5-hydroxytryptamine receptor

Overview
Name5-hydroxytryptamine receptor
Smed IDSMED30013518
Length (bp)1595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-hydroxytryptamine receptor (SMED30013518) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor (SMED30013518) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013518

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013518SMESG000031003.1 SmedASXL_001126SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013518SMESG000031003.1 dd_Smed_v6_48860_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 167.548 bits (423), Expect = 1.441e-45
Identity = 124/358 (34.64%), Postives = 183/358 (51.12%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + ++L++I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  +T  I G W+F  F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N + +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y +IY+     A+ +     F G       PR   ++  S+IA  LN I  ++  +      S++L  E    + NI     S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I     +   IP+WV  TFLWL
Sbjct:   76 YGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYK----AARKSAAKHKFPGF------PR---VEPDSVIA--LNGIVKLQKEVEECANLSRLLKHE----RKNI-----SIFKREQKAA-----------------------------------TTLGIIVGAFTVCWLPFFLLSTARPFI--CGTSCSCIPLWVERTFLWL 372          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 167.162 bits (422), Expect = 1.521e-45
Identity = 124/358 (34.64%), Postives = 183/358 (51.12%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + ++L++I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  +T  I G W+F  F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N + +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y +IY+     A+ +     F G       PR   ++  S+IA  LN I  ++  +      S++L  E    + NI     S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I     +   IP+WV  TFLWL
Sbjct:   76 YGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYK----AARKSAAKHKFPGF------PR---VEPDSVIA--LNGIVKLQKEVEECANLSRLLKHE----RKNI-----SIFKREQKAA-----------------------------------TTLGIIVGAFTVCWLPFFLLSTARPFI--CGTSCSCIPLWVERTFLWL 372          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR7 (5-hydroxytryptamine receptor 7 [Source:HGNC Symbol;Acc:HGNC:5302])

HSP 1 Score: 167.162 bits (422), Expect = 3.611e-45
Identity = 124/358 (34.64%), Postives = 183/358 (51.12%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + ++L++I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  +T  I G W+F  F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N + +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y +IY+     A+ +     F G       PR   ++  S+IA  LN I  ++  +      S++L  E    + NI     S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I     +   IP+WV  TFLWL
Sbjct:   76 YGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYK----AARKSAAKHKFPGF------PR---VEPDSVIA--LNGIVKLQKEVEECANLSRLLKHE----RKNI-----SIFKREQKAA-----------------------------------TTLGIIVGAFTVCWLPFFLLSTARPFI--CGTSCSCIPLWVERTFLWL 372          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 159.458 bits (402), Expect = 8.016e-43
Identity = 104/340 (30.59%), Postives = 170/340 (50.00%), Query Frame = 3
Query:  141 QISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNF-RPVFLMICIIWILSGLISIPPVTGWKEPFHLGH---CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKN-SLNTNNRFSQVLTTENSFYKYNIND--DILSVSKLQQRK------SDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVP 1121
            Q+  + LL  +    ++GN  ++ A+ L R L   +N L+ SLA +D +V+V V+P A + Q+   W   + TCD FI LD+L CT+SIL+LC I++DRY+ I  P+        R    +I + W++  LISIPP+ GW+ P        CT S+   Y  Y+T GAFYIPL++ML+LY RI++ A+   +         G   T++G       + S     +N     +N  L   ++    L    +  + +     +++ V ++   K      S+      +      K+++  +      +  E K +KTLGI+MG F  CW PFF + L++P
Sbjct:   36 QVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGAD-TRHGASPAPQPKKS-----VNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLP 369          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 147.902 bits (372), Expect = 4.166e-39
Identity = 112/363 (30.85%), Postives = 168/363 (46.28%), Query Frame = 3
Query:   99 SNRSFNFERYSVL--------SQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPL--SQYGTNFRPVFLMICIIWILSGLISIPPV--TGWKEPFHLGHCTYSES-LWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYK------YNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIK 1130
            SNRS N    S           +ISLA +LSVI + T++ N  ++  + L RKLHTP+N L+ SLA +D LV++ V+P +I   I   W F +  CD ++  DI  CTASIL+LC I++DRY+ I   L  S+  T       MI I+W +S  ISIPP+     K    +  C  + S + Y  Y+T GAFYIP V+++ILY RIY+                         R+ IL   SL         L+  S  ++         E   +       +N     L+ S L++++   +           + +KA +                LGI++G F  CW PFF + L++P+ +
Sbjct:   16 SNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAA-TMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYR-----------------------AARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAA-----------RERKATK---------------ILGIILGAFIICWLPFFVVSLVLPICR 328          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 149.058 bits (375), Expect = 1.078e-39
Identity = 100/336 (29.76%), Postives = 176/336 (52.38%), Query Frame = 3
Query:  144 ISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTP-SNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLN----AIPLVKNSLNTNNRFSQVLTTENSFYK-----YNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLI 1115
            ++++++L+V+ +  I GNLL+++ V+  RKL     N L+ SLA +D LV + V+P  +  +I G W      C+ ++ LD+L  TASIL++C IS+DRYF++  PL+ Y     P  +F+ I + WI+S LI +PP+ GW+     G C+ S  L Y  Y++LG+FYIP+V+++I+Y++IY +  + ++           +  +   RD  L   ++ +S          L +NS    +   +V+T  +   K       I++++          ++ +    SD    ++ KK  +K   K    E +A   LGI++  F   W PFF + +I
Sbjct:   23 LTISSMLTVMLL-IIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLT-YPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERAEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSR----------QRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVI 346          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 147.902 bits (372), Expect = 3.733e-39
Identity = 106/344 (30.81%), Postives = 176/344 (51.16%), Query Frame = 3
Query:  144 ISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTP-SNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDES------------DMTN-----SDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLI 1115
            ++++++L+V+ +  I GNLL+++ V+  RKL     N L+ SLA +D LV + V+P  +  +I G W      C+ ++ LD+L  TASIL++C IS+DRYF++  PL+ Y     P  +F+ I + WI+S LI +PP+ GW+     G C+ S  L Y  Y++LG+FYIP+V+++I+Y++IY +  + ++           +  +   RD  L   + I S  N    ++  L  N+        E+   K   N D+++    Q RK  E             D  +     SD    ++ KK  +K   K    E +A   LGI++  F   W PFF + +I
Sbjct:   23 LTISSMLTVMLL-IIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLT-YPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERAEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSR----------QRLKETERRDHTLNMLT-IRSSTNERYNMEYELEENSD-----PIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVI 348          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 139.043 bits (349), Expect = 7.021e-36
Identity = 111/348 (31.90%), Postives = 180/348 (51.72%), Query Frame = 3
Query:  168 VICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKG-YWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS---QYGTNFRPVFLMICIIWILSGLISIPPVTG---WKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            VI   T+VGN L+++AVF  R L    N  + SLA SD  VA+ V+P  ++T + G  WL     C FF   DILLCT+SILNLC I++DRY+ I  P++   +  T F  V ++I I+WILS LIS+PP+ G   W+E      C  S    +  ++  G+F++PL+VM+++Y +I+  A++  + N      M +   +N   D   ++ S+  + + +     +S        +  TT++  Y  N +  +    K++  K DE +       N     + R+K     +  E +A KT+ +++  F+FCW PFF   +I P  +T  ++ K     V + F WL
Sbjct:   55 VIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKF--VCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRI---QNAEGDDDYRKMSIKRASVESAR--TSSRTDGGSLPKDETTKHMKYHNNGSCKV----KVKDVKEDEGNP------NPTAVLRKREK---ISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAK-----VEQAFTWL 377          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 139.043 bits (349), Expect = 7.484e-36
Identity = 111/348 (31.90%), Postives = 180/348 (51.72%), Query Frame = 3
Query:  168 VICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKG-YWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS---QYGTNFRPVFLMICIIWILSGLISIPPVTG---WKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            VI   T+VGN L+++AVF  R L    N  + SLA SD  VA+ V+P  ++T + G  WL     C FF   DILLCT+SILNLC I++DRY+ I  P++   +  T F  V ++I I+WILS LIS+PP+ G   W+E      C  S    +  ++  G+F++PL+VM+++Y +I+  A++  + N      M +   +N   D   ++ S+  + + +     +S        +  TT++  Y  N +  +    K++  K DE +       N     + R+K     +  E +A KT+ +++  F+FCW PFF   +I P  +T  ++ K     V + F WL
Sbjct:   63 VIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKF--VCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRI---QNAEGDDDYRKMSIKRASVESAR--TSSRTDGGSLPKDETTKHMKYHNNGSCKV----KVKDVKEDEGNP------NPTAVLRKREK---ISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAK-----VEQAFTWL 385          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 139.043 bits (349), Expect = 7.938e-36
Identity = 111/348 (31.90%), Postives = 180/348 (51.72%), Query Frame = 3
Query:  168 VICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKG-YWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS---QYGTNFRPVFLMICIIWILSGLISIPPVTG---WKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            VI   T+VGN L+++AVF  R L    N  + SLA SD  VA+ V+P  ++T + G  WL     C FF   DILLCT+SILNLC I++DRY+ I  P++   +  T F  V ++I I+WILS LIS+PP+ G   W+E      C  S    +  ++  G+F++PL+VM+++Y +I+  A++  + N      M +   +N   D   ++ S+  + + +     +S        +  TT++  Y  N +  +    K++  K DE +       N     + R+K     +  E +A KT+ +++  F+FCW PFF   +I P  +T  ++ K     V + F WL
Sbjct:   66 VIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKF--VCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRI---QNAEGDDDYRKMSIKRASVESAR--TSSRTDGGSLPKDETTKHMKYHNNGSCKV----KVKDVKEDEGNP------NPTAVLRKREK---ISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAK-----VEQAFTWL 388          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 181.8 bits (460), Expect = 3.253e-50
Identity = 125/364 (34.34%), Postives = 186/364 (51.10%), Query Frame = 3
Query:  135 LSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMIC--IIWILSGLISIPP--VTGWKEPFHLGH--CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNI------NDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            L+ I ++ +L ++ +GT+VGN+L+ IAV +VRKL  P N L+ SLA SD  VA+ V+P A++ ++   W F    CD ++  D+L CTASILNLC IS+DRY  I +PL +YG    P  +M+C  I+W+ +  IS+PP  + G +     G   CT  ++  YQ YATLG+FYIPL VML +Y +I++ A++I       QT +       G             S   A PL    L ++    +  +  N+   Y+           L+        S  + +  S +   ++ + A++K          KA  TLGI+M  FT CW PFF L LI P        T ++P  +   FLWL
Sbjct:  160 LTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPL-EYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGS-----------PSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEK----------KASTTLGIIMSAFTVCWLPFFILALIRP------FETMHVPASLSSLFLWL 495          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0085746)

HSP 1 Score: 181.8 bits (460), Expect = 3.253e-50
Identity = 125/364 (34.34%), Postives = 186/364 (51.10%), Query Frame = 3
Query:  135 LSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMIC--IIWILSGLISIPP--VTGWKEPFHLGH--CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNI------NDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            L+ I ++ +L ++ +GT+VGN+L+ IAV +VRKL  P N L+ SLA SD  VA+ V+P A++ ++   W F    CD ++  D+L CTASILNLC IS+DRY  I +PL +YG    P  +M+C  I+W+ +  IS+PP  + G +     G   CT  ++  YQ YATLG+FYIPL VML +Y +I++ A++I       QT +       G             S   A PL    L ++    +  +  N+   Y+           L+        S  + +  S +   ++ + A++K          KA  TLGI+M  FT CW PFF L LI P        T ++P  +   FLWL
Sbjct:  160 LTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPL-EYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGS-----------PSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEK----------KASTTLGIIMSAFTVCWLPFFILALIRP------FETMHVPASLSSLFLWL 495          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: TyrR (gene:FBgn0038542 transcript:FBtr0344474)

HSP 1 Score: 151.369 bits (381), Expect = 5.213e-39
Identity = 76/182 (41.76%), Postives = 116/182 (63.74%), Query Frame = 3
Query:  144 ISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPL--SQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFH--LGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRI 677
            I L A+ +   V T++GN L+I+A+   R+L T +NC V SLA +D LV + V+P A+   + G W      CD +I LD+LLCTASIL+LC IS+DRY  + +PL  S+   + R   +MI I+W+L+  I+ PP+ GW EP    L  C Y+++  Y  ++ +G+F+IP+ VM+ +Y+RI
Sbjct:  117 IILIAVFATFIVVTVIGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSAMGSFFIPMAVMIYVYARI 298          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: TyrR (gene:FBgn0038542 transcript:FBtr0083532)

HSP 1 Score: 151.369 bits (381), Expect = 5.213e-39
Identity = 76/182 (41.76%), Postives = 116/182 (63.74%), Query Frame = 3
Query:  144 ISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPL--SQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFH--LGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRI 677
            I L A+ +   V T++GN L+I+A+   R+L T +NC V SLA +D LV + V+P A+   + G W      CD +I LD+LLCTASIL+LC IS+DRY  + +PL  S+   + R   +MI I+W+L+  I+ PP+ GW EP    L  C Y+++  Y  ++ +G+F+IP+ VM+ +Y+RI
Sbjct:  117 IILIAVFATFIVVTVIGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSAMGSFFIPMAVMIYVYARI 298          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: TyrR (gene:FBgn0038542 transcript:FBtr0346161)

HSP 1 Score: 151.369 bits (381), Expect = 5.213e-39
Identity = 76/182 (41.76%), Postives = 116/182 (63.74%), Query Frame = 3
Query:  144 ISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPL--SQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFH--LGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRI 677
            I L A+ +   V T++GN L+I+A+   R+L T +NC V SLA +D LV + V+P A+   + G W      CD +I LD+LLCTASIL+LC IS+DRY  + +PL  S+   + R   +MI I+W+L+  I+ PP+ GW EP    L  C Y+++  Y  ++ +G+F+IP+ VM+ +Y+RI
Sbjct:  117 IILIAVFATFIVVTVIGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSAMGSFFIPMAVMIYVYARI 298          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr7b (5-hydroxytryptamine (serotonin) receptor 7b [Source:ZFIN;Acc:ZDB-GENE-091118-105])

HSP 1 Score: 169.088 bits (427), Expect = 4.208e-47
Identity = 121/371 (32.61%), Postives = 181/371 (48.79%), Query Frame = 3
Query:   96 KSNRSFNFERY---SVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQI-KGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYG-TNFRPVFLMICIIWILSGLISIPPVTGWKEPFH-LGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            +SN S   +R     +   + +  +LS I   T++GN L++IAV +V+KL  PSN L+ SLA +D  VAVAV+PFAI+T +  G WLF E  C+ FI +D++ CTASI+ LC IS+DRY  I +PL+     N + +  MI  +W++S  I++PP  GW    +  G C  S+ + Y  Y+T  AFYIP+VVML +Y +I++            ++     FT   P  L        A P  A                 L T + F  + + +                    S+ ++++     R++  +     E KA  TLG++MG F+FCW PFF      P I     N    P+W+    LWL
Sbjct:    3 RSNGSCGEQRTLDPDLTKTVIVGLMLSSITAVTVMGNTLVVIAVCVVKKLRQPSNYLLVSLAIADLSVAVAVMPFAIVTDLTGGVWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIVGVWLVSASITLPPFCGWAHNVNTAGVCLISQDVGYTLYSTAVAFYIPMVVMLFMYYKIFK---------AARRSGAKHNFTSLPPIQL--------ACPEPA-----------------LATVDGFCMHGMKNG-----------------ATSEEFSALSCLLNRERRSASIFRREQKAATTLGVIMGVFSFCWLPFFLFTTARPFICGLLCNCA--PVWLERVLLWL 320          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 169.859 bits (429), Expect = 4.480e-47
Identity = 112/357 (31.37%), Postives = 179/357 (50.14%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQI-KGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYG-TNFRPVFLMICIIWILSGLISIPPVTGWKEPFH-LGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLW 1187
            ++   +I +  +L++I   T++GN+L++IAV +V+KL  PSN L+ SLA +D  VA+ V+PF I+T +  G WLF E  C+ FI +D++ CTASI+ LC IS+DRY  I +PL+     N + +  MI  +W++S  I++PP  GW +  +  G C  S+   Y  Y+T  AFYIP++VML +Y +I++            ++    +FT    R+    +   +AS          +L       Q        +   + ++  ++S+L  R+             +I   K  QK           A  TLG+++G F  CW PFF L    P I    +    IP+W+  T LW
Sbjct:   48 FTAAEKIVIGLMLAIITTVTVIGNMLVVIAVCVVKKLRQPSNYLLVSLAVADLSVAIVVMPFVIVTDLTGGKWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIFGVWLVSASITLPPFCGWAKNVNTAGVCLISQDFGYTIYSTAVAFYIPMIVMLFMYYKIFK---------AARKSGAKHRFTDFSRRE----RLETVAS---------EALRMQGLKPQ--------HTPGVAEECAALSRLLSRERQ-----------NISIFKREQK-----------AATTLGVIVGVFGICWLPFFILSTARPFI--CGVKCSCIPIWLERTLLW 350          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr7a (5-hydroxytryptamine (serotonin) receptor 7a [Source:ZFIN;Acc:ZDB-GENE-130530-666])

HSP 1 Score: 170.244 bits (430), Expect = 7.049e-47
Identity = 118/376 (31.38%), Postives = 183/376 (48.67%), Query Frame = 3
Query:   75 EMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNG-PRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            EM+  +  +  +     Y  + ++ +  +L+++ + TI GN+L++I+V  V+KL  PSN L+ SLA +D  VA+AV+PF  IT  I G W+F +F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N   +  M+  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML++Y RI++                  K T  G PRD   ++ + +     AI L +  +    R  ++L ++            +S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I         IP+WV  T LWL
Sbjct:   69 EMMEVANGTRCAEQILSYGEVEKVLIGGVLTMLTLITICGNMLVVISVCFVKKLRQPSNYLIVSLALADLSVALAVMPFVSITDLIGGRWIFGKFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGWCMAKMVLSVWLLSASITLPPLFGWAQNVNDDRVCLISQDFGYTIYSTAVAFYIPMTVMLVMYYRIFR-----------AAKLSAAKHTITGFPRDGA-EEPTGVDCVTVAIKL-QREVEECARLPRILCSDRRS---------ISIFKREQKAA-----------------------------------ATLGIVVGAFTICWLPFFLLSTARPFI--CGTECSCIPLWVERTLLWL 385          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr7a (5-hydroxytryptamine (serotonin) receptor 7a [Source:ZFIN;Acc:ZDB-GENE-130530-666])

HSP 1 Score: 169.859 bits (429), Expect = 1.060e-46
Identity = 121/379 (31.93%), Postives = 179/379 (47.23%), Query Frame = 3
Query:   75 EMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDE----SDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            EM+  +  +  +     Y  + ++ +  +L+++ + TI GN+L++I+V  V+KL  PSN L+ SLA +D  VA+AV+PF  IT  I G W+F +F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N   +  M+  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML++Y RI++ A                                                    + S    T   F +     D ++V+   QR+ +E      +  SD   SI   K  QK           A  TLGI++G FT CW PFF L    P I         IP+WV  T LWL
Sbjct:   69 EMMEVANGTRCAEQILSYGEVEKVLIGGVLTMLTLITICGNMLVVISVCFVKKLRQPSNYLIVSLALADLSVALAVMPFVSITDLIGGRWIFGKFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGWCMAKMVLSVWLLSASITLPPLFGWAQNVNDDRVCLISQDFGYTIYSTAVAFYIPMTVMLVMYYRIFRAA----------------------------------------------------KLSAAKHTITGFPREPTGVDCVTVAIKLQREVEECARLPRILCSDR-RSISIFKREQK-----------AAATLGIVVGAFTICWLPFFLLSTARPFI--CGTECSCIPLWVERTLLWL 381          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr7a (5-hydroxytryptamine (serotonin) receptor 7a [Source:ZFIN;Acc:ZDB-GENE-130530-666])

HSP 1 Score: 169.474 bits (428), Expect = 1.171e-46
Identity = 121/379 (31.93%), Postives = 179/379 (47.23%), Query Frame = 3
Query:   75 EMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDE----SDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            EM+  +  +  +     Y  + ++ +  +L+++ + TI GN+L++I+V  V+KL  PSN L+ SLA +D  VA+AV+PF  IT  I G W+F +F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N   +  M+  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML++Y RI++ A                                                    + S    T   F +     D ++V+   QR+ +E      +  SD   SI   K  QK           A  TLGI++G FT CW PFF L    P I         IP+WV  T LWL
Sbjct:   57 EMMEVANGTRCAEQILSYGEVEKVLIGGVLTMLTLITICGNMLVVISVCFVKKLRQPSNYLIVSLALADLSVALAVMPFVSITDLIGGRWIFGKFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGWCMAKMVLSVWLLSASITLPPLFGWAQNVNDDRVCLISQDFGYTIYSTAVAFYIPMTVMLVMYYRIFRAA----------------------------------------------------KLSAAKHTITGFPREPTGVDCVTVAIKLQREVEECARLPRILCSDR-RSISIFKREQK-----------AAATLGIVVGAFTICWLPFFLLSTARPFI--CGTECSCIPLWVERTLLWL 369          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: exd2 (exonuclease 3'-5' domain containing 2 [Source:Xenbase;Acc:XB-GENE-5752408])

HSP 1 Score: 175.252 bits (443), Expect = 1.475e-48
Identity = 121/358 (33.80%), Postives = 174/358 (48.60%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + A+LS+I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VA+AV+PF  +T  I G W+F    C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N R +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y RI+                      K   R     +F+ +  P  +  ++  S N N                      +   K  +  ++ S +  +D  N I   K  QK           A  TLGI++G FT CW PFF L    P I         IP+W+  TFLWL
Sbjct:   73 YGHIEKLVIGAILSLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAIAVMPFVSVTDLIGGEWIFGHVFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGRCMAKMILCVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYRIF----------------------KAAKRSAAKHKFTGLPRPEESEGMI--SANGN----------------------VKTHKESEECTNLSKLLRNDRKN-ISIFKREQK-----------AATTLGIIVGAFTICWLPFFLLSTARPFI--CGTECSCIPLWLERTFLWL 370          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 160.999 bits (406), Expect = 1.509e-43
Identity = 110/355 (30.99%), Postives = 178/355 (50.14%), Query Frame = 3
Query:  120 ERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNF-RPVFLMICIIWILSGLISIPPVTGWKEPFHLGH---CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTE-----NSFYKYNINDDILSVSKLQQRKSDES--DMTNSDYWNSI------KSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKT 1133
            E  ++  QI  +  L  + +  I GN  +I A+ L R L T +N L+ SLA +D +V+V V+P A   Q+   W   + TCD FI LD+L CT+SIL+LC I++DRY+ I  P+        R   ++I I WI+   ISIPP+ GW+ P        C  SE   Y  Y+T GAFYIPL++ML+LY +I++ A+   +          +  T             L  SP  A+   K++   +  + + +  +     N   ++  +  +L + ++    + +S  D+ N  +  ++      ++ +A        +  E K +KTLGI+MG F FCW PFF + L++P  +T
Sbjct:   22 EEVALSYQIVTSLFLGTLILCAIFGNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGWRTPEDRSDPNACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFRIRKTVKKAEKKKVADT------------CLSVSP--AVAERKSNGEPSKNWKRTVEPKPSACVNGAIRHGEDGAVLEIIEVHHYVNSKSHLDLPNHAHDMAVAPCSEKRNDRATDAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCET 362          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 145.976 bits (367), Expect = 2.333e-38
Identity = 115/377 (30.50%), Postives = 186/377 (49.34%), Query Frame = 3
Query:   78 MINSSLKSNRSFNFERY---------SVLS-QISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPL--SQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFH--LGHCTY-SESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKN-------SLNTNNRFSQVLTTEN----SFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIK 1130
            ++NS+++  R  +F+R          ++L  +I+LA LLS+I + T++ N+ +II + + RKLHTP+N L+ SLA +D LV++ V+P +I   +   W F +  CD ++  DI  CTASIL+LC I++DRY+ I   L  +++ T  R   +MI ++WI+S  ISIPP+   +   H  L  CT  ++ + Y  Y+T GAFYIP V++++LY +IY                          R  ILK  S+         L+         S+N N       T+E     +  K  + D I+   +L                ++ + KKA +               TLGI++G F  CW PFF + L++P+ +
Sbjct:    3 LVNSTIEEFRMASFQRLLHGRGQEESTLLGLKITLAVLLSIITLATLLSNVFVIITIVMTRKLHTPANYLIGSLAFTDLLVSILVMPISIAYTVTHTWTFGQIVCDIWLLSDITCCTASILHLCVIALDRYWAITDALEYTKHRTARRAA-VMILVVWIISICISIPPLFWRQAKAHEELTVCTINTDQISYTIYSTCGAFYIPTVLLILLYGKIYI-----------------------AARSRILKPPSIYGKRFTTAQLIPGSTGSSFCSINANVHMEHPHTSETPVCINHIKIKLADSIIERKRL----------------SAAREKKATK---------------TLGIILGAFIVCWLPFFVVSLVLPICR 324          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: ADRA2B (adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485811])

HSP 1 Score: 143.665 bits (361), Expect = 2.869e-37
Identity = 102/357 (28.57%), Postives = 184/357 (51.54%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPV---TGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMK---FTKNGPRDL----ILKQFSLIASPLN----------AIPLVKNSLNTNNRFSQV--LTTENSFYKYN------INDDILSVSK--LQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFF 1100
            YS+ +   +AA+++ + + TI GN+L+IIAV   R L  P N  + SLA +D LVA  +IPF++  ++ GYW F +  C+ ++ LD+L CT+SI++LC IS+DRY+++ Q + +Y +   P  +  +I I+W L+ LIS+PP+      K+      C  +E  WY   +++ +F+ P ++M+++Y RIY +AK+  + N+ ++    M    F++     L       Q  +I+S              +P++ ++    N  S+   L  +    K+       + D + +V    L  + + +SD++++      KS   R+K               L +++G F  CWFPFF
Sbjct:   12 YSIQATAVIAAIITFLVLFTIFGNVLVIIAVLTSRSLKAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFGKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAI-EYNSKRTPKRIKCIILIVWTLAALISLPPLIYKGKSKDQNAKPECKLNEEPWYILSSSICSFFAPCLIMILVYLRIYLIAKRRNRKNSTDKKLKKMAPGLFSRTNKHSLNSSHTQTQCGIISSQEKTGLALDDLHCGVPVLSSTREERNGHSESFGLQPQGENLKHTNGCEPAVMDTVATVKGVMLMPKGAKDSDLSSAKK----KSYINREKRF----------TFVLAVVIGVFVLCWFPFF 353          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: ENSXETT00000011711.1 (adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488806])

HSP 1 Score: 144.436 bits (363), Expect = 4.420e-37
Identity = 103/337 (30.56%), Postives = 166/337 (49.26%), Query Frame = 3
Query:  108 SFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGT--NFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH--CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTL 1106
            S N  R  +L   +L A +SV     I+GN+++II+V   ++L  P+N L+ +LA +D L++  V+PF+   +I GYW+F    CD +  +D+L CTASI +LC ISIDRY  +   L +Y T    +   L +  +W+ S +ISI P+ GWKEP       C  +  ++Y  +++L +FYIPL+V+L++Y R+Y                +  + TKN        +  ++   +++  L   +L  + R  Q  +  NS  + N     LS+  L+                  + KKA +               TLGI++G F  CW PFFT+
Sbjct:   38 SVNLTRAMLLG-FTLGAFISV----AIIGNIMVIISVVTNKQLRIPTNYLIVNLAIADLLLSSTVLPFSATKEIVGYWVFGRILCDVWAAMDVLCCTASIFSLCTISIDRYIGVRHSL-RYPTIVTRKRTILALLGVWMFSTVISIGPLLGWKEPAPPDTYVCEITTEIFYAIFSSLASFYIPLIVILVMYCRVY---------------VVAKRITKN-------LEAGVMKERMDSKEL---TLRIHCRNKQDDSPNNSKVQNNQPRSALSLKLLKFS----------------REKKAAK---------------TLGIVVGMFILCWLPFFTV 312          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 165.236 bits (417), Expect = 3.878e-45
Identity = 110/364 (30.22%), Postives = 178/364 (48.90%), Query Frame = 3
Query:   84 NSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNF-RPVFLMICIIWILSGLISIPPVTGWKEP---FHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASP-----LNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDE------SDMTNSDYWNSI---KSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVP 1121
            N +  SN +F++       Q+  + LL  +    ++GN  ++ A+ L R L   +N L+ SLA +D +V+V V+P A + Q+   W   + TCD FI LD+L CT+SIL+LC I++DRY+ I  P+        R    +I + W++  LISIPP+ GW+ P    +   CT S+   Y  Y+T GAFYIPL++ML+LY RI++              F   K  K   +      F   ++P     LN  P   +   +    +      N   +   +D  L V ++ +  + +      S+   + Y  +    K+++  +      +  E K +KTLGI+MG F  CW PFF + L++P
Sbjct:   24 NDTGLSNVTFSY-------QVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFR-----------AARFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLP 369          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 164.081 bits (414), Expect = 1.482e-44
Identity = 120/358 (33.52%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + ++L++I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  +T  I G W+F  F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N + +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y +IY+     A+ +     F G  F +  P  +I          LN +  ++  +      S++L  E    + NI     S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I     +   IP+WV  T LWL
Sbjct:   79 YGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYK----AARKSAAKHKFSG--FPRVQPESVI---------SLNGVVKLQKEVEECANLSRLLKHE----RKNI-----SIFKREQKAA-----------------------------------TTLGIIVGAFTVCWLPFFLLSTARPFI--CGTSCSCIPLWVERTCLWL 375          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 164.081 bits (414), Expect = 1.692e-44
Identity = 120/358 (33.52%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + ++L++I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  +T  I G W+F  F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N + +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y +IY+     A+ +     F G  F +  P  +I          LN +  ++  +      S++L  E    + NI     S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I     +   IP+WV  T LWL
Sbjct:   79 YGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYK----AARKSAAKHKFSG--FPRVQPESVI---------SLNGVVKLQKEVEECANLSRLLKHE----RKNI-----SIFKREQKAA-----------------------------------TTLGIIVGAFTVCWLPFFLLSTARPFI--CGTSCSCIPLWVERTCLWL 375          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr7 (5-hydroxytryptamine (serotonin) receptor 7 [Source:MGI Symbol;Acc:MGI:99841])

HSP 1 Score: 164.081 bits (414), Expect = 2.330e-44
Identity = 120/358 (33.52%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + ++L++I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  +T  I G W+F  F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N + +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y +IY+     A+ +     F G  F +  P  +I          LN +  ++  +      S++L  E    + NI     S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I     +   IP+WV  T LWL
Sbjct:   79 YGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYK----AARKSAAKHKFSG--FPRVQPESVI---------SLNGVVKLQKEVEECANLSRLLKHE----RKNI-----SIFKREQKAA-----------------------------------TTLGIIVGAFTVCWLPFFLLSTARPFI--CGTSCSCIPLWVERTCLWL 375          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1f (5-hydroxytryptamine (serotonin) receptor 1F [Source:MGI Symbol;Acc:MGI:99842])

HSP 1 Score: 150.599 bits (379), Expect = 3.133e-40
Identity = 108/350 (30.86%), Postives = 176/350 (50.29%), Query Frame = 3
Query:  138 SQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQT------YATLGAFYIPLVVMLILYSRIYQXXXX----XXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTK 1151
            S+I ++  LS + + T   N L+I A+ + RKLH P+N L+ SLA +DFLVAV V+PF+I+  ++  W+  +  CD ++ +DI+ CT SIL+L  I++DRY  I   + +Y     P    +MI I+W++S  IS+PP+  W+   H G     E +          Y+T GAFYIPLV++LILY +IY+ A+        +  + +   G  F ++G + + L   S +        L K+  + +  F ++ +T                      KS  S++ +   W   K    R++          KA  TLG+++G F  CW PFF  +L+V V +   I+ +
Sbjct:   22 SKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALDRYRAITDAV-EYARKRTPRHAGIMITIVWVISVFISMPPLF-WR---HQGTSRDDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIKEELNGQVFLESGEKSIKLVSTSYM--------LEKSLSDPSTDFDRIHSTV---------------------KSPRSELKHEKSWRRQKISGTRER----------KAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEE 327          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|P20905|5HT1R_DROME (5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster OX=7227 GN=5-HT7 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.261e-49
Identity = 125/364 (34.34%), Postives = 186/364 (51.10%), Query Frame = 3
Query:  135 LSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMIC--IIWILSGLISIPP--VTGWKEPFHLGH--CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNI------NDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            L+ I ++ +L ++ +GT+VGN+L+ IAV +VRKL  P N L+ SLA SD  VA+ V+P A++ ++   W F    CD ++  D+L CTASILNLC IS+DRY  I +PL +YG    P  +M+C  I+W+ +  IS+PP  + G +     G   CT  ++  YQ YATLG+FYIPL VML +Y +I++ A++I       QT +       G             S   A PL    L ++    +  +  N+   Y+           L+        S  + +  S +   ++ + A++K          KA  TLGI+M  FT CW PFF L LI P        T ++P  +   FLWL
Sbjct:  160 LTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPL-EYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGS-----------PSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEK----------KASTTLGIIMSAFTVCWLPFFILALIRP------FETMHVPASLSSLFLWL 495          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|P34969|5HT7R_HUMAN (5-hydroxytryptamine receptor 7 OS=Homo sapiens OX=9606 GN=HTR7 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 1.734e-44
Identity = 124/358 (34.64%), Postives = 183/358 (51.12%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + ++L++I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  +T  I G W+F  F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N + +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y +IY+     A+ +     F G       PR   ++  S+IA  LN I  ++  +      S++L  E    + NI     S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I     +   IP+WV  TFLWL
Sbjct:   76 YGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYK----AARKSAAKHKFPGF------PR---VEPDSVIA--LNGIVKLQKEVEECANLSRLLKHE----RKNI-----SIFKREQKAA-----------------------------------TTLGIIVGAFTVCWLPFFLLSTARPFI--CGTSCSCIPLWVERTFLWL 372          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q64264|5HT1A_MOUSE (5-hydroxytryptamine receptor 1A OS=Mus musculus OX=10090 GN=Htr1a PE=2 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 2.713e-44
Identity = 110/364 (30.22%), Postives = 178/364 (48.90%), Query Frame = 3
Query:   84 NSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNF-RPVFLMICIIWILSGLISIPPVTGWKEP---FHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASP-----LNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDE------SDMTNSDYWNSI---KSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVP 1121
            N +  SN +F++       Q+  + LL  +    ++GN  ++ A+ L R L   +N L+ SLA +D +V+V V+P A + Q+   W   + TCD FI LD+L CT+SIL+LC I++DRY+ I  P+        R    +I + W++  LISIPP+ GW+ P    +   CT S+   Y  Y+T GAFYIPL++ML+LY RI++              F   K  K   +      F   ++P     LN  P   +   +    +      N   +   +D  L V ++ +  + +      S+   + Y  +    K+++  +      +  E K +KTLGI+MG F  CW PFF + L++P
Sbjct:   24 NDTGLSNVTFSY-------QVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFR-----------AARFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLP 369          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q0EAB6|5HT1A_HORSE (5-hydroxytryptamine receptor 1A OS=Equus caballus OX=9796 GN=HTR1A PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.105e-43
Identity = 110/350 (31.43%), Postives = 172/350 (49.14%), Query Frame = 3
Query:  141 QISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNF-RPVFLMICIIWILSGLISIPPVTGWKEPFHLGH---CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLN-----------TNNRFSQVLTTENSFYKYNIND--DILSVSKLQQRK------SDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVP 1121
            Q+  + LL  +    ++GN  ++ A+ L R L   +N L+ SLA +D +V+V V+P A + Q+   W   + TCD FI LD+L CT+SIL+LC I++DRY+ I  P+        R    +I + W++  LISIPP+ GW+ P        CT S+   Y  Y+T GAFYIPL++ML+LY RI++ A+   +           K  K G          L ASP    P  K S N             N+   VL    +  + +     +++ V ++   K      S+   +  +  +   K+++  +      +  E K +KTLGI+MG F  CW PFF + L++P
Sbjct:   36 QVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLVGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVK-------KVEKKG------ADSRLGASP---APQRKKSANGELGSREWRQGVENKAGGVLCANGAVRQGDDGAALEVIEVHRMGNSKEHLPLPSEAGAIPCAPAFFEKKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLP 369          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|P32304|5HT7R_MOUSE (5-hydroxytryptamine receptor 7 OS=Mus musculus OX=10090 GN=Htr7 PE=2 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 1.183e-43
Identity = 120/358 (33.52%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ + ++L++I + TI GN L++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  +T  I G W+F  F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N + +  MI  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VML +Y +IY+     A+ +     F G  F +  P  +I          LN +  ++  +      S++L  E    + NI     S+ K +Q+ +                                    TLGI++G FT CW PFF L    P I     +   IP+WV  T LWL
Sbjct:   79 YGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYK----AARKSAAKHKFSG--FPRVQPESVI---------SLNGVVKLQKEVEECANLSRLLKHE----RKNI-----SIFKREQKAA-----------------------------------TTLGIIVGAFTVCWLPFFLLSTARPFI--CGTSCSCIPLWVERTCLWL 375          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KUK9 (GCR019 OS=Schmidtea mediterranea OX=79327 GN=gcr019 PE=2 SV=1)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 380/383 (99.22%), Postives = 381/383 (99.48%), Query Frame = 3
Query:   51 QVFDFDVEEMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWLVRF 1199
            QVFDFDVEEMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVR+LHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQVAKKIAKNNNVNQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLSKKIISESKAIKTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL  F
Sbjct:    7 QVFDFDVEEMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRRLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQVAKKIAKNNNVNQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLSKKIISESKAIKTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWLGYF 389          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KUH0 (GCR026 OS=Schmidtea mediterranea OX=79327 GN=gcr026 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 5.307e-75
Identity = 160/363 (44.08%), Postives = 215/363 (59.23%), Query Frame = 3
Query:  120 ERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTEN-SFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWLVRF 1199
             +Y+   ++ +  +LS++   T+VGN+LIIIAV LV+KL TPSN L+ +LA SD LV+  V+PFAII Q+KG+W FSEF CD FI  D+LLCT SIL+LC ISIDRYF I +PL QY +      + +MI  +W+L+GLIS+PP  GWKE F    C YS+SL YQ YAT GAFY+PL +ML LY +I  +AK+IA                    +L LKQ S   S  N+  +  N   T NR   +  T N SF +++  +           KS+E   +       + ++ +   Y   K+ SE KAIKTLGI+MGCFT CW PFF +QL +P+ K    +  ++P  V E FLWL  F
Sbjct:   47 RKYTPTQEVFIGLILSILTFSTLVGNILIIIAVTLVKKLQTPSNLLIVNLATSDLLVSGIVLPFAIIFQLKGFWPFSEFLCDTFILSDVLLCTCSILSLCIISIDRYFAITRPL-QYASKRTTGRISIMIVSVWVLAGLISVPPFIGWKEKFVKNECKYSDSLSYQIYATFGAFYVPLFIMLFLYGKILLLAKRIA--------------------NLDLKQRSQKTSRRNSTVVFSNHNTTENRKPSLQQTMNCSFIQHDHRES--------NDKSEEMAFSKRYTITKLYNRTSMNLYKKSKLSSEVKAIKTLGIIMGCFTICWCPFFIIQLTIPIAKALGQDPNFVPPTVIEIFLWLGYF 380          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KU83 (GCR039 OS=Schmidtea mediterranea OX=79327 GN=gcr039 PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 5.584e-71
Identity = 150/360 (41.67%), Postives = 207/360 (57.50%), Query Frame = 3
Query:  123 RYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTN--FRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIP-LVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTK-YIPMWVRETFLWL 1190
            RY+   +  L  L +++  GT+ GN L+I A+ LV+KL  PSN L+ SLA SD LVA  +   A I    G+W FSE  CD FI LD+LLC++SILNLC ISIDRY  I +PL QYG+    + +FLMI ++W LSGLISIPPV GWKE F  G C YSE+L YQ YAT GAFYIPL++ML+LY RI++               +     K   +  + K+ S  AS +  +P L  +S+   N   ++  ++ S      ++D +   KL    + E  +    Y  + K+  A  K +            TLG++MGCFT CW PFF +QLI P++K  NI++  YI  W+++ FLWL
Sbjct:   27 RYNSTIEHLLIVLFTLLIFGTLGGNCLVISAIILVKKLQIPSNFLILSLAASDTLVAFFLPLVAFIQLRGGHWPFSETFCDIFICLDVLLCSSSILNLCAISIDRYLIITKPL-QYGSRRTLKQMFLMILLVWFLSGLISIPPVIGWKEGFIPGKCIYSENLGYQIYATCGAFYIPLIIMLVLYGRIFK---------------LTQSMVKKDAK--LHKRASRYASDVLKMPDLNDDSVVKENICKRLSLSDQS------SNDWMDSKKLAISNAKEEFI--KQYKKTEKANYAENKAI-----------TTLGVIMGCFTICWLPFFVIQLIKPLLKVANIDSNLYISQWIQDMFLWL 349          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KUF2 (GCR023 OS=Schmidtea mediterranea OX=79327 GN=gcr023 PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 5.083e-69
Identity = 145/346 (41.91%), Postives = 197/346 (56.94%), Query Frame = 3
Query:  120 ERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTN--FRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTK 1151
            ERY  ++ I L  +LS++ +GT++GN L+I A FLVR+L TP N L+ +LA +D +V   VIP A I QIKGYW+F+++ C  FI  D+LLCT+SILNLC IS+DRYF I QP  +Y T+   + + LMI I+W  S LIS+PP+ GW  P    +C YSE+L YQ YAT  AFY+PL+VML+LY RI++       N    Q  MG K TK  P+     + +   +  N   + K      ++F + L  E S    N+ D      K+   +SDE    NS    S   +    K +           KTLG++MGCFT CW PFF  QL+ PV     IN+K
Sbjct:   61 ERYHPVTLIVLYVMLSILFLGTVIGNSLMIFAFFLVRRLRTPCNMLIINLAVTDLMVGTLVIPMASIYQIKGYWIFNDYICSGFILFDVLLCTSSILNLCAISVDRYFIITQPF-RYATHRTTKRMLLMIFIVWAASALISVPPLFGWSNPKSKYYCDYSENLGYQIYATFIAFYLPLIVMLVLYGRIFR-----LANYIYVQEKMGGKETKQ-PKRNSNFRNNFNDNNNNNSIIDK------SKFEKKLNNEESNKHLNVPD-----IKINFAESDEELHHNSKTKFSSGKRNNEAKAI-----------KTLGVIMGCFTICWLPFFIFQLLNPVFSALGINSK 377          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KU92 (GCR052 OS=Schmidtea mediterranea OX=79327 GN=gcr052 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.875e-68
Identity = 150/364 (41.21%), Postives = 205/364 (56.32%), Query Frame = 3
Query:  111 FNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGY-WLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFL--MICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNIN-TKYIPMWVRETFLWL 1190
            F  E+Y V  ++ L  +  VI VG I GN L+I+A+FLV+KL TPSN L+ SLA SDF V+V V+P A+  Q+  + W FSE  CDFFI  D+LLCT+SILNLC ISIDRY  I +P+ QY     P+ +   I   WI+SGLISIPPV  WKEPF  G C  +E+L YQ YATLGAFYIPL++ML+LY RI+++A+ +A               ++  R L   Q +       ++P      N+     ++L            D     S+  Q    + + T +    + + KK            ESKAI TLG++MGCFT CW PFF +Q++ P++    ++  KY+  W  E FLWL
Sbjct:   47 FECEKYPVGMEVFLGMIFVVIVVGAIGGNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPM-QYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEPFRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLARNMA--------------QEDAKRKLGTGQMT--DEEQTSLPNQSGRTNSAEEDRKLLRF----------DPTQRPSEGNQGNGFDVEKTGTGPKTNPRKKKQSNN--------ESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFLWL 375          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: htr7a (5-hydroxytryptamine receptor 7-like [Source:NCBI gene;Acc:103024740])

HSP 1 Score: 173.711 bits (439), Expect = 8.608e-48
Identity = 118/379 (31.13%), Postives = 180/379 (47.49%), Query Frame = 3
Query:   99 SNRSFNFER---YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDM---------TNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            +NR+   E+   Y    ++ + A+L+ + + TI GN+L++++V  V+KL  PSN L+ SLA +D  VA+AV+PF  IT  I G W+F +F C+ FI +D++ CTASI+ LC ISIDRY  I +PL+     N   +  M+  +W+LS  I++PP+ GW +  +    C  S+   Y  Y+T  AFYIP+ VMLI+Y RIY+                               + S     +   P  + +        +    + S     +  D ++V+    R+ +E              S    SI   K  QK           A  TLG+++G F+FCW PFF L    P +         +P+WV  T LWL
Sbjct:   97 ANRTRCAEQILSYGGAEKVLIGAVLTALTLSTICGNVLVLVSVCFVKKLRQPSNYLIVSLALADLSVALAVMPFVSITDLIGGRWIFGQFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGWCMAKMVLSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMTVMLIMYYRIYRA-----------------------------AKLSAAKHTITGFPRPEKNRQDEVDEDEEDPGDGSEVSTGV--DCVTVAMKLHREVEECARLPRLLRGIGGGSSDRKSISIFKREQK-----------AAATLGVVVGAFSFCWLPFFLLSTTRPFV--CGTECSCVPLWVERTLLWL 431          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000007940.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:42941:45329:1 gene:ENSAMXG00000007726.2 transcript:ENSAMXT00000007940.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.392 bits (420), Expect = 7.118e-46
Identity = 130/402 (32.34%), Postives = 191/402 (47.51%), Query Frame = 3
Query:   51 QVFDFDVEEMIN------SSLKSNRSFNFER---YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDR----YFTILQPLS----QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDE---SDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Q+ D  V ++ +      SSL  N +   E+   Y    ++ +  +L+++   TI GNLL++I+V  V+KL  PSN L+ SLA +D  VAVAV+PF  IT  I G W+F    C+ FI +D++ CTASI+ LC ISIDR    Y  I +PL+    Q G     + L    +W+LS  I++PP+ GW +  +  + C  S+ L Y  Y+T  AFYIP+ VML +Y RIY+                                 + ++   +AI ++    + +NR                 D + +V KLQ+   D    S +  +D  N I   K  QK           A  TLGI++G F+ CW PFF L    P I    +    +P+WV  T LWL
Sbjct:   11 QILDLRVGKVQDRATVPASSLLENETGCGEQILSYGRAEKVLIGGVLTMLTFLTICGNLLVVISVCFVKKLKQPSNYLIVSLAVADLSVAVAVMPFVSITDLIGGQWIFGRVFCNVFIAMDVMCCTASIMTLCVISIDRCLVVYLGITKPLTYPVRQSGKCMAKIVLS---VWLLSASITLPPLFGWAQNVNDDNVCLISQDLGYTVYSTAVAFYIPMSVMLFMYYRIYRA--------------------------------AKVSVAKHAIAIMPK--DEDNRV----------------DCVSAVLKLQRDAEDCGSFSRLLRNDRRN-ISIFKREQK-----------AAATLGIVVGAFSVCWLPFFLLSTARPFI--CGVTCSCVPLWVERTLLWL 345          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000006138.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27993956:27999385:-1 gene:ENSAMXG00000005992.2 transcript:ENSAMXT00000006138.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 7.369e-41
Identity = 111/364 (30.49%), Postives = 180/364 (49.45%), Query Frame = 3
Query:  117 FERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS--QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH---CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDES-DMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            F  + VL+ + L AL+ +    +IVGN  +I A+ L R L T +N L+ SLA +D LV+V V+P A + Q+   W   +  CD FI LD+L CT+SIL+LC I++DRY+ I  P++     T  R   L I + W++   ISIPP+ GW+ P    +   CT S+   Y  ++T GAFYIPL +ML+LY RI++ A+   + +    T       K   R       +   SP  ++    +    ++     + T +       +   L   ++ +  + E   +  ++     +   AR++            +KTLGI+MG F  CW PFF + L++P    +  ++  +P W+     WL
Sbjct:   29 FGVWEVLTSLLLGALILM----SIVGNACVIAAIALERSLQTINNYLIGSLAVTDLLVSVLVLPMAALYQVLQRWTLGQVACDLFIALDVLCCTSSILHLCAIALDRYWAITDPVAYMTRRTLCRAATL-ISLTWLVGFSISIPPMLGWRTPEDRANPLECTISQDPGYTIFSTFGAFYIPLALMLVLYGRIFRAARFRIRRSAKKNTDKMKMKEKEKDRKGTGLTGNGAPSPCTSVTGTPDVNRVSSPDDPRIDTPDGTRASTPDSTSLGSPEVTRVGTPEGISLEGTELLQDSRGALARERR----------TVKTLGIIMGTFILCWLPFFIVALVLP----FCGSSCPMPPWLGAVINWL 373          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: adra2c (alpha-2C adrenergic receptor-like [Source:NCBI gene;Acc:103033245])

HSP 1 Score: 150.599 bits (379), Expect = 8.056e-40
Identity = 81/211 (38.39%), Postives = 131/211 (62.09%), Query Frame = 3
Query:   69 VEEMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGW----KEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQ 683
            +E  +NSS  S       +YS+ + I LA L+S + + TIVGN+L++IAV   R L  P N  + SLA +D LVA  ++PF++  ++ GYW F +  CD ++ LD+L CT+SI++LC IS+DRY+++ Q + +Y     P  V  MI ++W++S +IS PP+       +E      C  ++  WY  Y+++G+F+ P V+M+++Y RIYQ
Sbjct:   14 LELHLNSSGNST-----SKYSLPTIIGLAGLVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLATADILVATLIMPFSLANELMGYWFFGKVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAV-EYNLKRTPRRVKGMIVVVWLISAVISFPPLISMDRKDQEINVKPQCEINDHTWYILYSSIGSFFAPCVIMILVYIRIYQ 218          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000026144.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:14357937:14360657:1 gene:ENSAMXG00000025418.2 transcript:ENSAMXT00000026144.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 4.054e-39
Identity = 83/207 (40.10%), Postives = 127/207 (61.35%), Query Frame = 3
Query:   75 EMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPL--SQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFH--LGHC-TYSESLWYQTYATLGAFYIPLVVMLILYSRIY 680
            + +N SL  +     E   +  QISL+ALL+V+ + T++ N  +I  +FL RKLHTP+N L+ SLA +D LV++ V+P +I+  +   W   +  CD ++  DI  CTASIL+LC I++DRY+ I   L  S+  T  R   LMI ++W++S  ISIPP+   +   H  L  C   ++ + Y  Y+T GAFY+P ++++ILY RIY
Sbjct:    3 QHLNQSLTEDSEAWDEATLLGLQISLSALLAVVTLATMLSNAFVIATIFLTRKLHTPANFLIGSLALTDLLVSILVMPISIVYTVSKTWTLGQIMCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYSKRRTTRRAA-LMIGVVWVISISISIPPLFWRQAKAHEELTECLVNTDQISYTLYSTFGAFYVPTILLVILYGRIY 208          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.206 bits (365), Expect = 5.570e-39
Identity = 79/190 (41.58%), Postives = 115/190 (60.53%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNF-RPVFLMICIIWILSGLISIPPVTGWKEPFHLGH---CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQ 683
            Y+V+S + L AL  ++C   I GN  +I A+ L R L   +N L+ SLA +D LV++ V+P A + Q+   W   +  CD FI LD+L CT+SIL+LC I++DRY+ I  P+        R   +MI + W++   ISIPP+ GW+ P        C  S+   Y  Y+T GAFYIPL++ML+LYSRI++
Sbjct:   35 YTVISSLCLTAL--ILCA--IFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPEDRADPNACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFR 220          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 6.377e-38
Identity = 84/212 (39.62%), Postives = 121/212 (57.08%), Query Frame = 3
Query:  141 QISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNF-RPVFLMICIIWILSGLISIPPVTGWKEPFHLGH---CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRD 764
            Q + ++ L  +   +I GN  ++ A++L R L T +N L+ SLA +D LV+V V+P A + Q+ G W   +  CD FI LD+L CT+SIL+LC I++DRY+ I  P+        R   LMI I W++   ISIPP+ GW++         C  S+ L Y  Y+T GAFYIPLV+ML+LY +I+  A+   + N     F     T NG  D
Sbjct:    2 QTATSSALGALIACSIAGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAITWVVGFSISIPPMLGWRQAEDRADPDACNISQHLGYTIYSTFGAFYIPLVLMLVLYGKIFSAARFRIRKNV---AFKSASHTDNGSAD 210          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 138.658 bits (348), Expect = 5.514e-36
Identity = 74/215 (34.42%), Postives = 127/215 (59.07%), Query Frame = 3
Query:   66 DVEEMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGW-------KEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQ 683
            +V    NSS  ++    +E YSVL+ + L++L+ ++   T+ GN L+IIAV     L  P N  + SLA +D LVA  VIPF++  ++ GYW F    C+ ++ LD+L CT+SI++LC IS+DRY+++ Q + +Y     P  +  +I I+W ++  IS+PP+          +E     +C  + + WY   + +G+F+ P ++M+++Y+RIY 
Sbjct:   27 NVNGATNSSNGTDEKLGWE-YSVLAGLGLSSLVLILVFATVFGNCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFNELMGYWYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAV-EYNIKRTPRRIKRIIVIVWFIAIAISLPPLISMNQKNRQQQEEVGRPNCELNTNTWYILGSCIGSFFAPCLIMVLVYARIYH 239          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 9.401e-34
Identity = 72/196 (36.73%), Postives = 110/196 (56.12%), Query Frame = 3
Query:  165 SVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGWKEP-------FHLGH--------------CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQ 683
            S I + TI GN L+ IAVF  + L    N  + SLA +D LVA  V+PF++  ++ GYW+F  F C+ ++ LD+L CT+SI++LC IS+DRY+++ Q + +Y     P  V   I I+W+++ LIS PP+ G   P        H G               C  +E  WY   +   +F+ P ++ML++Y+RIYQ
Sbjct:   41 SFIILVTIFGNSLVAIAVFTSKSLKAAQNLFLVSLAAADILVATLVMPFSLANELMGYWVFGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAV-RYNMKRTPRRVKRAIVIVWVIAALISFPPLVGTGRPPANIHRHRHQGSGRNASSSPSSVLPTCKLNEETWYVLSSCTASFFTPCLIMLLVYARIYQ 235          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 127.872 bits (320), Expect = 1.676e-32
Identity = 98/329 (29.79%), Postives = 161/329 (48.94%), Query Frame = 3
Query:  195 NLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGW--KEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRF--SQVLTTENSFYKYNINDD-ILSVSKLQQRKSDESDMTNSDYWNSIKSKKAR---QKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTK 1151
            N L+I A+   RKL  P+N L+ SLA +D LVA  V+P A    + G W      CD ++ LD+  CTASIL+LC I++DR++ I    ++Y     P    LMI   W+L+  IS+PP+  W  ++P         + + Y  Y+T GAFY+PL ++L LY RI++ AK++ +     Q     K + +    + L+Q S                     F  S+  +++ +  +   +     SVS + +R         S  + S +  + R   Q+ +      E +A KTLG+++G F  CW PFF  +L+V + K+  ++ +
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITD-AAEYAHKRTPGRAALMIAASWLLAACISVPPLF-WRRRDPAKPRCIIEHDHVLYTIYSTFGAFYVPLALLLALYCRIFRAAKRLYEKRESKQR---EKLSVSAESAVSLEQPSQSQHQQQQQQPAGKLFRLPQPFCMSETSSSDQTLAQAERSGQHQQSVSAVARRSKRSLRPPRSVRFMSARLDQRRPCLQERI--SGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVSPE 386          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 95.1301 bits (235), Expect = 3.879e-21
Identity = 95/363 (26.17%), Postives = 162/363 (44.63%), Query Frame = 3
Query:  123 RYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQI-KGYW--LFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLG---HCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFT--KNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFL 1184
            + SV S I+ A  + ++ + TI+GNLL+  +VF  R+L +P+N LV SLA SD LV    +PF +   + +  W        C F+I++D+L   AS++NL  IS DR   I QPL  +     +   ++I ++WI +   +      W+    +     C     + Y T   L AF+ PL++++I Y  + QVA + A      +  + +  +   N        + SL ASP    P+++           + T+ +S ++ +IN    +    + R    S       ++ +K  KA +               TL +++G F  CWFPFF + +      T     + IP  V+   L
Sbjct:   17 KNSVGSTIASACFIVIVMLLTIMGNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCAFLSFVEWEGESTIAAYPQCGIRARV-YITLMALAAFFCPLLIVIICYGMVLQVAIRHALQVQKEKEQIALNVSPEPNSNNHEESGETSL-ASP----PVIR-----------LKTSRSSSHRKDIN---FANGHAKHRNPASST------FHIMKQIKATK---------------TLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAVKRVLL 338          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO32939 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN0])

HSP 1 Score: 91.6633 bits (226), Expect = 1.982e-20
Identity = 61/189 (32.28%), Postives = 100/189 (52.91%), Query Frame = 3
Query:  138 SQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKG-YWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFH-----LGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQ 683
            S ++    LSVI V T++GN  + + VFL   LH  +N +V SLA SD +VA+  +PF I   +   +W      C F+I+ D+  C ASI+NL  IS+DR+     PL+ Q   N      M+  +W+ S +++   +  W  P       +  C   +  +Y   A LG F++PL+V+++ YS +++
Sbjct:   19 SYVAQTVFLSVIFVITLLGNATVCLTVFLTSSLHAFTNYIVASLAVSDLMVALFSLPFRIHQTVHNTHWCLGASACAFWIWADMFCCCASIMNLALISLDRFLATKYPLNYQELINRAGKIAMVVTVWLYSFVVASLSLRNWTSPEGPLVKTINGCFKPDPYFYTFAAALG-FFLPLIVIILAYSYVFR 206          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO37207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGH3])

HSP 1 Score: 87.4261 bits (215), Expect = 4.210e-19
Identity = 82/314 (26.11%), Postives = 135/314 (42.99%), Query Frame = 3
Query:  183 TIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGWKEPFHLGH---CT--YSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLN-AIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFF 1100
            +I+GN+LI++A+   R L + ++  + +LA +DFL+AV  +PF + + I   W+F  F C      + + C AS+L+L  +SIDRYF I+ PL +Y     P   F+++  +W+ S L    P+ GW    ++ +   CT  +  S+ Y  +     F+ PL+VM   Y  I                   +   +   R + LK    IA+PL  A+ +   S + N                             +RK +E +   + + +  K+ K                  TL I+MG F FCW P F
Sbjct:    1 SILGNILILLAIKRTRSLQSITSVFIANLAVADFLLAVIGMPFTMTSSITYDWIFGPFWCKLNGMANSVFCIASMLSLAAVSIDRYFAIITPL-KYPMLMTPRMAFMLVAWVWLQSLLCGFLPIFGWCRYTYITNESICTAEWGSSIPYTMFIFGACFFAPLLVMFYSYYHI-------------------LLAARRHARQMALK-VGDIATPLKTAVAITLPSADNN----------------------------AKRKREERE---AKFKSDTKAAK------------------TLLIVMGTFLFCWSPHF 244          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO30867 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK0])

HSP 1 Score: 86.2705 bits (212), Expect = 5.812e-19
Identity = 61/178 (34.27%), Postives = 90/178 (50.56%), Query Frame = 3
Query:  183 TIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMICI--IWILSGLISIPPVTGWKEPFHLGHCTYSESLW-----------YQTYATLGAFYIPLVVMLILYSRI 677
            TI GN +I + ++ VR+LH P+  L+ +LA +D L+A+ ++PF I   I   W+F    C    FL   LCTAS+L L  I++DRY  IL  L QY  +       ICI  +W+ S + S  P  GW      G  ++   LW           +  +     +++PL  +L LYSRI
Sbjct:    4 TIFGNAVICLVIYRVRRLHCPTGFLLANLAVTDILIALLLLPFRIPGIIYHRWVFGRPGCVVIGFLQNTLCTASVLTLLSITVDRYLAILWSL-QYNGSVTGTKTAICIALLWVYSTISSCFPFFGW------GKYSFLPGLWLCETDHIVLPSFTYFRLATVYFLPLFAILFLYSRI 174          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO41558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3W6])

HSP 1 Score: 85.8853 bits (211), Expect = 1.566e-18
Identity = 63/184 (34.24%), Postives = 99/184 (53.80%), Query Frame = 3
Query:  147 SLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ----IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYG--TNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIY 680
            +L A+LS + +GTI GNLL++I+++    L  P+   + SLA +D LV V  +P  +I +    +  +W    F CD F F   L   ASIL+LC ISIDR  TI  PL+ +   T +R V + + + WI +  IS+ P      P  L  C YS + W+     +    +P V++++ Y+ +Y
Sbjct:   20 ALVAILSPMSLGTICGNLLVLISIWTQPSLQLPNFMAIGSLAMADLLVGVFAMPAYVIKKSPLALGEFW--EGFVCDVFRFSYFLSGYASILSLCIISIDRMLTIRNPLTYHTLVTQYR-VTVTLVVAWIDAIGISVLPFLPTGVPQGL-PCHYSPAGWWSIMVIVTNVVVPFVIIMLCYTDMY 199          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: htr7a (5-hydroxytryptamine receptor 7 [Source:NCBI gene;Acc:101173573])

HSP 1 Score: 178.333 bits (451), Expect = 7.415e-50
Identity = 115/358 (32.12%), Postives = 175/358 (48.88%), Query Frame = 3
Query:  126 YSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQ-IKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH-CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            Y  + ++ +  +L+++ + TI GN+L++I+V  V+KL  PSN L+ SLA +D  VA+AV+PF  IT  I G W+F +F C+ FI +D++ CTASI++LC ISIDRY  I +PL+     N   +  M+  +W+LS  I++PP+ GW +  + G  C  S+   Y  Y+T  AFYIP+ VMLI+Y RI++                               + S     +   P + +S        +  +T               VS+L   KS E          SI  ++ +             A  TLGI++G FTFCW PFF +    P I    +    +P+W+  T LWL
Sbjct:   90 YGRVEKVLIGGVLTMLTLSTICGNMLVVISVCFVKKLRQPSNYLIVSLAVADLSVALAVMPFVSITDLIGGQWVFGQFFCNVFIAMDVMCCTASIMSLCVISIDRYLGITKPLTYPVRQNGCCMAKMVLSVWLLSASITLPPLFGWAQNVNDGRVCLISQDFGYTVYSTAVAFYIPMSVMLIMYYRIFRA-----------------------------AKLSAAKHTITGFPRLGDSQALQREVEEECSTR--------------VSRLL--KSGEHHQRRKRKNQSIFKREQK-------------AAATLGIVVGAFTFCWLPFFLVSTARPFI--CGVECSCVPLWLERTLLWL 387          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 175.637 bits (444), Expect = 5.716e-49
Identity = 115/354 (32.49%), Postives = 176/354 (49.72%), Query Frame = 3
Query:  138 SQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQI-KGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYG-TNFRPVFLMICIIWILSGLISIPPVTGWKEPFH-LGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
             +I +  +L++I   T++GN L++IAV +V+KL  PSN L+ SLA +D  VA+ V+PF I+T +  G WLF E  C+ FI +D++ CTASI+ LC IS+DRY  I +PL+     N + +  MI  +W++S  I++PP  GW +  H  G C  S+   Y  Y+T  AFYIP++VML++Y +I++ A                   K+G +                           +RF+ +L  E       + ++ L +  L+     E   T S   N       R++        E KA  TLG+++G F  CW PFF L    P I    +    +P+W+  T LWL
Sbjct:   86 EKIIIGVMLAIITAVTVMGNTLVVIAVCVVKKLRQPSNYLLVSLAVADLSVAIVVMPFVIVTDLTGGKWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMILGVWLVSASITLPPFCGWAKNVHKAGVCLISQDFGYTIYSTAVAFYIPMLVMLVMYYKIFRAA------------------RKSGAK---------------------------HRFTDLLRRER---LETVANEALRMQGLKPSGVAEECATLSRLLN-------RERKNISIFKREQKAATTLGVIVGVFAVCWLPFFILSTARPFI--CGVECSCVPIWLERTLLWL 382          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.992 bits (393), Expect = 7.278e-42
Identity = 110/365 (30.14%), Postives = 175/365 (47.95%), Query Frame = 3
Query:  141 QISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS--QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGH---CTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMK----------FTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            QI  + LL  + + +I GN  ++ A+ L R L   +N L+ SLA +D +V+V V+P A + Q+   W   +  CD FI LD+L CT+SIL+LC I++DRY+ I  P+      T  R V L+IC  W++   ISIPP+ GW+      +   C  S+   Y  Y+T GAFYIPL++ML+LY RI++ A+   +          +           F K        + +        + P V  ++   +    +   E           ++S SK      +    ++  Y N  +     ++ L   +  E K +KTLGI+MG F FCW PFF + L++P    +   + ++P W+     WL
Sbjct:   42 QIITSLLLGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAV-LLICATWLIGFSISIPPMLGWRSAEDRANPDACMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVKKIETAKVSDKCLAVSPAFFHKKSNGQSGGRGWKRCDGSKPSSPCVNGAVMHGDEGESLEIIE-----------VISNSKTHLPLPNTPQSSSHGYENMNERNSGAKRKL--ALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLP----FCPESCFMPDWLGAVINWL 388          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 153.68 bits (387), Expect = 3.173e-41
Identity = 104/377 (27.59%), Postives = 177/377 (46.95%), Query Frame = 3
Query:  108 SFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNF-RPVFLMICIIWILSGLISIPPVTGWK-EPFHLG-------HCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQ----VLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSI---KSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL 1190
            S   E   +  Q+  + LL  + +  I GN  ++ A+ L R L   +N L+ SLA +D +V+V V+P A + Q+   W   +  CD FI LD+L CT+SIL+LC I++DRY+ I +P+        R   ++I + W++   IS+PP+   + +P  +         C   +  WY  Y+T GAFYIPL +ML+LY RI++            +  +     K   + +     ++  S  +  P       +  R  +     L + N   K+  + + L + ++         + N+     +   +  KA +      +  E K +KTLGI+MG F  CW PFF + L++P  +     + Y+P W+ +   WL
Sbjct:    7 SVEKEDMKLSYQVVTSFLLGALILCAIFGNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNSWTLGQVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISVPPMLVMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLYGRIFK----------AARFRIRRTVRKTEKKKVADSCLAISPSLFHKTPHGDAQGKSWKRSVEPRPLALPSVNGAVKHAEDGESLEIIEVHSNSRGNLPLPNTPSTVPLFESRHDKATEAKRKIALARERKTVKTLGIIMGTFILCWLPFFIVALVMPFCQ----ESCYMPRWLEDVINWL 369          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: ENSORLT00000018283.2 (pep primary_assembly:ASM223467v1:22:9799933:9805173:-1 gene:ENSORLG00000014581.2 transcript:ENSORLT00000018283.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 2.105e-40
Identity = 101/334 (30.24%), Postives = 165/334 (49.40%), Query Frame = 3
Query:  141 QISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLS-QYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFH--LGHCTY-SESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIK 1130
            Q+SL+ LL+++ + T++ N  +I  +FL RKLHTP+N L+ SLA +D LV++ V+P +I+  +   W   +  CD ++  DI  CTASIL+LC I++DRY+ I   L        R   +M+ ++W++S  IS+PP+   +   H  L  C   ++ + Y  Y+T GAFY+P V+++ILY RIY  A+        +    G +FT      LI          LN+    +  L++ +  S       +  K  + D +L   +L                 + + +KA +               TLGI++G F  CW PFF   L++ + K
Sbjct:   34 QVSLSVLLALVTLATVLSNAFVITTIFLTRKLHTPANFLIGSLAVTDLLVSILVMPISILYTVSKTWSLGQIVCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYPKRRTMRRAAMMVGVVWVISISISMPPLFWRQAKAHEELTECVVNTDQISYTLYSTFGAFYVPTVLLIILYGRIYMAARSRILKTPCSS---GKRFTTA---QLIQTSAGSSLCSLNSTSHQEAHLHSGSTRSGGSPLFMNSVKVKLADSVLERKRL----------------CAARERKATK---------------TLGIILGAFIVCWLPFFVGTLVLAICK 330          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000031003.1 (SMESG000031003.1)

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 381/383 (99.48%), Postives = 381/383 (99.48%), Query Frame = 3
Query:   51 QVFDFDVEEMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWLVRF 1199
            QVFDFDVEEMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQVAKKIAKNNNVNQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLSKKIISESKAIKTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWL  F
Sbjct:    7 QVFDFDVEEMINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQVAKKIAKNNNVNQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLSKKIISESKAIKTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWLGYF 389          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000073069.1 (SMESG000073069.1)

HSP 1 Score: 255.373 bits (651), Expect = 5.839e-80
Identity = 160/363 (44.08%), Postives = 216/363 (59.50%), Query Frame = 3
Query:  120 ERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTEN-SFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTKYIPMWVRETFLWLVRF 1199
             +Y+   ++ +  +LS++   T+VGN+LIIIAV LV+KL TPSN L+ +LA SD LV+  V+PFAII Q+KG+W FSEF CD FI  D+LLCT SIL+LC ISIDRYF I +PL QY +      + +MI  +W+L+GLIS+PP  GWKE F    C YS+SL YQ YAT GAFY+PL +ML LY +I  +AK+IA                    +L LKQ S   S  N+  +  N   T NR   +  T N SF +++  +           KS+E   +       + ++ +   Y   K+ SE KAIKTLGI+MGCFT CW PFF +QL +P+ K    +  ++P  V E FLWL +F
Sbjct:   47 RKYTPTQEVFIGLILSILTFSTLVGNILIIIAVTLVKKLQTPSNLLIVNLATSDLLVSGIVLPFAIIFQLKGFWPFSEFLCDTFILSDVLLCTCSILSLCIISIDRYFAITRPL-QYASKRTTGRISIMIVSVWVLAGLISVPPFIGWKEKFVKNECKYSDSLSYQIYATFGAFYVPLFIMLFLYGKILLLAKRIA--------------------NLDLKQRSQKTSRRNSTVVFSNHNTTENRKPSLQQTMNCSFIQHDHRES--------NDKSEEMAFSKRYTITKLYNRTSMNLYKKSKLSSEVKAIKTLGIIMGCFTICWCPFFIIQLTIPIAKALGQDPNFVPPTVIEIFLWLGKF 380          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000045237.1 (SMESG000045237.1)

HSP 1 Score: 243.817 bits (621), Expect = 9.740e-75
Identity = 150/360 (41.67%), Postives = 207/360 (57.50%), Query Frame = 3
Query:  123 RYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTN--FRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIP-LVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTK-YIPMWVRETFLWL 1190
            RY+   +  L  L +++  GT+ GN L+I A+ LV+KL  PSN L+ SLA SD LVA  +   A I    G+W FSE  CD FI LD+LLC++SILNLC ISIDRY  I +PL QYG+    + +FLMI ++W LSGLISIPPV GWKE F  G C YSE+L YQ YAT GAFYIPL++ML+LY RI++               +     K   +  + K+ S  AS +  +P L  +S+   N   ++  ++ S      ++D +   KL    + E  +    Y  + K+  A  K +            TLG++MGCFT CW PFF +QLI P++K  NI++  YI  W+++ FLWL
Sbjct:   27 RYNSTIEHLLIVLFTLLIFGTLGGNCLVISAIILVKKLQIPSNFLILSLAASDTLVAFFLPLVAFIQLRGGHWPFSETFCDIFICLDVLLCSSSILNLCAISIDRYLIITKPL-QYGSRRTLKQMFLMILLVWFLSGLISIPPVIGWKEGFIPGKCIYSENLGYQIYATCGAFYIPLIIMLVLYGRIFK---------------LTQSMVKKDAK--LHKRASRYASDVLKMPDLNDDSVVKENMCKRLSLSDQS------SNDWMDSKKLAISNAKEEFI--KQYKKTEKANYAENKAI-----------TTLGVIMGCFTICWLPFFVIQLIKPLLKVANIDSNLYISQWIQDMFLWL 349          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000017113.1 (SMESG000017113.1)

HSP 1 Score: 242.276 bits (617), Expect = 5.418e-73
Identity = 154/368 (41.85%), Postives = 207/368 (56.25%), Query Frame = 3
Query:  108 SFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQI-KGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRP--VFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINT-KYIPMWVRETFLWLVRF 1199
            SF+FE +       L  + +V  VGT  GNLL+I++V +V+KL TPSN L+ +LACSDFLV++ V+P AI   I +  W FSE  CD FI  D++LCT+SILNLC ISIDRY  I +PL QY  N  P  + LMI I WI S LISIPP+ GWKE F  G C+YSE+L YQ YAT GAFYIPL+VMLILY RI++    +A+    N   M +  + N           ++ S L + P  + +L              S Y    +  ++S+ K         +  N+     IKS    +            AI TLG++MGCFT CW PFF +Q+  P++K  ++N+  Y P+W+ E  LWL  F
Sbjct:   34 SFDFEMF-------LIVIFTVFVVGTAGGNLLVIMSVAIVKKLQTPSNFLIVNLACSDFLVSILVLPGAIHQTINRSRWPFSEILCDVFISFDVILCTSSILNLCAISIDRYLVITRPL-QYAVNRTPARISLMIAISWIASALISIPPLFGWKETFIPGQCSYSENLLYQIYATFGAFYIPLLVMLILYGRIFK----LARVLAQNDAKMKIGISPNSSDREHQPNLRIVDSHLCSTPNGQMNL--------------SLY----SGSLVSIIKSTNFSESSQNKLNNRSRAKIKSSTETK------------AITTLGVIMGCFTICWLPFFIIQIAKPILKVASVNSVNYFPIWLIEICLWLGYF 359          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000051080.1 (SMESG000051080.1)

HSP 1 Score: 239.195 bits (609), Expect = 1.413e-72
Identity = 145/346 (41.91%), Postives = 197/346 (56.94%), Query Frame = 3
Query:  120 ERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLVRKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIFLDILLCTASILNLCCISIDRYFTILQPLSQYGTN--FRPVFLMICIIWILSGLISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRIYQXXXXXXXXXXXXQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKNSLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWNSIKSKKARQKYLXXXXXXXXXXXXTLGILMGCFTFCWFPFFTLQLIVPVIKTYNINTK 1151
            ERY  ++ I L  +LS++ +GT++GN L+I A FLVR+L TP N L+ +LA +D +V   VIP A I QIKGYW+F+++ C  FI  D+LLCT+SILNLC IS+DRYF I QP  +Y T+   + + LMI I+W  S LIS+PP+ GW  P    +C YSE+L YQ YAT  AFY+PL+VML+LY RI++       N    Q  MG K TK  P+     + +   +  N   + K      ++F + L  E S    N+ D      K+   +SDE    NS    S   +    K +           KTLG++MGCFT CW PFF  QL+ PV     IN+K
Sbjct:   61 ERYHPVTLIVLYVMLSILFLGTVIGNSLMIFAFFLVRRLRTPCNMLIINLAVTDLMVGTLVIPMASIYQIKGYWIFNDYICSGFILFDVLLCTSSILNLCAISVDRYFIITQPF-RYATHRTTKRMLLMIFIVWAASALISVPPLFGWSNPKSKYYCDYSENLGYQIYATFIAFYLPLIVMLVLYGRIFR-----LANYIYVQEKMGGKETKQ-PKRNSNFRNNFNDNNNNNSIIDK------SKFEKKLNNEESNKHLNVPD-----IKINFAESDEELHHNSKTKFSSGKRNNEAKAI-----------KTLGVIMGCFTICWLPFFIFQLLNPVFSALGINSK 377          
The following BLAST results are available for this feature:
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR71.441e-4534.645-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR71.521e-4534.645-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR73.611e-4534.645-hydroxytryptamine receptor 7 [Source:HGNC Symbol... [more]
HTR1A8.016e-4330.595-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
HTR1D4.166e-3930.855-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
octr-11.078e-3929.76OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-13.733e-3930.81OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
ser-27.021e-3631.90Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-27.484e-3631.90Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-27.938e-3631.90Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
5-HT73.253e-5034.34gene:FBgn0004573 transcript:FBtr0334508[more]
5-HT73.253e-5034.34gene:FBgn0004573 transcript:FBtr0085746[more]
TyrR5.213e-3941.76gene:FBgn0038542 transcript:FBtr0344474[more]
TyrR5.213e-3941.76gene:FBgn0038542 transcript:FBtr0083532[more]
TyrR5.213e-3941.76gene:FBgn0038542 transcript:FBtr0346161[more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr7b4.208e-4732.615-hydroxytryptamine (serotonin) receptor 7b [Sourc... [more]
htr7c4.480e-4731.375-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
htr7a7.049e-4731.385-hydroxytryptamine (serotonin) receptor 7a [Sourc... [more]
htr7a1.060e-4631.935-hydroxytryptamine (serotonin) receptor 7a [Sourc... [more]
htr7a1.171e-4631.935-hydroxytryptamine (serotonin) receptor 7a [Sourc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exd21.475e-4833.80exonuclease 3'-5' domain containing 2 [Source:Xenb... [more]
ENSXETT00000046867.11.509e-4330.995-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
HTR1D2.333e-3830.505-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
ADRA2B2.869e-3728.57adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485... [more]
ENSXETT00000011711.14.420e-3730.56adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr1a3.878e-4530.225-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Htr71.482e-4433.525-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr71.692e-4433.525-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr72.330e-4433.525-hydroxytryptamine (serotonin) receptor 7 [Source... [more]
Htr1f3.133e-4030.865-hydroxytryptamine (serotonin) receptor 1F [Sourc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20905|5HT1R_DROME3.261e-4934.345-hydroxytryptamine receptor 1 OS=Drosophila melan... [more]
sp|P34969|5HT7R_HUMAN1.734e-4434.645-hydroxytryptamine receptor 7 OS=Homo sapiens OX=... [more]
sp|Q64264|5HT1A_MOUSE2.713e-4430.225-hydroxytryptamine receptor 1A OS=Mus musculus OX... [more]
sp|Q0EAB6|5HT1A_HORSE1.105e-4331.435-hydroxytryptamine receptor 1A OS=Equus caballus ... [more]
sp|P32304|5HT7R_MOUSE1.183e-4333.525-hydroxytryptamine receptor 7 OS=Mus musculus OX=... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUK90.000e+099.22GCR019 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
A0A193KUH05.307e-7544.08GCR026 OS=Schmidtea mediterranea OX=79327 GN=gcr02... [more]
A0A193KU835.584e-7141.67GCR039 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A193KUF25.083e-6941.91GCR023 OS=Schmidtea mediterranea OX=79327 GN=gcr02... [more]
A0A193KU922.875e-6841.21GCR052 OS=Schmidtea mediterranea OX=79327 GN=gcr05... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr7a8.608e-4831.135-hydroxytryptamine receptor 7-like [Source:NCBI g... [more]
ENSAMXT00000007940.27.118e-4632.34pep primary_assembly:Astyanax_mexicanus-2.0:4:4294... [more]
ENSAMXT00000006138.27.369e-4130.49pep primary_assembly:Astyanax_mexicanus-2.0:6:2799... [more]
adra2c8.056e-4038.39alpha-2C adrenergic receptor-like [Source:NCBI gen... [more]
ENSAMXT00000026144.24.054e-3940.10pep primary_assembly:Astyanax_mexicanus-2.0:9:1435... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009127.15.570e-3941.58pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000001357.16.377e-3839.62pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
adra2c5.514e-3634.42adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
ENSPMAT00000008360.19.401e-3436.73pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
HTR1F1.676e-3229.795-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473593.879e-2126.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329391.982e-2032.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372074.210e-1926.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308675.812e-1934.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415581.566e-1834.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr7a7.415e-5032.125-hydroxytryptamine receptor 7 [Source:NCBI gene;A... [more]
htr7c5.716e-4932.495-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
ENSORLT00000005282.27.278e-4230.14pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
htr1ab3.173e-4127.595-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
ENSORLT00000018283.22.105e-4030.24pep primary_assembly:ASM223467v1:22:9799933:980517... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031003.10.000e+099.48SMESG000031003.1[more]
SMESG000073069.15.839e-8044.08SMESG000073069.1[more]
SMESG000045237.19.740e-7541.67SMESG000045237.1[more]
SMESG000017113.15.418e-7341.85SMESG000017113.1[more]
SMESG000051080.11.413e-7241.91SMESG000051080.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013518 ID=SMED30013518|Name=5-hydroxytryptamine receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1595bp
TCTCAGAATTTCTCTACAAAAATGCCTAAGCAAAATGTGGAAATCGTCGT
CAAGTCTTCGATTTTGATGTTGAAGAAATGATCAATTCTTCATTGAAATC
CAATAGATCTTTTAATTTCGAAAGATATTCCGTGCTGTCTCAAATCTCAT
TAGCTGCCCTGCTGTCGGTGATCTGTGTGGGAACAATTGTTGGGAACCTT
TTGATCATCATTGCCGTGTTTCTGGTAAGGAAGCTTCACACTCCCAGCAA
TTGTTTAGTCTTTAGTTTAGCTTGTAGTGATTTTCTTGTTGCAGTTGCTG
TCATTCCGTTCGCTATCATAACCCAGATCAAAGGATATTGGCTTTTCAGT
GAATTCACGTGTGATTTTTTTATCTTTTTGGATATTTTACTTTGTACCGC
TTCGATTTTGAATCTTTGCTGCATTTCAATTGATAGATATTTCACAATTC
TTCAACCTCTCAGTCAATACGGAACGAACTTTCGGCCGGTTTTCTTGATG
ATTTGTATAATTTGGATTCTTTCCGGATTGATATCGATACCTCCTGTGAC
GGGTTGGAAAGAACCTTTCCACTTAGGTCACTGTACATATAGTGAGAGTT
TGTGGTATCAAACATATGCCACCCTTGGTGCATTTTATATTCCTCTTGTT
GTCATGTTGATACTTTACAGCAGAATTTATCAAGTCGCCAAAAAAATTGC
TAAAAATAATAACGTTAACCAGACATTTATGGGAATGAAATTTACAAAAA
ATGGACCAAGAGATTTGATTTTGAAACAGTTTTCTCTAATTGCTTCTCCT
CTGAATGCAATTCCTCTTGTAAAAAATTCTTTGAATACAAATAATCGGTT
TTCCCAGGTTTTGACTACCGAAAATTCTTTTTACAAATATAATATTAATG
ATGACATACTTTCTGTGTCAAAATTGCAGCAACGTAAAAGTGATGAATCT
GACATGACGAATTCCGATTATTGGAACTCTATCAAATCTAAGAAAGCCAG
ACAGAAATATTTATCAAAAAAAATTATTTCTGAAAGTAAAGCCATAAAAA
CTCTGGGAATATTAATGGGTTGCTTCACCTTTTGTTGGTTTCCCTTTTTC
ACGTTACAGTTAATAGTTCCGGTGATTAAAACATATAATATTAATACGAA
ATACATTCCGATGTGGGTCAGAGAAACATTTTTATGGCTGGTGAGATTCA
TTTGGAGTTTACAAACGAAATTTCGTGGATATGAATGAACCGGAATTGAA
ATTAACTTAGGGATTTCAAATTATTGAAGGGCATCTTCTCATAACAGAAT
TCCAGTTGAAATAATCAGACTTTACTTCCTTAAAGCGCTTATTTTGCACT
ATTTGAATTAATTGTTCTGATAAATATTGTTTGTGATTCTTCATTTGTAT
TAGCACTCGGTTTCAGACATTAAAATTCAACCACTCCTTACCAATCACTT
CATAGTAACCTTGATGACGTCACAGGATATCACTAAACACGACAGATCTG
GTTTATTTTGAAAATTATTTAAACAGATTGAAAGAGAATTACTACAATTA
CCAGAAATGAACTTTGCTAAAGTTGTAACGCTTAACAATTCGGAG
back to top

protein sequence of SMED30013518-orf-1

>SMED30013518-orf-1 ID=SMED30013518-orf-1|Name=SMED30013518-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=387bp
MINSSLKSNRSFNFERYSVLSQISLAALLSVICVGTIVGNLLIIIAVFLV
RKLHTPSNCLVFSLACSDFLVAVAVIPFAIITQIKGYWLFSEFTCDFFIF
LDILLCTASILNLCCISIDRYFTILQPLSQYGTNFRPVFLMICIIWILSG
LISIPPVTGWKEPFHLGHCTYSESLWYQTYATLGAFYIPLVVMLILYSRI
YQVAKKIAKNNNVNQTFMGMKFTKNGPRDLILKQFSLIASPLNAIPLVKN
SLNTNNRFSQVLTTENSFYKYNINDDILSVSKLQQRKSDESDMTNSDYWN
SIKSKKARQKYLSKKIISESKAIKTLGILMGCFTFCWFPFFTLQLIVPVI
KTYNINTKYIPMWVRETFLWLVRFIWSLQTKFRGYE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction