Zinc finger protein, putative

Overview
NameZinc finger protein, putative
Smed IDSMED30013516
Length (bp)4846
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein, putative (SMED30013516) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein, putative (SMED30013516) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein, putative (SMED30013516) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein, putative (SMED30013516) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013516

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013516SMESG000002851.1 SmedASXL_017715SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013516SMESG000002851.1 SmedASXL_017715SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30013516SMESG000002851.1 dd_Smed_v4_5428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013516SMESG000002851.1 dd_Smed_v4_5428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013516SMESG000002851.1 dd_Smed_v4_5428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013516SMESG000002851.1 dd_Smed_v4_5428_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein, putative vs. Ensembl Human
Match: BAZ1B (bromodomain adjacent to zinc finger domain 1B [Source:HGNC Symbol;Acc:HGNC:961])

HSP 1 Score: 139.043 bits (349), Expect = 3.433e-32
Identity = 92/288 (31.94%), Postives = 139/288 (48.26%), Query Frame = 1
Query:  109 TICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGV-------------------------------------------VVKVDRSRS---NDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            TI H  T E     EE   +   Y+++IWTC+ TG   LT KEA + EQ  +++LK  F   +E  VL+ VHH+  SL+ L+  AW +I  +Y V E    ++   K + +K V                                           VVK D  R    ND    SP KL +     +++    K +P K    Y VK+   DK++ ++P++++ RT RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ +T
Sbjct:   24 TIPH--TQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEECDFEVGKEKMLKVKIVKIHPLEKVDEEATEKKSDGACDSPSSDKENSSQIAQDHQKKETVVKEDEGRRESINDRARRSPRKLPTSLKKGERKWAPPKFLPHK----YDVKLQNEDKIISNVPADSLIRTERPPNKEIVRYFIRHNALRAGTGENAPWVVEDELVKKYSLPSKFSDFLLDPYKYMTLNPST 305          

HSP 2 Score: 133.265 bits (334), Expect = 2.141e-30
Identity = 84/259 (32.43%), Postives = 136/259 (52.51%), Query Frame = 1
Query: 2602 WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP---------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            W +  +  EL +LLNCL  +GIRES LK  LE       D   S+       A + N  + +  G Q  L+   + +L E    +++G LG VE+  E++ RV S   L +  E ++++   V ++F   +  P                            K A+   ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCRK  +++ ++LCD CN AFH FCLRPAL+++P+GEW CP C+P +  R++
Sbjct:  991 WFLCDSQKELDELLNCLHPQGIRESQLKERLEKRYQ---DIIHSI-----HLARKPNLGLKSCDGNQE-LLNFLRSDLIEVATRLQKGGLGYVEETSEFEARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRRKLQSEDSAKTEEVDEEKKMVEEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNS 1240          

HSP 3 Score: 111.309 bits (277), Expect = 1.125e-23
Identity = 129/474 (27.22%), Postives = 215/474 (45.36%), Query Frame = 1
Query: 1171 LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAY----------------LNERRNQMRRQLREKKREENTKLEDNELEYAKQI--PEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGR---LFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVE 2529
            +I K  +L S++  A+ P+ +R  +  R E  E KKR  +M+ +QR+ Y                   R  +M  +L ++KR E+ +L    L   + +  PEG P ++ G         +  V EF+ CY  LL+P     D    +TA  L ++ +S        L   + +LL+ LLQD       E+G+ L+E+P+T+ +  EL+RL L         R  V+ +      DD KD      D EV  E               EKL+T E  +L+ E+K+ +L  L +RIL    V   ++  Q+   E +K+R+   KE NDK +A +Q ++EM          +  N K   G G    +   +      D+   D  S V  RR    + I+  +ERE +  + +   + + EE +++K    ++K++     +AK +MR  P+G+DR+  RYW F      +++E
Sbjct:  498 VISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSEEQRKEYLKKKREELKKKLKEKAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPEGLPNTLFGD--------VAMVVEFLSCYSGLLLP-----DAQYPITAVSLMEA-LSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLR--------RSDVQEESEGSDTDDNKDS-AAFEDNEVQDE-------------FLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKERLAVLKEENDKKRAEKQKRKEM-------EAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMISAVKSRR---LLAIQAKKEREIQEREMKVKLERQAEEERIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIE 925          

HSP 4 Score: 73.9442 bits (180), Expect = 2.434e-12
Identity = 37/108 (34.26%), Postives = 59/108 (54.63%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV  +E  DYY +IT P++   +  K   G Y     S++ FL+D+ Q+F NAEVYN   S +++  +  EQ    +  K+  G  Y R
Sbjct: 1348 CEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYR----SVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVR 1451          
BLAST of Zinc finger protein, putative vs. Ensembl Human
Match: BAZ1B (bromodomain adjacent to zinc finger domain 1B [Source:HGNC Symbol;Acc:HGNC:961])

HSP 1 Score: 139.043 bits (349), Expect = 3.433e-32
Identity = 92/288 (31.94%), Postives = 139/288 (48.26%), Query Frame = 1
Query:  109 TICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGV-------------------------------------------VVKVDRSRS---NDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            TI H  T E     EE   +   Y+++IWTC+ TG   LT KEA + EQ  +++LK  F   +E  VL+ VHH+  SL+ L+  AW +I  +Y V E    ++   K + +K V                                           VVK D  R    ND    SP KL +     +++    K +P K    Y VK+   DK++ ++P++++ RT RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ +T
Sbjct:   24 TIPH--TQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEECDFEVGKEKMLKVKIVKIHPLEKVDEEATEKKSDGACDSPSSDKENSSQIAQDHQKKETVVKEDEGRRESINDRARRSPRKLPTSLKKGERKWAPPKFLPHK----YDVKLQNEDKIISNVPADSLIRTERPPNKEIVRYFIRHNALRAGTGENAPWVVEDELVKKYSLPSKFSDFLLDPYKYMTLNPST 305          

HSP 2 Score: 133.265 bits (334), Expect = 2.141e-30
Identity = 84/259 (32.43%), Postives = 136/259 (52.51%), Query Frame = 1
Query: 2602 WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP---------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            W +  +  EL +LLNCL  +GIRES LK  LE       D   S+       A + N  + +  G Q  L+   + +L E    +++G LG VE+  E++ RV S   L +  E ++++   V ++F   +  P                            K A+   ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCRK  +++ ++LCD CN AFH FCLRPAL+++P+GEW CP C+P +  R++
Sbjct:  991 WFLCDSQKELDELLNCLHPQGIRESQLKERLEKRYQ---DIIHSI-----HLARKPNLGLKSCDGNQE-LLNFLRSDLIEVATRLQKGGLGYVEETSEFEARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRRKLQSEDSAKTEEVDEEKKMVEEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNS 1240          

HSP 3 Score: 111.309 bits (277), Expect = 1.125e-23
Identity = 129/474 (27.22%), Postives = 215/474 (45.36%), Query Frame = 1
Query: 1171 LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAY----------------LNERRNQMRRQLREKKREENTKLEDNELEYAKQI--PEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGR---LFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVE 2529
            +I K  +L S++  A+ P+ +R  +  R E  E KKR  +M+ +QR+ Y                   R  +M  +L ++KR E+ +L    L   + +  PEG P ++ G         +  V EF+ CY  LL+P     D    +TA  L ++ +S        L   + +LL+ LLQD       E+G+ L+E+P+T+ +  EL+RL L         R  V+ +      DD KD      D EV  E               EKL+T E  +L+ E+K+ +L  L +RIL    V   ++  Q+   E +K+R+   KE NDK +A +Q ++EM          +  N K   G G    +   +      D+   D  S V  RR    + I+  +ERE +  + +   + + EE +++K    ++K++     +AK +MR  P+G+DR+  RYW F      +++E
Sbjct:  498 VISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSEEQRKEYLKKKREELKKKLKEKAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPEGLPNTLFGD--------VAMVVEFLSCYSGLLLP-----DAQYPITAVSLMEA-LSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLR--------RSDVQEESEGSDTDDNKDS-AAFEDNEVQDE-------------FLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKERLAVLKEENDKKRAEKQKRKEM-------EAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMISAVKSRR---LLAIQAKKEREIQEREMKVKLERQAEEERIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIE 925          

HSP 4 Score: 73.9442 bits (180), Expect = 2.434e-12
Identity = 37/108 (34.26%), Postives = 59/108 (54.63%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV  +E  DYY +IT P++   +  K   G Y     S++ FL+D+ Q+F NAEVYN   S +++  +  EQ    +  K+  G  Y R
Sbjct: 1348 CEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYR----SVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVR 1451          
BLAST of Zinc finger protein, putative vs. Ensembl Human
Match: BAZ1A (bromodomain adjacent to zinc finger domain 1A [Source:HGNC Symbol;Acc:HGNC:960])

HSP 1 Score: 97.4413 bits (241), Expect = 1.653e-19
Identity = 42/126 (33.33%), Postives = 70/126 (55.56%), Query Frame = 1
Query: 2917 SVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQ---------AQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP 3267
            S  ++ +   L  +  G+  RF   PL +++    +   +++         + +Q  L++  S LD  V WSKS  + +C++CRK  D  +M+LCD C+   HT+C+RP L  +PEG+WFCP C+P
Sbjct: 1042 SSVVHYLAMALFQIEQGIERRFLKAPLDASDSGRSYKTVLDRWRESLLSSASLSQVFLHL--STLDRSVIWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP 1165          

HSP 2 Score: 57.3806 bits (137), Expect = 2.927e-7
Identity = 36/125 (28.80%), Postives = 62/125 (49.60%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKES-LDTLIHKAWTQIHQEYCVNEPVTI 411
            MPLL  K ++  K   D + ++      +TNEI  + ++   +T L N  +W+C +TG+  LT++EAL+SE+   + L+ SF +     VL     +  S L  +    +  +   Y V E V +
Sbjct:    1 MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESEKKARQNLQ-SFPEPLIIPVLYLTSLTHRSRLHEICDDIFAYVKDRYFVEETVEV 124          
BLAST of Zinc finger protein, putative vs. Ensembl Human
Match: BAZ1A (bromodomain adjacent to zinc finger domain 1A [Source:HGNC Symbol;Acc:HGNC:960])

HSP 1 Score: 96.2857 bits (238), Expect = 3.909e-19
Identity = 42/126 (33.33%), Postives = 70/126 (55.56%), Query Frame = 1
Query: 2917 SVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQ---------AQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP 3267
            S  ++ +   L  +  G+  RF   PL +++    +   +++         + +Q  L++  S LD  V WSKS  + +C++CRK  D  +M+LCD C+   HT+C+RP L  +PEG+WFCP C+P
Sbjct: 1074 SSVVHYLAMALFQIEQGIERRFLKAPLDASDSGRSYKTVLDRWRESLLSSASLSQVFLHL--STLDRSVIWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP 1197          

HSP 2 Score: 56.225 bits (134), Expect = 6.941e-7
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVL---QFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTI 411
            MPLL  K ++  K   D + ++      +TNEI  + ++   +T L N  +W+C +TG+  LT++EAL+SE+   + L+ SF +     VL      H S+  L  +    +  +   Y V E V +
Sbjct:    1 MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESEKKARQNLQ-SFPEPLIIPVLYLTSLTHRSR--LHEICDDIFAYVKDRYFVEETVEV 124          
BLAST of Zinc finger protein, putative vs. Ensembl Human
Match: BAZ1A (bromodomain adjacent to zinc finger domain 1A [Source:HGNC Symbol;Acc:HGNC:960])

HSP 1 Score: 96.2857 bits (238), Expect = 3.909e-19
Identity = 42/126 (33.33%), Postives = 70/126 (55.56%), Query Frame = 1
Query: 2917 SVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQ---------AQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP 3267
            S  ++ +   L  +  G+  RF   PL +++    +   +++         + +Q  L++  S LD  V WSKS  + +C++CRK  D  +M+LCD C+   HT+C+RP L  +PEG+WFCP C+P
Sbjct: 1074 SSVVHYLAMALFQIEQGIERRFLKAPLDASDSGRSYKTVLDRWRESLLSSASLSQVFLHL--STLDRSVIWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP 1197          

HSP 2 Score: 56.225 bits (134), Expect = 6.941e-7
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVL---QFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTI 411
            MPLL  K ++  K   D + ++      +TNEI  + ++   +T L N  +W+C +TG+  LT++EAL+SE+   + L+ SF +     VL      H S+  L  +    +  +   Y V E V +
Sbjct:    1 MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESEKKARQNLQ-SFPEPLIIPVLYLTSLTHRSR--LHEICDDIFAYVKDRYFVEETVEV 124          
BLAST of Zinc finger protein, putative vs. Ensembl Celegans
Match: athp-2 (AT Hook plus PHD finger transcription factor [Source:UniProtKB/TrEMBL;Acc:Q9N5L9])

HSP 1 Score: 75.485 bits (184), Expect = 3.415e-13
Identity = 37/90 (41.11%), Postives = 51/90 (56.67%), Query Frame = 1
Query: 4306 MLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            +LK  M  + SWPF+ PVD +EVPDYY +I  P+N+  MM K KQ IY   I+      +D   +  N E YN P+++I  L+  L  F 
Sbjct: 1332 LLKEAMRQECSWPFLQPVDSKEVPDYYDVIKRPMNLRTMMNKIKQRIYNKPIE----VRNDFQLILSNCETYNEPENEIYKLSRELHDFM 1417          

HSP 2 Score: 53.9138 bits (128), Expect = 1.218e-6
Identity = 43/202 (21.29%), Postives = 83/202 (41.09%), Query Frame = 1
Query: 2833 LKETEISIRQGSLGGVE-----DYVEWQKRVNSS----VTLNE---------------------MKETLVSVFL--GVHERFWNVPLKSANGRNEFLN------------AVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVA 3306
            L + E  I QG +G +E     + +EW+  +  S    + LNE                     MK  +    +   +H +F   P  S N ++E  N            A+ + ++ + L++  S  +  + W KS    KCR CR+ +  + ++LC  C++ +H  C +  ++     +W C  C+   R  + ++  +A
Sbjct:  974 LLDFEEKIDQGQMGSIEKIFECNRIEWRDNLKESGNVCMLLNEDISIFGEISVNLEESEHFSDSMKLAIAFYMIIKSIHLKFIKAPYISPN-KDEHGNLKPSELFIRWQRALLECESHSALSLFISTFEGSIKWDKSRLQGKCRSCRRKAAAHDLVLCSECDNCYHLKCAKLDVNSDAPADWMCTSCRAQQRKVENEAKRMA 1174          
BLAST of Zinc finger protein, putative vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 72.7886 bits (177), Expect = 2.366e-12
Identity = 35/137 (25.55%), Postives = 61/137 (44.53%), Query Frame = 1
Query: 3121 DKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQCRLDE 3531
            + C VC +   +  ++LCD+C  A+H  C+   +   PEG+W CPHC+                     H     I  +    ++ + C +C  ++    +  C +C   +HA+C +PPL +I    W C +C + E
Sbjct:  266 ENCEVCNQ---DGELMLCDTCTRAYHVACIDENMEQPPEGDWSCPHCE--------------------EHGPDVLIVEEEPAKANMDYCRICKETSN---ILLCDTCPSSYHAYCIDPPLTEIPEGEWSCPRCIIPE 376          

HSP 2 Score: 63.929 bits (154), Expect = 1.272e-9
Identity = 24/50 (48.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query: 3112 AKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHC 3261
            A  D CR+C++ S+   +LLCD+C  ++H +C+ P L +IPEGEW CP C
Sbjct:  326 ANMDYCRICKETSN---ILLCDTCPSSYHAYCIDPPLTEIPEGEWSCPRC 372          
BLAST of Zinc finger protein, putative vs. Ensembl Celegans
Match: baz-2 (Bromodomain Adjacent to Zinc finger domain, 2A/2B, homolog [Source:UniProtKB/TrEMBL;Acc:Q23590])

HSP 1 Score: 72.0182 bits (175), Expect = 3.889e-12
Identity = 40/147 (27.21%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 2878 VEDYVEWQKRVNSSVTLNEMKETLVSVFL-----GVHERFWNVPLKSANGRN------EFLNAVE-QAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRAR 3282
            V+D + W K ++  V   E+ ET++   +      V  +FW    +    ++      ++ + V  +AQT ++L +    L+  + W +S+++  C++C K+ D + ML+CD C    H  C RP +  +PEG+WFC  C+     R
Sbjct: 1009 VKDDMAW-KVIDEEVDGQELDETIIRQKIIETADMVQPKFWRPKFQKLEDQDTCQLFEDWKSYVSTEAQTTSQLMVALQTLEGMIMWERSSREALCQIC-KSMDGDEMLVCDGCESGCHMECFRPRMTKVPEGDWFCQRCREEKSGR 1153          

HSP 2 Score: 65.4698 bits (158), Expect = 3.498e-10
Identity = 37/131 (28.24%), Postives = 67/131 (51.15%), Query Frame = 1
Query: 4237 KAPIQKKSCNGISAEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYS--KYEFGVEYTRM 4623
            K  ++  S  G+     ++ C  ML  ++    + PF++PV+P+ VP Y  II+ P+++  + +K ++ IY +  D    F  D+  MF N   +N+  S+I    I+L +FF+  +   KY F     R+
Sbjct: 1262 KRKLEVPSIGGLPKNMNKELCQLMLDELVVQANALPFLEPVNPKLVPGYKMIISKPMDLKTIRQKNEKLIYETPED----FAEDIELMFANCRQFNIDHSEIGRAGISLHKFFQKRWKQLKYNFTKRLRRL 1388          
BLAST of Zinc finger protein, putative vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 68.1662 bits (165), Expect = 5.418e-11
Identity = 39/135 (28.89%), Postives = 61/135 (45.19%), Query Frame = 1
Query: 3118 DDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQI-RRTNWHCCQC 3519
            +D C  C++   +  +LLCD+C  A+HT C+   + + PEG+W C HC                      H      +   +QN   E C +C  +   + L  C SC   FHA+C +PPL ++ +   W C +C
Sbjct:  256 NDYCEECKQ---DGELLLCDTCPRAYHTVCIDENMEEPPEGDWSCAHCI--------------------EHGPEVVKEEPAKQND--EFCKICKET---ENLLLCDSCVCSFHAYCIDPPLTEVPKEETWSCPRC 362          
BLAST of Zinc finger protein, putative vs. Ensembl Celegans
Match: pcaf-1 (P300/CBP Associated Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q9N3S7])

HSP 1 Score: 62.7734 bits (151), Expect = 1.858e-9
Identity = 32/92 (34.78%), Postives = 48/92 (52.17%), Query Frame = 1
Query: 4291 KACYHM--------------LKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYN 4524
            K+CYH+              LK + + K +WPF  PVD +EVP+YY  I  PI+   M EK K+  Y        +F++D+ ++F N  V+N
Sbjct:  639 KSCYHLDERDDSLDSKIGAILKKLTADKNAWPFASPVDVKEVPEYYDHIKHPIDFKTMQEKLKRKAYTHQ----HLFIADLNRLFQNCYVFN 726          
BLAST of Zinc finger protein, putative vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0088091)

HSP 1 Score: 107.457 bits (267), Expect = 9.550e-23
Identity = 49/172 (28.49%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 3010 GRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVC--HSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            G  ++ +AV ++ T A+L M    L++CV W KS     C+ C    +E+ +LLCD C+  +HT+C +P + +IP+G+W+C  C  V++A                              +++ +C VC  H  +   ++  C  C + +HA C+ PPL ++ R  W+C  C
Sbjct: 2470 GLVQWRDAVSRSHTTAQLAMALYVLESCVAWDKSIMKANCQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYEC--VNKA------------------------------TNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGC 2609          

HSP 2 Score: 58.151 bits (139), Expect = 8.464e-8
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFK 4578
            C  +L  M  H+ SWPF+ PV+ ++ P Y +II  P++++ + +K +   Y +  D    F  DV Q+F N E++N  DS +      + +FF+
Sbjct: 2899 CKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTRED----FCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFE 2988          

HSP 3 Score: 51.9878 bits (123), Expect = 6.990e-6
Identity = 24/63 (38.10%), Postives = 34/63 (53.97%), Query Frame = 1
Query: 3097 CWSKSAKDDKCRVC--RKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRA 3279
            C +K+  + KC VC   + S    M+ CD C  A+H  C  P L  +P G+W+C  C  +SRA
Sbjct: 2553 CVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGC--ISRA 2613          
BLAST of Zinc finger protein, putative vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0333071)

HSP 1 Score: 85.5001 bits (210), Expect = 5.011e-16
Identity = 36/133 (27.07%), Postives = 64/133 (48.12%), Query Frame = 1
Query: 3127 CRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVC--HSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            C+ C    +E+ +LLCD C+  +HT+C +P + +IP+G+W+C  C  V++A                              +++ +C VC  H  +   ++  C  C + +HA C+ PPL ++ R  W+C  C
Sbjct: 2604 CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYEC--VNKA------------------------------TNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGC 2704          

HSP 2 Score: 58.5362 bits (140), Expect = 7.544e-8
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFK 4578
            C  +L  M  H+ SWPF+ PV+ ++ P Y +II  P++++ + +K +   Y +  D    F  DV Q+F N E++N  DS +      + +FF+
Sbjct: 2994 CKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTRED----FCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFE 3083          

HSP 3 Score: 51.9878 bits (123), Expect = 6.717e-6
Identity = 24/63 (38.10%), Postives = 34/63 (53.97%), Query Frame = 1
Query: 3097 CWSKSAKDDKCRVC--RKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRA 3279
            C +K+  + KC VC   + S    M+ CD C  A+H  C  P L  +P G+W+C  C  +SRA
Sbjct: 2648 CVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGC--ISRA 2708          
BLAST of Zinc finger protein, putative vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0333070)

HSP 1 Score: 85.1149 bits (209), Expect = 5.442e-16
Identity = 36/133 (27.07%), Postives = 64/133 (48.12%), Query Frame = 1
Query: 3127 CRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVC--HSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            C+ C    +E+ +LLCD C+  +HT+C +P + +IP+G+W+C  C  V++A                              +++ +C VC  H  +   ++  C  C + +HA C+ PPL ++ R  W+C  C
Sbjct: 2568 CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYEC--VNKA------------------------------TNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGC 2668          

HSP 2 Score: 58.151 bits (139), Expect = 8.197e-8
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFK 4578
            C  +L  M  H+ SWPF+ PV+ ++ P Y +II  P++++ + +K +   Y +  D    F  DV Q+F N E++N  DS +      + +FF+
Sbjct: 2958 CKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTRED----FCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFE 3047          

HSP 3 Score: 51.9878 bits (123), Expect = 7.239e-6
Identity = 24/63 (38.10%), Postives = 34/63 (53.97%), Query Frame = 1
Query: 3097 CWSKSAKDDKCRVC--RKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRA 3279
            C +K+  + KC VC   + S    M+ CD C  A+H  C  P L  +P G+W+C  C  +SRA
Sbjct: 2612 CVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGC--ISRA 2672          
BLAST of Zinc finger protein, putative vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0113066)

HSP 1 Score: 85.1149 bits (209), Expect = 5.646e-16
Identity = 36/133 (27.07%), Postives = 64/133 (48.12%), Query Frame = 1
Query: 3127 CRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVC--HSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            C+ C    +E+ +LLCD C+  +HT+C +P + +IP+G+W+C  C  V++A                              +++ +C VC  H  +   ++  C  C + +HA C+ PPL ++ R  W+C  C
Sbjct: 2641 CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYEC--VNKA------------------------------TNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGC 2741          

HSP 2 Score: 58.5362 bits (140), Expect = 6.826e-8
Identity = 30/94 (31.91%), Postives = 52/94 (55.32%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFK 4578
            C  +L  M  H+ SWPF+ PV+ ++ P Y +II  P++++ + +K +   Y +  D    F  DV Q+F N E++N  DS +      + +FF+
Sbjct: 3031 CKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTRED----FCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFE 3120          

HSP 3 Score: 51.9878 bits (123), Expect = 7.436e-6
Identity = 24/63 (38.10%), Postives = 34/63 (53.97%), Query Frame = 1
Query: 3097 CWSKSAKDDKCRVC--RKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRA 3279
            C +K+  + KC VC   + S    M+ CD C  A+H  C  P L  +P G+W+C  C  +SRA
Sbjct: 2685 CVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGC--ISRA 2745          
BLAST of Zinc finger protein, putative vs. Ensembl Fly
Match: Gcn5 (gene:FBgn0020388 transcript:FBtr0075969)

HSP 1 Score: 78.5666 bits (192), Expect = 3.656e-14
Identity = 34/100 (34.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query: 4279 EKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFK 4578
            EK+  +   +L+++  H  +WPF+ PV   EVPDYY  I  P+++  M E+ K+G Y     + ++F++D+ ++F N   YN PD++    A +LE++F+
Sbjct:  707 EKLATSFASVLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYY----QTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQ 802          
BLAST of Zinc finger protein, putative vs. Ensembl Zebrafish
Match: baz1b (bromodomain adjacent to zinc finger domain, 1B [Source:NCBI gene;Acc:571727])

HSP 1 Score: 140.969 bits (354), Expect = 6.183e-33
Identity = 97/302 (32.12%), Postives = 149/302 (49.34%), Query Frame = 1
Query:   43 PLLSNKLYILNKIRKDKK---DEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSS--DASSSDKENM----------------------------------------KKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            PLL  K Y L K   +     +E  TI H  T E   N+EE   +   Y ++IWTC+ TG   LT KEA + EQ  +++L+  +   FE  VL+ VHH+   LD L+ + W +I  +Y V E   + +   K + ++  VVK+     N  +EN+  K+    D+ SSDKEN                                         KK ++P    + Y VK+   DK++ D+P++ + RT RPP+K+ +R FIR +A+R    ++ PWVV++ELVKK+ LP+   +F +D  K 
Sbjct:    3 PLLGRKPYPLVKPLSEPPGPGEEVYTIEH--TKEAFRNKEEYEARLRRYGERIWTCKSTGSSQLTHKEAWEEEQEVTELLQEEYPVWFEKPVLEIVHHNTVPLDKLVDQVWVEILTKYAVGEKCDLMVGNDKTLSVE--VVKI-HPLENPPEENAEKKMEGACDSPSSDKENASQENLKKEPQSKEEESRRESLSDRARRSPRKLPTTMKEEKKKWVMPKFLPHKYDVKLVNEDKVISDVPADNLFRTERPPNKEIMRYFIRHYALRLGSGESAPWVVEDELVKKFSLPSKFSDFLLDPHKF 299          

HSP 2 Score: 117.472 bits (293), Expect = 9.770e-26
Identity = 66/213 (30.99%), Postives = 110/213 (51.64%), Query Frame = 1
Query: 2764 RTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVED---YVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV-----SRARD 3285
            + NP +    G Q  L+   + ++ E    +++G LG +ED   + E+++RV +   L E  E ++++   V ++F   +  P                             + A    ++  AV +AQT +R+++L   LDAC+ W  SA++ +C+VCR+  +++ ++LCD CN AFH FCLRPAL+ IP GEW CP C+P      SR R+
Sbjct: 1051 KGNPGLKTCDGHQE-LLKFLRSDIIEVASRLQKGGLGYLEDTSEFEEFEERVKTLEKLPEFGECVIALQESVIKKFLQGFMAPKQKKKKKTGGEESTTAEEVDDQKKLAEEARVATAVEKWKTAVREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRRKGEDDKLILCDECNKAFHLFCLRPALYRIPAGEWLCPACQPTIARRSSRGRN 1262          

HSP 3 Score: 88.1965 bits (217), Expect = 8.253e-17
Identity = 95/357 (26.61%), Postives = 173/357 (48.46%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVK----QLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREK-----------KREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKD--QHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQE 2133
            A  LL+  K+N    + K     L+ K  +  S +  ++ P+ ++  +  R E  E+K+R   M+ +++++ L ++R +++++LREK           +RE + + ED ELE  K +P      +  G+    +  +  V EF+ CY  LLMP     DD   +T+  L +++  +       L   + VLL+ LLQD       E+ + L+E+P+T+ +  EL+RL             +  +D +EE +    D  Q G   D+ VS+E               EKL+T E+ +L  ++K+ +L  L +RIL    V   ++   ++  E +K+R+   KE ND+ +A +Q ++E
Sbjct:  474 ALHLLRFYKENKGKEDKKTTLSSLLSKAAKALSPEDRSRLPEELKELVQKRWELLEQKRRWALMSEEEKQSVLKQKRQEVKQKLREKAKERREKEMQVRREMSRRYEDQELE-GKNLPAFRLFDMPEGLPNTIFGDVAMVVEFLHCYSGLLMP-----DDQYPITSIALLEALAGE-KAGFLYLNRVLVVLLQTLLQDELAEGYSELDMPLSEIPLTMHSVSELVRLC------------LRPSDAHEEESARGSDDWQSGADFDDMVSSEF-------------LEKLETAEVFELDPQEKVSLLLALCHRILMTYSVEDHVEAVHQKSAEMWKERVATLKEANDRKRAEKQKRKE 798          

HSP 4 Score: 77.411 bits (189), Expect = 1.319e-13
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEY 4614
            C  +L+ +M  + SWPF +PV  EE  DY  +IT P+++  M  K+K   Y S  D    F+ D+  +F NAE YN P S+++      E+ F  +  K   GV Y
Sbjct: 1375 CEEILQKIMKFRHSWPFREPVSAEEAEDYQDVITSPMDLTTMQGKFKSSEYHSASD----FIEDMKLIFSNAEEYNQPSSNVLTCMSRTEEAFVELLQKSLPGVSY 1476          
BLAST of Zinc finger protein, putative vs. Ensembl Zebrafish
Match: baz1b (bromodomain adjacent to zinc finger domain, 1B [Source:NCBI gene;Acc:571727])

HSP 1 Score: 140.969 bits (354), Expect = 6.890e-33
Identity = 97/302 (32.12%), Postives = 149/302 (49.34%), Query Frame = 1
Query:   43 PLLSNKLYILNKIRKDKK---DEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSS--DASSSDKENM----------------------------------------KKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            PLL  K Y L K   +     +E  TI H  T E   N+EE   +   Y ++IWTC+ TG   LT KEA + EQ  +++L+  +   FE  VL+ VHH+   LD L+ + W +I  +Y V E   + +   K + ++  VVK+     N  +EN+  K+    D+ SSDKEN                                         KK ++P    + Y VK+   DK++ D+P++ + RT RPP+K+ +R FIR +A+R    ++ PWVV++ELVKK+ LP+   +F +D  K 
Sbjct:    3 PLLGRKPYPLVKPLSEPPGPGEEVYTIEH--TKEAFRNKEEYEARLRRYGERIWTCKSTGSSQLTHKEAWEEEQEVTELLQEEYPVWFEKPVLEIVHHNTVPLDKLVDQVWVEILTKYAVGEKCDLMVGNDKTLSVE--VVKI-HPLENPPEENAEKKMEGACDSPSSDKENASQENLKKEPQSKEEESRRESLSDRARRSPRKLPTTMKEEKKKWVMPKFLPHKYDVKLVNEDKVISDVPADNLFRTERPPNKEIMRYFIRHYALRLGSGESAPWVVEDELVKKFSLPSKFSDFLLDPHKF 299          

HSP 2 Score: 117.472 bits (293), Expect = 1.024e-25
Identity = 66/213 (30.99%), Postives = 110/213 (51.64%), Query Frame = 1
Query: 2764 RTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVED---YVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV-----SRARD 3285
            + NP +    G Q  L+   + ++ E    +++G LG +ED   + E+++RV +   L E  E ++++   V ++F   +  P                             + A    ++  AV +AQT +R+++L   LDAC+ W  SA++ +C+VCR+  +++ ++LCD CN AFH FCLRPAL+ IP GEW CP C+P      SR R+
Sbjct: 1051 KGNPGLKTCDGHQE-LLKFLRSDIIEVASRLQKGGLGYLEDTSEFEEFEERVKTLEKLPEFGECVIALQESVIKKFLQGFMAPKQKKKKKTGGEESTTAEEVDDQKKLAEEARVATAVEKWKTAVREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRRKGEDDKLILCDECNKAFHLFCLRPALYRIPAGEWLCPACQPTIARRSSRGRN 1262          

HSP 3 Score: 88.1965 bits (217), Expect = 7.937e-17
Identity = 95/357 (26.61%), Postives = 173/357 (48.46%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVK----QLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREK-----------KREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKD--QHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQE 2133
            A  LL+  K+N    + K     L+ K  +  S +  ++ P+ ++  +  R E  E+K+R   M+ +++++ L ++R +++++LREK           +RE + + ED ELE  K +P      +  G+    +  +  V EF+ CY  LLMP     DD   +T+  L +++  +       L   + VLL+ LLQD       E+ + L+E+P+T+ +  EL+RL             +  +D +EE +    D  Q G   D+ VS+E               EKL+T E+ +L  ++K+ +L  L +RIL    V   ++   ++  E +K+R+   KE ND+ +A +Q ++E
Sbjct:  474 ALHLLRFYKENKGKEDKKTTLSSLLSKAAKALSPEDRSRLPEELKELVQKRWELLEQKRRWALMSEEEKQSVLKQKRQEVKQKLREKAKERREKEMQVRREMSRRYEDQELE-GKNLPAFRLFDMPEGLPNTIFGDVAMVVEFLHCYSGLLMP-----DDQYPITSIALLEALAGE-KAGFLYLNRVLVVLLQTLLQDELAEGYSELDMPLSEIPLTMHSVSELVRLC------------LRPSDAHEEESARGSDDWQSGADFDDMVSSEF-------------LEKLETAEVFELDPQEKVSLLLALCHRILMTYSVEDHVEAVHQKSAEMWKERVATLKEANDRKRAEKQKRKE 798          

HSP 4 Score: 77.7962 bits (190), Expect = 1.127e-13
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEY 4614
            C  +L+ +M  + SWPF +PV  EE  DY  +IT P+++  M  K+K   Y S  D    F+ D+  +F NAE YN P S+++      E+ F  +  K   GV Y
Sbjct: 1375 CEEILQKIMKFRHSWPFREPVSAEEAEDYQDVITSPMDLTTMQGKFKSSEYHSASD----FIEDMKLIFSNAEEYNQPSSNVLTCMSRTEEAFVELLQKSLPGVSY 1476          
BLAST of Zinc finger protein, putative vs. Ensembl Zebrafish
Match: baz1b (bromodomain adjacent to zinc finger domain, 1B [Source:NCBI gene;Acc:571727])

HSP 1 Score: 140.969 bits (354), Expect = 6.915e-33
Identity = 97/302 (32.12%), Postives = 149/302 (49.34%), Query Frame = 1
Query:   43 PLLSNKLYILNKIRKDKK---DEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSS--DASSSDKENM----------------------------------------KKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            PLL  K Y L K   +     +E  TI H  T E   N+EE   +   Y ++IWTC+ TG   LT KEA + EQ  +++L+  +   FE  VL+ VHH+   LD L+ + W +I  +Y V E   + +   K + ++  VVK+     N  +EN+  K+    D+ SSDKEN                                         KK ++P    + Y VK+   DK++ D+P++ + RT RPP+K+ +R FIR +A+R    ++ PWVV++ELVKK+ LP+   +F +D  K 
Sbjct:    3 PLLGRKPYPLVKPLSEPPGPGEEVYTIEH--TKEAFRNKEEYEARLRRYGERIWTCKSTGSSQLTHKEAWEEEQEVTELLQEEYPVWFEKPVLEIVHHNTVPLDKLVDQVWVEILTKYAVGEKCDLMVGNDKTLSVE--VVKI-HPLENPPEENAEKKMEGACDSPSSDKENASQENLKKEPQSKEEESRRESLSDRARRSPRKLPTTMKEEKKKWVMPKFLPHKYDVKLVNEDKVISDVPADNLFRTERPPNKEIMRYFIRHYALRLGSGESAPWVVEDELVKKFSLPSKFSDFLLDPHKF 299          

HSP 2 Score: 117.472 bits (293), Expect = 9.597e-26
Identity = 66/213 (30.99%), Postives = 110/213 (51.64%), Query Frame = 1
Query: 2764 RTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVED---YVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV-----SRARD 3285
            + NP +    G Q  L+   + ++ E    +++G LG +ED   + E+++RV +   L E  E ++++   V ++F   +  P                             + A    ++  AV +AQT +R+++L   LDAC+ W  SA++ +C+VCR+  +++ ++LCD CN AFH FCLRPAL+ IP GEW CP C+P      SR R+
Sbjct: 1051 KGNPGLKTCDGHQE-LLKFLRSDIIEVASRLQKGGLGYLEDTSEFEEFEERVKTLEKLPEFGECVIALQESVIKKFLQGFMAPKQKKKKKTGGEESTTAEEVDDQKKLAEEARVATAVEKWKTAVREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRRKGEDDKLILCDECNKAFHLFCLRPALYRIPAGEWLCPACQPTIARRSSRGRN 1262          

HSP 3 Score: 88.5817 bits (218), Expect = 5.769e-17
Identity = 95/357 (26.61%), Postives = 173/357 (48.46%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVK----QLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREK-----------KREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKD--QHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQE 2133
            A  LL+  K+N    + K     L+ K  +  S +  ++ P+ ++  +  R E  E+K+R   M+ +++++ L ++R +++++LREK           +RE + + ED ELE  K +P      +  G+    +  +  V EF+ CY  LLMP     DD   +T+  L +++  +       L   + VLL+ LLQD       E+ + L+E+P+T+ +  EL+RL             +  +D +EE +    D  Q G   D+ VS+E               EKL+T E+ +L  ++K+ +L  L +RIL    V   ++   ++  E +K+R+   KE ND+ +A +Q ++E
Sbjct:  474 ALHLLRFYKENKGKEDKKTTLSSLLSKAAKALSPEDRSRLPEELKELVQKRWELLEQKRRWALMSEEEKQSVLKQKRQEVKQKLREKAKERREKEMQVRREMSRRYEDQELE-GKNLPAFRLFDMPEGLPNTIFGDVAMVVEFLHCYSGLLMP-----DDQYPITSIALLEALAGE-KAGFLYLNRVLVVLLQTLLQDELAEGYSELDMPLSEIPLTMHSVSELVRLC------------LRPSDAHEEESARGSDDWQSGADFDDMVSSEF-------------LEKLETAEVFELDPQEKVSLLLALCHRILMTYSVEDHVEAVHQKSAEMWKERVATLKEANDRKRAEKQKRKE 798          

HSP 4 Score: 77.411 bits (189), Expect = 1.370e-13
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEY 4614
            C  +L+ +M  + SWPF +PV  EE  DY  +IT P+++  M  K+K   Y S  D    F+ D+  +F NAE YN P S+++      E+ F  +  K   GV Y
Sbjct: 1375 CEEILQKIMKFRHSWPFREPVSAEEAEDYQDVITSPMDLTTMQGKFKSSEYHSASD----FIEDMKLIFSNAEEYNQPSSNVLTCMSRTEEAFVELLQKSLPGVSY 1476          
BLAST of Zinc finger protein, putative vs. Ensembl Zebrafish
Match: baz1a (bromodomain adjacent to zinc finger domain, 1A [Source:ZFIN;Acc:ZDB-GENE-030131-6105])

HSP 1 Score: 85.5001 bits (210), Expect = 2.307e-16
Identity = 31/67 (46.27%), Postives = 43/67 (64.18%), Query Frame = 1
Query: 3076 SFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSR 3276
            S L+  V W+KS  + +C+VCR+  D  +MLLCD C   +H FC+RP L  +P  +WFCP C+P  R
Sbjct:  214 STLERSVAWAKSILNTRCKVCRRKGDAENMLLCDGCGRGYHIFCVRPKLKAVPSEDWFCPECRPKQR 280          

HSP 2 Score: 60.8474 bits (146), Expect = 1.118e-8
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 1
Query: 4294 ACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            AC  +  +++ H+ SWPF+  V   +VPDYY II  PI ++ + EK     Y +  +    ++ DV  MF N   YN  +++     + L+ FF
Sbjct:  471 ACELLSVDLVRHEDSWPFMKLVSRTQVPDYYDIIKKPIALSTIREKVNNCEYQTAAE----YIEDVELMFSNCLEYNPHNTNEAKAGLRLQAFF 560          
BLAST of Zinc finger protein, putative vs. Ensembl Zebrafish
Match: baz1a (bromodomain adjacent to zinc finger domain, 1A [Source:ZFIN;Acc:ZDB-GENE-030131-6105])

HSP 1 Score: 84.3445 bits (207), Expect = 1.105e-15
Identity = 31/67 (46.27%), Postives = 43/67 (64.18%), Query Frame = 1
Query: 3076 SFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSR 3276
            S L+  V W+KS  + +C+VCR+  D  +MLLCD C   +H FC+RP L  +P  +WFCP C+P  R
Sbjct: 1102 STLERSVAWAKSILNTRCKVCRRKGDAENMLLCDGCGRGYHIFCVRPKLKAVPSEDWFCPECRPKQR 1168          

HSP 2 Score: 54.299 bits (129), Expect = 1.470e-6
Identity = 30/81 (37.04%), Postives = 47/81 (58.02%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKD-KKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKN 279
            MPLL  K ++  K   D + DE+  +C   T+EI    +E   +T L N  +W+C +TG+  LT++EAL+SE+     L+N
Sbjct:    1 MPLLHKKPFVRQKPPADLRPDEEVFLC-KYTHEIFRTYDEFFERTILCNSLVWSCAVTGKPGLTYQEALESEKKARLSLQN 80          
BLAST of Zinc finger protein, putative vs. Ensembl Xenopus
Match: BAZ1B (bromodomain adjacent to zinc finger domain 1B [Source:NCBI gene;Acc:100038181])

HSP 1 Score: 190.66 bits (483), Expect = 5.136e-48
Identity = 207/817 (25.34%), Postives = 363/817 (44.43%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVKQ----LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTK-----------LEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYV--------------------EIEQXXXXXXXXXXXXXXPDHILTE----------------WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV-----SRARDADSDTV 3303
            A  L+   +DN +  + K     LI K  ++ S +   + PD ++  +  R E  E +K+   MT +QR+ Y++++R  ++ +++EK RE   K            ED EL   K +P    +    G+    +  +  V EF+  Y  LL+P     D    +TA  + +++ ++       L   + VLL+ LLQD       E+G+ L+E+P+T+ +A EL+R      +  R++        + E  D+  +      D+EV  E               EK++T E  +L+ E+K+ +L  L +RIL    V   +D  Q+   E +K+R+   KE NDK +A +Q ++E     G+    ++V    +      +  +     T+ +I    S V  RR      I+  +E+E   +  ++  + E EE + +K    ++K++     +AK ++R  PLG+DR+  RYW F      +++                    E EQ +  +    ++   PD                     W +  T  EL +LL+ L  +G RES LK  L        D   S+       A + N  +    G+Q  L+   + ++ E    +++G LG ++D  E++ +V +   L +  E +V +   V ++F   +  P                             K A+   ++  A+  AQT +R+++L   LDAC+ W  S+++ +C+VCRK  +++ ++LCD CN AFH FCLRP L +IP+GEW CP C+P      SR R+   D+ 
Sbjct:  395 ALHLISYYRDNKNREDRKSALSALISKVARMLSAEDRKRLPDELQELVQKRYELLEHRKQWAVMTEEQRQEYMSKKREALKARIKEKARERKQKEREERLEKQKRYEDQELT-GKSLPTFKLVDTPEGLPNALFGDVAMVIEFLSGYADLLLP-----DGQYPVTAVSIMEALAAE-KGGFMYLNRVLVVLLQTLLQDEIAEDYGELGMKLSEIPLTLHSASELVR------LCLRKSDSPAGESESTEKEDEDSEGSAVYQDDEVEDE-------------YLEKMETSEFFELTTEEKLHILVALCHRILMTYSVQDHVDTKQQRSGELWKERLAILKEENDKKRAEKQRRKEQ----GSMKPKEEVVASKVVKKQEKTNTMQQDNDTEDMI----SAVKSRR---LQAIQAKKEKEEHQKLTKERLEREAEEERSRKQKASAEKAFHEGIAKAKLVLRRSPLGTDRNHNRYWLFSDEVPGLFIEKGWVHDSINYRFSPPESEQEYEQDAEESEDADSSVGCPDDSTQREGKTVEMTVPKQGQNLWFLCDTQKELDELLDSLHLQGFRESQLKERLYQ------DIMHSI-----HLARKQNLGLKTCDGQQE-LLNFLRSDIIEVATRLQKGGLGYLDDTTEFEAKVRTLENLKDFGECIVFLQAAVIKKFLQGFMAPKQKKRKHQSEEAAAKAEEQDEEKKMAEEAKVASAVEKWKTAIRDAQTFSRMHVLLGMLDACIKWDMSSENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPVLFNIPDGEWLCPACQPATARRSSRGRNYAEDST 1162          

HSP 2 Score: 129.028 bits (323), Expect = 3.711e-29
Identity = 82/257 (31.91%), Postives = 128/257 (49.81%), Query Frame = 1
Query:  178 YNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSSDASSSDKENM-------------------------------------KKKIIPVK-KNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            Y ++IWTC+ TG   LT KEA   EQ  +++LK  F   +E  VL+ VHH+  SLD L+ ++W +I  +Y   E    ++    E  L+  +VKV      +       + S D+ SSDKEN                                      +KK +P K   + Y VK+   DK++  +P +++ R+ RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ ++
Sbjct:   24 YAERIWTCKSTGSSQLTHKEAWDEEQEVTELLKEEFPVWYEKQVLEMVHHNTISLDKLVDQSWMEIMTKYADGEECDFEVGP--EKYLRVTIVKVHPLEKEEQASEKKSEGSCDSPSSDKENSNKVAQDIQLKEESNRRESLSDRARRSPRKLPASLKKEEKKWVPPKFLPHKYDVKLLNEDKVISFVPVDSLYRSERPPNKEILRYFIRHNALRLGTGENAPWVVEDELVKKYSLPSKFSDFLLDPHKYMTLNPSS 278          

HSP 3 Score: 61.2326 bits (147), Expect = 1.992e-8
Identity = 31/108 (28.70%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV+ +E+ DY  ++T+P++   M  K   G Y     +++ FL+D+  +F N E+Y  P S  ++     EQ  + +  K+     Y R
Sbjct: 1213 CEEILAKLIKYRFSWPFREPVNTDEIEDYMNVVTNPMDFQTMQSKCSCGSY----QTVQEFLNDLKLVFGNTELYYEPGSSQLSCLEKTEQCARDLLGKHLPAHTYQR 1316          
BLAST of Zinc finger protein, putative vs. Ensembl Xenopus
Match: BAZ1B (bromodomain adjacent to zinc finger domain 1B [Source:NCBI gene;Acc:100038181])

HSP 1 Score: 190.274 bits (482), Expect = 6.085e-48
Identity = 207/817 (25.34%), Postives = 365/817 (44.68%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVKQ----LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTK-----------LEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYV--------------------EIEQXXXXXXXXXXXXXXPDHILTE----------------WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV-----SRARDADSDTV 3303
            A  L+   +DN +  + K     LI K  ++ S +   + PD ++  +  R E  E +K+   MT +QR+ Y++++R  ++ +++EK RE   K            ED EL   K +P    +    G+    +  +  V EF+  Y  LL+P     D    +TA  + +++ ++       L   + VLL+ LLQD       E+G+ L+E+P+T+ +A EL+R      +  R++        + E  D+  +      D+EV  E               EK++T E  +L+ E+K+ +L  L +RIL    V   +D  Q+   E +K+R+   KE NDK +A +Q ++E     G+    ++V    +      +  +     T+ +I    S V  RR      I+  +E+E   +  ++  + E EE + +K    ++K++     +AK ++R  PLG+DR+  RYW F      +++                    E EQ +  +    ++   PD                     W +  T  EL +LL+ L  +G RES LK  L++      D   S+       A + N  +    G+Q  L+   + ++ E    +++G LG ++D  E++ +V +   L +  E +V +   V ++F   +  P                             K A+   ++  A+  AQT +R+++L   LDAC+ W  S+++ +C+VCRK  +++ ++LCD CN AFH FCLRP L +IP+GEW CP C+P      SR R+   D+ 
Sbjct:  442 ALHLISYYRDNKNREDRKSALSALISKVARMLSAEDRKRLPDELQELVQKRYELLEHRKQWAVMTEEQRQEYMSKKREALKARIKEKARERKQKEREERLEKQKRYEDQEL-TGKSLPTFKLVDTPEGLPNALFGDVAMVIEFLSGYADLLLP-----DGQYPVTAVSIMEALAAE-KGGFMYLNRVLVVLLQTLLQDEIAEDYGELGMKLSEIPLTLHSASELVR------LCLRKSDSPAGESESTEKEDEDSEGSAVYQDDEVEDE-------------YLEKMETSEFFELTTEEKLHILVALCHRILMTYSVQDHVDTKQQRSGELWKERLAILKEENDKKRAEKQRRKEQ----GSMKPKEEVVASKVVKKQEKTNTMQQDNDTEDMI----SAVKSRR---LQAIQAKKEKEEHQKLTKERLEREAEEERSRKQKASAEKAFHEGIAKAKLVLRRSPLGTDRNHNRYWLFSDEVPGLFIEKGWVHDSINYRFSPPESEQEYEQDAEESEDADSSVGCPDDSTQREGKTVEMTVPKQGQNLWFLCDTQKELDELLDSLHLQGFRESQLKERLQNRYQ---DIMHSI-----HLARKQNLGLKTCDGQQE-LLNFLRSDIIEVATRLQKGGLGYLDDTTEFEAKVRTLENLKDFGECIVFLQAAVIKKFLQGFMAPKQKKRKHQSEEAAAKAEEQDEEKKMAEEAKVASAVEKWKTAIRDAQTFSRMHVLLGMLDACIKWDMSSENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPVLFNIPDGEWLCPACQPATARRSSRGRNYAEDST 1212          

HSP 2 Score: 130.183 bits (326), Expect = 1.603e-29
Identity = 85/275 (30.91%), Postives = 134/275 (48.73%), Query Frame = 1
Query:  127 TNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSSDASSSDKENM--------------------------------------KKKIIPVK-KNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            + E   + EE   +   Y ++IWTC+ TG   LT KEA   EQ  +++LK  F   +E  VL+ VHH+  SLD L+ ++W +I  +Y   E    ++    E  L+  +VKV      +       + S D+ SSDKEN                                       +KK +P K   + Y VK+   DK++  +P +++ R+ RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ ++
Sbjct:   34 SKEAFRSREEYESRLERYAERIWTCKSTGSSQLTHKEAWDEEQEVTELLKEEFPVWYEKQVLEMVHHNTISLDKLVDQSWMEIMTKYADGEECDFEVGP--EKYLRVTIVKVHPLEKEEQASEKKSEGSCDSPSSDKENSNKVAQDIQLKEESNRRESLSSDRARRSPRKLPASLKKEEKKWVPPKFLPHKYDVKLLNEDKVISFVPVDSLYRSERPPNKEILRYFIRHNALRLGTGENAPWVVEDELVKKYSLPSKFSDFLLDPHKYMTLNPSS 306          

HSP 3 Score: 62.003 bits (149), Expect = 1.076e-8
Identity = 31/108 (28.70%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV+ +E+ DY  ++T+P++   M  K   G Y     +++ FL+D+  +F N E+Y  P S  ++     EQ  + +  K+     Y R
Sbjct: 1272 CEEILAKLIKYRFSWPFREPVNTDEIEDYMNVVTNPMDFQTMQSKCSCGSY----QTVQEFLNDLKLVFGNTELYYEPGSSQLSCLEKTEQCARDLLGKHLPAHTYQR 1375          
BLAST of Zinc finger protein, putative vs. Ensembl Xenopus
Match: BAZ1B (bromodomain adjacent to zinc finger domain 1B [Source:NCBI gene;Acc:100038181])

HSP 1 Score: 189.504 bits (480), Expect = 1.085e-47
Identity = 207/817 (25.34%), Postives = 365/817 (44.68%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVKQ----LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTK-----------LEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYV--------------------EIEQXXXXXXXXXXXXXXPDHILTE----------------WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV-----SRARDADSDTV 3303
            A  L+   +DN +  + K     LI K  ++ S +   + PD ++  +  R E  E +K+   MT +QR+ Y++++R  ++ +++EK RE   K            ED EL   K +P    +    G+    +  +  V EF+  Y  LL+P     D    +TA  + +++ ++       L   + VLL+ LLQD       E+G+ L+E+P+T+ +A EL+R      +  R++        + E  D+  +      D+EV  E               EK++T E  +L+ E+K+ +L  L +RIL    V   +D  Q+   E +K+R+   KE NDK +A +Q ++E     G+    ++V    +      +  +     T+ +I    S V  RR      I+  +E+E   +  ++  + E EE + +K    ++K++     +AK ++R  PLG+DR+  RYW F      +++                    E EQ +  +    ++   PD                     W +  T  EL +LL+ L  +G RES LK  L++      D   S+       A + N  +    G+Q  L+   + ++ E    +++G LG ++D  E++ +V +   L +  E +V +   V ++F   +  P                             K A+   ++  A+  AQT +R+++L   LDAC+ W  S+++ +C+VCRK  +++ ++LCD CN AFH FCLRP L +IP+GEW CP C+P      SR R+   D+ 
Sbjct:  446 ALHLISYYRDNKNREDRKSALSALISKVARMLSAEDRKRLPDELQELVQKRYELLEHRKQWAVMTEEQRQEYMSKKREALKARIKEKARERKQKEREERLEKQKRYEDQEL-TGKSLPTFKLVDTPEGLPNALFGDVAMVIEFLSGYADLLLP-----DGQYPVTAVSIMEALAAE-KGGFMYLNRVLVVLLQTLLQDEIAEDYGELGMKLSEIPLTLHSASELVR------LCLRKSDSPAGESESTEKEDEDSEGSAVYQDDEVEDE-------------YLEKMETSEFFELTTEEKLHILVALCHRILMTYSVQDHVDTKQQRSGELWKERLAILKEENDKKRAEKQRRKEQ----GSMKPKEEVVASKVVKKQEKTNTMQQDNDTEDMI----SAVKSRR---LQAIQAKKEKEEHQKLTKERLEREAEEERSRKQKASAEKAFHEGIAKAKLVLRRSPLGTDRNHNRYWLFSDEVPGLFIEKGWVHDSINYRFSPPESEQEYEQDAEESEDADSSVGCPDDSTQREGKTVEMTVPKQGQNLWFLCDTQKELDELLDSLHLQGFRESQLKERLQNRYQ---DIMHSI-----HLARKQNLGLKTCDGQQE-LLNFLRSDIIEVATRLQKGGLGYLDDTTEFEAKVRTLENLKDFGECIVFLQAAVIKKFLQGFMAPKQKKRKHQSEEAAAKAEEQDEEKKMAEEAKVASAVEKWKTAIRDAQTFSRMHVLLGMLDACIKWDMSSENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPVLFNIPDGEWLCPACQPATARRSSRGRNYAEDST 1216          

HSP 2 Score: 128.642 bits (322), Expect = 4.512e-29
Identity = 85/279 (30.47%), Postives = 134/279 (48.03%), Query Frame = 1
Query:  127 TNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSSDASSSDKENM------------------------------------------KKKIIPVK-KNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            + E   + EE   +   Y ++IWTC+ TG   LT KEA   EQ  +++LK  F   +E  VL+ VHH+  SLD L+ ++W +I  +Y   E    ++    E  L+  +VKV      +       + S D+ SSDKEN                                           +KK +P K   + Y VK+   DK++  +P +++ R+ RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ ++
Sbjct:   34 SKEAFRSREEYESRLERYAERIWTCKSTGSSQLTHKEAWDEEQEVTELLKEEFPVWYEKQVLEMVHHNTISLDKLVDQSWMEIMTKYADGEECDFEVGP--EKYLRVTIVKVHPLEKEEQASEKKSEGSCDSPSSDKENSNKVAQDIQLKEESNRRESLSSLRESDRARRSPRKLPASLKKEEKKWVPPKFLPHKYDVKLLNEDKVISFVPVDSLYRSERPPNKEILRYFIRHNALRLGTGENAPWVVEDELVKKYSLPSKFSDFLLDPHKYMTLNPSS 310          

HSP 3 Score: 62.003 bits (149), Expect = 1.020e-8
Identity = 31/108 (28.70%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV+ +E+ DY  ++T+P++   M  K   G Y     +++ FL+D+  +F N E+Y  P S  ++     EQ  + +  K+     Y R
Sbjct: 1310 CEEILAKLIKYRFSWPFREPVNTDEIEDYMNVVTNPMDFQTMQSKCSCGSY----QTVQEFLNDLKLVFGNTELYYEPGSSQLSCLEKTEQCARDLLGKHLPAHTYQR 1413          
BLAST of Zinc finger protein, putative vs. Ensembl Xenopus
Match: BAZ1B (bromodomain adjacent to zinc finger domain 1B [Source:NCBI gene;Acc:100038181])

HSP 1 Score: 186.808 bits (473), Expect = 6.960e-47
Identity = 204/809 (25.22%), Postives = 363/809 (44.87%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVKQ----LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTK-----------LEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYV--------------------EIEQXXXXXXXXXXXXXXPDHILTE----------------WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYV--EWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            A  L+   +DN +  + K     LI K  ++ S +   + PD ++  +  R E  E +K+   MT +QR+ Y++++R  ++ +++EK RE   K            ED EL   K +P    +    G+    +  +  V EF+  Y  LL+P     D    +TA  + +++ ++       L   + VLL+ LLQD       E+G+ L+E+P+T+ +A EL+R      +  R++        + E  D+  +      D+EV  E               EK++T E  +L+ E+K+ +L  L +RIL    V   +D  Q+   E +K+R+   KE NDK +A +Q ++E     G+    ++V    +      +  +     T+ +I    S V  RR      I+  +E+E   +  ++  + E EE + +K    ++K++     +AK ++R  PLG+DR+  RYW F      +++                    E EQ +  +    ++   PD                     W +  T  EL +LL+ L  +G RES LK  L+       + +Q +   +   A + N  +    G+Q  L+   + ++ E    +++G LG ++D    E++ RV +   L +  E +V +   V ++F   +  P                             K A+   ++  A+  AQT +R+++L   LDAC+ W  S+++ +C+VCRK  +++ ++LCD CN AFH FCLRP L +IP+GEW CP C+P +  R +
Sbjct:  441 ALHLISYYRDNKNREDRKSALSALISKVARMLSAEDRKRLPDELQELVQKRYELLEHRKQWAVMTEEQRQEYMSKKREALKARIKEKARERKQKEREERLEKQKRYEDQEL-TGKSLPTFKLVDTPEGLPNALFGDVAMVIEFLSGYADLLLP-----DGQYPVTAVSIMEALAAE-KGGFMYLNRVLVVLLQTLLQDEIAEDYGELGMKLSEIPLTLHSASELVR------LCLRKSDSPAGESESTEKEDEDSEGSAVYQDDEVEDE-------------YLEKMETSEFFELTTEEKLHILVALCHRILMTYSVQDHVDTKQQRSGELWKERLAILKEENDKKRAEKQRRKEQ----GSMKPKEEVVASKVVKKQEKTNTMQQDNDTEDMI----SAVKSRR---LQAIQAKKEKEEHQKLTKERLEREAEEERSRKQKASAEKAFHEGIAKAKLVLRRSPLGTDRNHNRYWLFSDEVPGLFIEKGWVHDSINYRFSPPESEQEYEQDAEESEDADSSVGCPDDSTQREGKTVEMTVPKQGQNLWFLCDTQKELDELLDSLHLQGFRESQLKERLQ-------NRYQDIM-HSIHLARKQNLGLKTCDGQQE-LLNFLRSDIIEVATRLQKGGLGYLDDTTEFEYKPRVRTLENLKDFGECIVFLQAAVIKKFLQGFMAPKQKKRKHQSEEAAAKAEEQDEEKKMAEEAKVASAVEKWKTAIRDAQTFSRMHVLLGMLDACIKWDMSSENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPVLFNIPDGEWLCPACQPATARRSS 1203          

HSP 2 Score: 130.568 bits (327), Expect = 1.238e-29
Identity = 85/274 (31.02%), Postives = 134/274 (48.91%), Query Frame = 1
Query:  127 TNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSSDASSSDKENM-------------------------------------KKKIIPVK-KNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            + E   + EE   +   Y ++IWTC+ TG   LT KEA   EQ  +++LK  F   +E  VL+ VHH+  SLD L+ ++W +I  +Y   E    ++    E  L+  +VKV      +       + S D+ SSDKEN                                      +KK +P K   + Y VK+   DK++  +P +++ R+ RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ ++
Sbjct:   34 SKEAFRSREEYESRLERYAERIWTCKSTGSSQLTHKEAWDEEQEVTELLKEEFPVWYEKQVLEMVHHNTISLDKLVDQSWMEIMTKYADGEECDFEVGP--EKYLRVTIVKVHPLEKEEQASEKKSEGSCDSPSSDKENSNKVAQDIQLKEESNRRESLSDRARRSPRKLPASLKKEEKKWVPPKFLPHKYDVKLLNEDKVISFVPVDSLYRSERPPNKEILRYFIRHNALRLGTGENAPWVVEDELVKKYSLPSKFSDFLLDPHKYMTLNPSS 305          

HSP 3 Score: 61.6178 bits (148), Expect = 1.179e-8
Identity = 31/108 (28.70%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV+ +E+ DY  ++T+P++   M  K   G Y     +++ FL+D+  +F N E+Y  P S  ++     EQ  + +  K+     Y R
Sbjct: 1263 CEEILAKLIKYRFSWPFREPVNTDEIEDYMNVVTNPMDFQTMQSKCSCGSY----QTVQEFLNDLKLVFGNTELYYEPGSSQLSCLEKTEQCARDLLGKHLPAHTYQR 1366          
BLAST of Zinc finger protein, putative vs. Ensembl Xenopus
Match: BAZ1A (bromodomain adjacent to zinc finger domain 1A [Source:NCBI gene;Acc:100497377])

HSP 1 Score: 94.7449 bits (234), Expect = 1.034e-18
Identity = 42/123 (34.15%), Postives = 70/123 (56.91%), Query Frame = 1
Query: 2935 MKETLVSVFLGVHERFWNVPLK-SANGR------NEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRAR 3282
            +   L+ +  GV  ++   PL  S +GR      + +  ++  + + +++ +  S LD  + WS+S  + +C+VCRK  D  SM+LCD C+   H +C+RP L  +PEG+WFCP C P  R+R
Sbjct:  931 LARALLQIEQGVERKYLKAPLDVSESGRVQRTVLDRWRESLLSSGSFSQIFLHLSTLDRSILWSRSILNARCKVCRKKGDGESMVLCDGCDRGHHIYCVRPKLKYVPEGDWFCPECHPKQRSR 1053          

HSP 2 Score: 59.3066 bits (142), Expect = 6.162e-8
Identity = 34/108 (31.48%), Postives = 52/108 (48.15%), Query Frame = 1
Query: 4294 ACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYT 4617
            AC  ++  ++ H  SWPF+  V   +VPDY+ II  PI +  + EK  +  Y    +    F+ DV  MF N   YN  +S      + L+ FF  +    + G+E T
Sbjct: 1274 ACEQLVVELVRHDDSWPFMRLVSKIQVPDYFDIIQKPIALNLIREKVNKCEYKCASE----FIDDVQLMFSNCFEYNHHNSSEAKAGVRLQSFF--VSEARKLGLEVT 1375          
BLAST of Zinc finger protein, putative vs. Ensembl Mouse
Match: Baz1b (bromodomain adjacent to zinc finger domain, 1B [Source:MGI Symbol;Acc:MGI:1353499])

HSP 1 Score: 138.658 bits (348), Expect = 3.191e-32
Identity = 92/288 (31.94%), Postives = 139/288 (48.26%), Query Frame = 1
Query:  109 TICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGV-------------------------------------------VVKVDRSRS---NDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            TI H  T E     EE   +   Y+++IWTC+ TG   LT KEA + EQ  +++LK  F   +E  VL+ VHH+  SL+ L+  AW +I  +Y V E    ++   K + +K V                                           VVK D  R    ND    SP KL +     +++    K +P K    Y VK+   DK++ ++P++++ RT RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ +T
Sbjct:   24 TIPH--TQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPNWYEKLVLEMVHHNTASLEKLVDSAWLEIMTKYAVGEECDFEVGKEKMLKVKIVKIHPLEKVDEEAVEKKSDGACDSPSSDKENSSQMAQDLQKKETVVKEDEGRRESINDRARRSPRKLPTSLKKGERKWAPPKFLPHK----YDVKLQNEDKIISNVPADSLIRTERPPNKEILRYFIRHNALRAGTGENAPWVVEDELVKKYSLPSKFSDFLLDPYKYMTLNPST 305          

HSP 2 Score: 128.257 bits (321), Expect = 4.800e-29
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query: 2602 WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP---------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            W +  +  EL +LL+CL  +GIRES LK  LE    ++T             A + N  + +  G Q  L+   + +L E    +++G LG +E   E++ RV S   L +  E ++++   V ++F   +  P                            K A+   ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCRK  +++ ++LCD CN AFH FCLRPAL+++P+GEW CP C+P +  R++
Sbjct:  991 WFLCDSQKELDELLSCLHPQGIRESQLKERLEKRYQEITHSIY--------LARKPNLGLKSCDGNQE-LLNFLRSDLIEVATRLQKGGLGYMEGTSEFEARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKKRKLQSEDSTKSEEVDEEKKMVEEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPPTARRNS 1240          

HSP 3 Score: 120.168 bits (300), Expect = 1.404e-26
Identity = 124/464 (26.72%), Postives = 219/464 (47.20%), Query Frame = 1
Query: 1171 LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKR-----------EENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVE 2529
            +I K  +L SN+  A+ P+ +R  +  R E  E KKR  +M+ +QR+ YL ++R +++ +LREK +           E+  + ED EL   + +P    +    G+    +  +  V EF+ CY  LL+P     D    +TA  L ++ +S        L   + +LL+ LLQD       E+G+ L+E+P+T+ +  EL+RL L         R  V+ D      DD KD      D EV  E               EKL+T E  +L+ E+K+ +L  L +RIL    V   ++  Q+   E +K+R+   KE NDK +A +Q ++EM          ++   +++ G  +    +        +  DD    V+ R    + ++   +RE +  + +   + E EE +++K    ++K++     +AK ++R  P+G+DR+  RYW F +    +++E
Sbjct:  499 VISKTARLLSNEDRARLPEELRALVQKRYELLEHKKRWASMSEEQRKEYLKKKRQELKERLREKAKERREREMLERLEKQKRFEDQELG-GRNLPAFRLVDTPEGLPNTLFGDVALVVEFLSCYSGLLLP-----DAQYPITAVSLMEA-LSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLR--------RCDVQEDSEGSETDDNKDS-TPFEDNEVQDE-------------FLEKLETSEFFELTSEEKLRILTALCHRILMTYSVQDHMETRQQVSAELWKERLAVLKEENDKKRAEKQKRKEM-----EARNKENGKEENVLGKVDRKKEIVKIEQQVEVEADDMISAVKSR--RLLSMQAKRKREIQERETKVRLEREAEEERMRKHKAAAEKAFQEGIAKAKLVLRRTPIGTDRNHNRYWLFSNEVPGLFIE 926          

HSP 4 Score: 67.781 bits (164), Expect = 1.499e-10
Identity = 35/108 (32.41%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV  +E  DYY +I  P++   +  K   G Y     S++ FL+D+ Q+F NAE+YN   S +++     EQ    +  K+  G  Y R
Sbjct: 1344 CEDILHKLVKYRFSWPFREPVTRDEAEDYYDVIEHPMDFQTIQNKCSCGNYR----SVQEFLTDMKQVFANAELYNCRGSHVLSCMEKTEQCLLALLQKHLPGHPYVR 1447          
BLAST of Zinc finger protein, putative vs. Ensembl Mouse
Match: Baz1a (bromodomain adjacent to zinc finger domain 1A [Source:MGI Symbol;Acc:MGI:1309478])

HSP 1 Score: 93.2041 bits (230), Expect = 2.411e-18
Identity = 40/116 (34.48%), Postives = 64/116 (55.17%), Query Frame = 1
Query: 2947 LVSVFLGVHERFWNVPLKSANGRNEFLNAVEQ---------AQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP 3267
            L  +  G+  RF   PL   +    +   +++         + +Q  L++  S LD  V WSKS  + +C++CRK  D  +M+LCD C+   HT+C+RP L  +P+G+WFCP C+P
Sbjct: 1085 LFQIEQGIERRFLKAPLDGNDSGRSYKTVLDRWRESLLSSASLSQVFLHL--STLDRSVMWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKAVPDGDWFCPECRP 1198          

HSP 2 Score: 58.151 bits (139), Expect = 1.301e-7
Identity = 36/125 (28.80%), Postives = 64/125 (51.20%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKES-LDTLIHKAWTQIHQEYCVNEPVTI 411
            MPLL  K ++  K   D + ++      +TNEI  + ++   +T L N  +W+C +TG+  LT++EAL+SE+   + L+ SF +     VL   + ++ S L  +    +  +   Y V E V +
Sbjct:    1 MPLLHRKPFVRQKPPGDLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESERKARQNLQ-SFPEPLIIPVLYLTNLTRRSRLHEICDDIFAYVKDRYFVEETVEV 124          

HSP 3 Score: 51.9878 bits (123), Expect = 9.824e-6
Identity = 31/112 (27.68%), Postives = 49/112 (43.75%), Query Frame = 1
Query: 4240 APIQKKSCNGISAEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
             P+ ++S           A   ++  ++ H  SWPF+  V   +VPDYY II  PI +  + EK  +  Y    +    F+ D+  MF N   YN  ++        L+ FF
Sbjct: 1418 VPLNRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASE----FIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFF 1525          
BLAST of Zinc finger protein, putative vs. Ensembl Mouse
Match: Baz1a (bromodomain adjacent to zinc finger domain 1A [Source:MGI Symbol;Acc:MGI:1309478])

HSP 1 Score: 93.2041 bits (230), Expect = 2.492e-18
Identity = 40/116 (34.48%), Postives = 64/116 (55.17%), Query Frame = 1
Query: 2947 LVSVFLGVHERFWNVPLKSANGRNEFLNAVEQ---------AQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP 3267
            L  +  G+  RF   PL   +    +   +++         + +Q  L++  S LD  V WSKS  + +C++CRK  D  +M+LCD C+   HT+C+RP L  +P+G+WFCP C+P
Sbjct: 1082 LFQIEQGIERRFLKAPLDGNDSGRSYKTVLDRWRESLLSSASLSQVFLHL--STLDRSVMWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKAVPDGDWFCPECRP 1195          

HSP 2 Score: 57.7658 bits (138), Expect = 1.379e-7
Identity = 36/125 (28.80%), Postives = 64/125 (51.20%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKES-LDTLIHKAWTQIHQEYCVNEPVTI 411
            MPLL  K ++  K   D + ++      +TNEI  + ++   +T L N  +W+C +TG+  LT++EAL+SE+   + L+ SF +     VL   + ++ S L  +    +  +   Y V E V +
Sbjct:    1 MPLLHRKPFVRQKPPGDLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESERKARQNLQ-SFPEPLIIPVLYLTNLTRRSRLHEICDDIFAYVKDRYFVEETVEV 124          
BLAST of Zinc finger protein, putative vs. Ensembl Mouse
Match: Chd4 (chromodomain helicase DNA binding protein 4 [Source:MGI Symbol;Acc:MGI:1344380])

HSP 1 Score: 82.8037 bits (203), Expect = 4.001e-15
Identity = 41/135 (30.37%), Postives = 62/135 (45.93%), Query Frame = 1
Query: 3121 DKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQ--NSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            D C VC++  +   ++LCD+C  A+H  CL P +   PEG+W CPHC+      +A  D            + + +     +  + H E C VC       +L  C +C   +H HC  PPL +I    W C +C
Sbjct:  364 DYCEVCQQGGE---IILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKEDNSE------GEEILEEVGGDPEEEDDHHMEFCRVCKDGG---ELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRC 486          
BLAST of Zinc finger protein, putative vs. Ensembl Mouse
Match: Chd4 (chromodomain helicase DNA binding protein 4 [Source:MGI Symbol;Acc:MGI:1344380])

HSP 1 Score: 82.8037 bits (203), Expect = 4.393e-15
Identity = 41/135 (30.37%), Postives = 62/135 (45.93%), Query Frame = 1
Query: 3121 DKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQ--NSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            D C VC++  +   ++LCD+C  A+H  CL P +   PEG+W CPHC+      +A  D            + + +     +  + H E C VC       +L  C +C   +H HC  PPL +I    W C +C
Sbjct:  371 DYCEVCQQGGE---IILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQWEAKEDNSE------GEEILEEVGGDPEEEDDHHMEFCRVCKDGG---ELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRC 493          
BLAST of Zinc finger protein, putative vs. UniProt/SwissProt
Match: sp|A2BIL7|BAZ1B_DANRE (Tyrosine-protein kinase BAZ1B OS=Danio rerio OX=7955 GN=baz1b PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 6.118e-32
Identity = 97/302 (32.12%), Postives = 149/302 (49.34%), Query Frame = 1
Query:   43 PLLSNKLYILNKIRKDKK---DEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSS--DASSSDKENM----------------------------------------KKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            PLL  K Y L K   +     +E  TI H  T E   N+EE   +   Y ++IWTC+ TG   LT KEA + EQ  +++L+  +   FE  VL+ VHH+   LD L+ + W +I  +Y V E   + +   K + ++  VVK+     N  +EN+  K+    D+ SSDKEN                                         KK ++P    + Y VK+   DK++ D+P++ + RT RPP+K+ +R FIR +A+R    ++ PWVV++ELVKK+ LP+   +F +D  K 
Sbjct:    3 PLLGRKPYPLVKPLSEPPGPGEEVYTIEH--TKEAFRNKEEYEARLRRYGERIWTCKSTGSSQLTHKEAWEEEQEVTELLQEEYPVWFEKPVLEIVHHNTVPLDKLVDQVWVEILTKYAVGEKCDLMVGNDKTLSVE--VVKI-HPLENPPEENAEKKMEGACDSPSSDKENASQENLKKEPQSKEEESRRESLSDRARRSPRKLPTTMKEEKKKWVMPKFLPHKYDVKLVNEDKVISDVPADNLFRTERPPNKEIMRYFIRHYALRLGSGESAPWVVEDELVKKFSLPSKFSDFLLDPHKF 299          

HSP 2 Score: 117.472 bits (293), Expect = 7.311e-25
Identity = 66/213 (30.99%), Postives = 110/213 (51.64%), Query Frame = 1
Query: 2764 RTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVED---YVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV-----SRARD 3285
            + NP +    G Q  L+   + ++ E    +++G LG +ED   + E+++RV +   L E  E ++++   V ++F   +  P                             + A    ++  AV +AQT +R+++L   LDAC+ W  SA++ +C+VCR+  +++ ++LCD CN AFH FCLRPAL+ IP GEW CP C+P      SR R+
Sbjct: 1051 KGNPGLKTCDGHQE-LLKFLRSDIIEVASRLQKGGLGYLEDTSEFEEFEERVKTLEKLPEFGECVIALQESVIKKFLQGFMAPKQKKKKKTGGEESTTAEEVDDQKKLAEEARVATAVEKWKTAVREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRRKGEDDKLILCDECNKAFHLFCLRPALYRIPAGEWLCPACQPTIARRSSRGRN 1262          

HSP 3 Score: 88.1965 bits (217), Expect = 6.022e-16
Identity = 95/357 (26.61%), Postives = 173/357 (48.46%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVK----QLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREK-----------KREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKD--QHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQE 2133
            A  LL+  K+N    + K     L+ K  +  S +  ++ P+ ++  +  R E  E+K+R   M+ +++++ L ++R +++++LREK           +RE + + ED ELE  K +P      +  G+    +  +  V EF+ CY  LLMP     DD   +T+  L +++  +       L   + VLL+ LLQD       E+ + L+E+P+T+ +  EL+RL             +  +D +EE +    D  Q G   D+ VS+E               EKL+T E+ +L  ++K+ +L  L +RIL    V   ++   ++  E +K+R+   KE ND+ +A +Q ++E
Sbjct:  474 ALHLLRFYKENKGKEDKKTTLSSLLSKAAKALSPEDRSRLPEELKELVQKRWELLEQKRRWALMSEEEKQSVLKQKRQEVKQKLREKAKERREKEMQVRREMSRRYEDQELE-GKNLPAFRLFDMPEGLPNTIFGDVAMVVEFLHCYSGLLMP-----DDQYPITSIALLEALAGE-KAGFLYLNRVLVVLLQTLLQDELAEGYSELDMPLSEIPLTMHSVSELVRLC------------LRPSDAHEEESARGSDDWQSGADFDDMVSSEF-------------LEKLETAEVFELDPQEKVSLLLALCHRILMTYSVEDHVEAVHQKSAEMWKERVATLKEANDRKRAEKQKRKE 798          

HSP 4 Score: 77.7962 bits (190), Expect = 9.544e-13
Identity = 38/106 (35.85%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEY 4614
            C  +L+ +M  + SWPF +PV  EE  DY  +IT P+++  M  K+K   Y S  D    F+ D+  +F NAE YN P S+++      E+ F  +  K   GV Y
Sbjct: 1375 CEEILQKIMKFRHSWPFREPVSAEEAEDYQDVITSPMDLTTMQGKFKSSEYHSASD----FIEDMKLIFSNAEEYNQPSSNVLTCMSRTEEAFVELLQKSLPGVSY 1476          
BLAST of Zinc finger protein, putative vs. UniProt/SwissProt
Match: sp|Q9UIG0|BAZ1B_HUMAN (Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.649e-31
Identity = 92/288 (31.94%), Postives = 139/288 (48.26%), Query Frame = 1
Query:  109 TICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGV-------------------------------------------VVKVDRSRS---NDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            TI H  T E     EE   +   Y+++IWTC+ TG   LT KEA + EQ  +++LK  F   +E  VL+ VHH+  SL+ L+  AW +I  +Y V E    ++   K + +K V                                           VVK D  R    ND    SP KL +     +++    K +P K    Y VK+   DK++ ++P++++ RT RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ +T
Sbjct:   24 TIPH--TQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEECDFEVGKEKMLKVKIVKIHPLEKVDEEATEKKSDGACDSPSSDKENSSQIAQDHQKKETVVKEDEGRRESINDRARRSPRKLPTSLKKGERKWAPPKFLPHK----YDVKLQNEDKIISNVPADSLIRTERPPNKEIVRYFIRHNALRAGTGENAPWVVEDELVKKYSLPSKFSDFLLDPYKYMTLNPST 305          

HSP 2 Score: 133.265 bits (334), Expect = 1.028e-29
Identity = 84/259 (32.43%), Postives = 136/259 (52.51%), Query Frame = 1
Query: 2602 WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP---------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            W +  +  EL +LLNCL  +GIRES LK  LE       D   S+       A + N  + +  G Q  L+   + +L E    +++G LG VE+  E++ RV S   L +  E ++++   V ++F   +  P                            K A+   ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCRK  +++ ++LCD CN AFH FCLRPAL+++P+GEW CP C+P +  R++
Sbjct:  991 WFLCDSQKELDELLNCLHPQGIRESQLKERLEKRYQ---DIIHSI-----HLARKPNLGLKSCDGNQE-LLNFLRSDLIEVATRLQKGGLGYVEETSEFEARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRRKLQSEDSAKTEEVDEEKKMVEEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNS 1240          

HSP 3 Score: 111.309 bits (277), Expect = 5.404e-23
Identity = 129/474 (27.22%), Postives = 215/474 (45.36%), Query Frame = 1
Query: 1171 LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAY----------------LNERRNQMRRQLREKKREENTKLEDNELEYAKQI--PEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGR---LFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVE 2529
            +I K  +L S++  A+ P+ +R  +  R E  E KKR  +M+ +QR+ Y                   R  +M  +L ++KR E+ +L    L   + +  PEG P ++ G         +  V EF+ CY  LL+P     D    +TA  L ++ +S        L   + +LL+ LLQD       E+G+ L+E+P+T+ +  EL+RL L         R  V+ +      DD KD      D EV  E               EKL+T E  +L+ E+K+ +L  L +RIL    V   ++  Q+   E +K+R+   KE NDK +A +Q ++EM          +  N K   G G    +   +      D+   D  S V  RR    + I+  +ERE +  + +   + + EE +++K    ++K++     +AK +MR  P+G+DR+  RYW F      +++E
Sbjct:  498 VISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSEEQRKEYLKKKREELKKKLKEKAKERREKEMLERLEKQKRYEDQELTGKNLPAFRLVDTPEGLPNTLFGD--------VAMVVEFLSCYSGLLLP-----DAQYPITAVSLMEA-LSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLR--------RSDVQEESEGSDTDDNKDS-AAFEDNEVQDE-------------FLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKERLAVLKEENDKKRAEKQKRKEM-------EAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMISAVKSRR---LLAIQAKKEREIQEREMKVKLERQAEEERIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIE 925          

HSP 4 Score: 73.9442 bits (180), Expect = 1.169e-11
Identity = 37/108 (34.26%), Postives = 59/108 (54.63%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV  +E  DYY +IT P++   +  K   G Y     S++ FL+D+ Q+F NAEVYN   S +++  +  EQ    +  K+  G  Y R
Sbjct: 1348 CEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYR----SVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVR 1451          
BLAST of Zinc finger protein, putative vs. UniProt/SwissProt
Match: sp|Q9Z277|BAZ1B_MOUSE (Tyrosine-protein kinase BAZ1B OS=Mus musculus OX=10090 GN=Baz1b PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 2.232e-31
Identity = 92/288 (31.94%), Postives = 139/288 (48.26%), Query Frame = 1
Query:  109 TICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGV-------------------------------------------VVKVDRSRS---NDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            TI H  T E     EE   +   Y+++IWTC+ TG   LT KEA + EQ  +++LK  F   +E  VL+ VHH+  SL+ L+  AW +I  +Y V E    ++   K + +K V                                           VVK D  R    ND    SP KL +     +++    K +P K    Y VK+   DK++ ++P++++ RT RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ +T
Sbjct:   24 TIPH--TQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPNWYEKLVLEMVHHNTASLEKLVDSAWLEIMTKYAVGEECDFEVGKEKMLKVKIVKIHPLEKVDEEAVEKKSDGACDSPSSDKENSSQMAQDLQKKETVVKEDEGRRESINDRARRSPRKLPTSLKKGERKWAPPKFLPHK----YDVKLQNEDKIISNVPADSLIRTERPPNKEILRYFIRHNALRAGTGENAPWVVEDELVKKYSLPSKFSDFLLDPYKYMTLNPST 305          

HSP 2 Score: 128.257 bits (321), Expect = 3.358e-28
Identity = 81/259 (31.27%), Postives = 135/259 (52.12%), Query Frame = 1
Query: 2602 WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP---------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            W +  +  EL +LL+CL  +GIRES LK  LE    ++T             A + N  + +  G Q  L+   + +L E    +++G LG +E   E++ RV S   L +  E ++++   V ++F   +  P                            K A+   ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCRK  +++ ++LCD CN AFH FCLRPAL+++P+GEW CP C+P +  R++
Sbjct:  991 WFLCDSQKELDELLSCLHPQGIRESQLKERLEKRYQEITHSIY--------LARKPNLGLKSCDGNQE-LLNFLRSDLIEVATRLQKGGLGYMEGTSEFEARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKKRKLQSEDSTKSEEVDEEKKMVEEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPPTARRNS 1240          

HSP 3 Score: 120.168 bits (300), Expect = 9.818e-26
Identity = 124/464 (26.72%), Postives = 219/464 (47.20%), Query Frame = 1
Query: 1171 LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKR-----------EENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVE 2529
            +I K  +L SN+  A+ P+ +R  +  R E  E KKR  +M+ +QR+ YL ++R +++ +LREK +           E+  + ED EL   + +P    +    G+    +  +  V EF+ CY  LL+P     D    +TA  L ++ +S        L   + +LL+ LLQD       E+G+ L+E+P+T+ +  EL+RL L         R  V+ D      DD KD      D EV  E               EKL+T E  +L+ E+K+ +L  L +RIL    V   ++  Q+   E +K+R+   KE NDK +A +Q ++EM          ++   +++ G  +    +        +  DD    V+ R    + ++   +RE +  + +   + E EE +++K    ++K++     +AK ++R  P+G+DR+  RYW F +    +++E
Sbjct:  499 VISKTARLLSNEDRARLPEELRALVQKRYELLEHKKRWASMSEEQRKEYLKKKRQELKERLREKAKERREREMLERLEKQKRFEDQELG-GRNLPAFRLVDTPEGLPNTLFGDVALVVEFLSCYSGLLLP-----DAQYPITAVSLMEA-LSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLR--------RCDVQEDSEGSETDDNKDS-TPFEDNEVQDE-------------FLEKLETSEFFELTSEEKLRILTALCHRILMTYSVQDHMETRQQVSAELWKERLAVLKEENDKKRAEKQKRKEM-----EARNKENGKEENVLGKVDRKKEIVKIEQQVEVEADDMISAVKSR--RLLSMQAKRKREIQERETKVRLEREAEEERMRKHKAAAEKAFQEGIAKAKLVLRRTPIGTDRNHNRYWLFSNEVPGLFIE 926          

HSP 4 Score: 67.781 bits (164), Expect = 1.049e-9
Identity = 35/108 (32.41%), Postives = 57/108 (52.78%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +PV  +E  DYY +I  P++   +  K   G Y     S++ FL+D+ Q+F NAE+YN   S +++     EQ    +  K+  G  Y R
Sbjct: 1344 CEDILHKLVKYRFSWPFREPVTRDEAEDYYDVIEHPMDFQTIQNKCSCGNYR----SVQEFLTDMKQVFANAELYNCRGSHVLSCMEKTEQCLLALLQKHLPGHPYVR 1447          
BLAST of Zinc finger protein, putative vs. UniProt/SwissProt
Match: sp|A8DZJ1|BAZ1B_XENLA (Tyrosine-protein kinase BAZ1B OS=Xenopus laevis OX=8355 GN=baz1b PE=2 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 8.226e-30
Identity = 99/368 (26.90%), Postives = 167/368 (45.38%), Query Frame = 1
Query: 2401 SQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVE-------------------IEQXXXXXXXXXXXXXXPD--------HILTE--------WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVA 3306
            ++K++     +AK ++R  PLG+DR+  RYW F      +Y+E                    EQ +  +    ++   PD        H  T         W +  T  EL +LL+ L  +G RES LK  L++      D   S+       A + N  +    G+Q  L+   + ++ E    +++G LG ++D  E++ +V +   L +  E +V +   V ++F   +  P                             K A+   ++  A+  AQT +R+++L   LDAC+ W  S+++ +C+VCRK  +++ ++LCD CN AFH FCLRP L +IP+GEW CP C+P +  R +     A
Sbjct:  855 AEKAFHEGIAKAKLVLRRSPLGTDRNHNRYWLFSDEVPGLYIEKGWVHDSINYRFSPESKQDSEQDAEESEDANSSIGCPDDSTQREEKHAETTVPKQGQNLWFLCDTQKELDELLDSLHPQGFRESQLKERLQNRYQ---DIMHSI-----HLARKQNLGLKTCDGQQE-LLNFLRSDIIEVATRLQKGGLGYLDDTTEFEAKVRTFENLKDFGECIVFLQAAVIKKFLQGFMAPKQKKRKHQSEEAAAKAEEQDEEKKMAEEAKVASAVEKWKVAIRDAQTFSRMHVLLGMLDACIKWDMSSENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPVLFNIPDGEWLCPACQPATARRSSRGRNYA 1213          

HSP 2 Score: 128.642 bits (322), Expect = 2.314e-28
Identity = 85/279 (30.47%), Postives = 134/279 (48.03%), Query Frame = 1
Query:  127 TNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSSDASSSDKENM------------------------------------------KKKIIPVK-KNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            + E   + EE   +   Y ++IWTC+ TG   LT KEA   EQ  +++LK  F   +E  VL+ VHH+  SLD L+ ++W +I  +Y   E    ++    E  L+  +VKV      +       + S D+ SSDKEN                                           +KK +P K   + Y VK+   DK++  +P +++ R+ RPP+K+ +R FIR +A+R    +N PWVV++ELVKKY LP+   +F +D  K   L+ ++
Sbjct:   34 SKEAFRSREEYESRLERYAERIWTCKSTGSSQLTHKEAWDEEQEVAELLKEEFPVWYEKQVLEMVHHNTISLDKLVDQSWMEIMTKYADGEECDFEVGP--EKYLRAKIVKVHPLEKEEQASEKKSEGSCDSPSSDKENSNKVAQDIQLKEESNRLESLSSLRESDRARRSPRKLPTSLKKEEKKWVPPKFLPHKYDVKLLNEDKVISFVPVDSLYRSERPPNKEILRYFIRHNALRIGTGENAPWVVEDELVKKYTLPSKFSDFLLDPHKYMTLNPSS 310          

HSP 3 Score: 80.1073 bits (196), Expect = 1.791e-13
Identity = 92/343 (26.82%), Postives = 156/343 (45.48%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVKQ----LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTKLEDNELE----------YAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVND 2100
            A  L+   +DN +  + K     LI K  ++ S +   + PD ++  +  R E  E +K+   MT +QRE Y+ ++R  ++ +++EK RE   K  +  LE            K +P    +    G+    +  +  V EF+  Y  LL+P     D    +TA  L +++ ++       L   + VLL+ LLQD       E+G+ L+E+P+T+ +A EL+RL L          + +E  G+E++      Q  +V DE                    EKL+T E  +L+ E+K+ +L  L +RIL    V   +D  Q+   E +K+R+   K  ND
Sbjct:  449 ALHLISYYRDNKNREDRKSALSALISKVARMLSAEDRKRLPDDLQELVQKRYELLEHRKQWAVMTEEQREEYMRKKREALKARIKEKTRERKQKEREERLEKQKRYEDQDLTGKSLPTFKLVDTPEGLPNALFGDVAMVIEFLSGYSDLLLP-----DGQYPVTAVSLMEALAAE-KGGFMYLNRGLVVLLQTLLQDEIAEDYGELGMKLSEIPLTLHSASELVRLCLRKSDSPAGENESIEK-GDEDSEGSAVYQDDEVEDE------------------YLEKLETSEFFELTTEEKLHILAALCHRILMTYSVQDHVDAKQQRSGELWKERLAILKGEND 766          

HSP 4 Score: 56.225 bits (134), Expect = 3.459e-6
Identity = 29/108 (26.85%), Postives = 55/108 (50.93%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  ++ ++ SWPF +P + +E+ DY +++T P++   M  K   G Y     +++ FL+D+  +F N E+Y    S  ++     EQ  + +  K+     Y R
Sbjct: 1313 CEEILAKLIKYRFSWPFREPFNADEIEDYTKVVTTPMDFQTMQSKCSCGSY----QTVQEFLNDLKLVFGNTELYYEAGSSQLSCLEKTEQCARDLLGKHLPAHTYQR 1416          
BLAST of Zinc finger protein, putative vs. UniProt/SwissProt
Match: sp|Q9NRL2|BAZ1A_HUMAN (Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.877e-18
Identity = 42/126 (33.33%), Postives = 70/126 (55.56%), Query Frame = 1
Query: 2917 SVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQ---------AQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP 3267
            S  ++ +   L  +  G+  RF   PL +++    +   +++         + +Q  L++  S LD  V WSKS  + +C++CRK  D  +M+LCD C+   HT+C+RP L  +PEG+WFCP C+P
Sbjct: 1074 SSVVHYLAMALFQIEQGIERRFLKAPLDASDSGRSYKTVLDRWRESLLSSASLSQVFLHL--STLDRSVIWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP 1197          

HSP 2 Score: 56.225 bits (134), Expect = 3.333e-6
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVL---QFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTI 411
            MPLL  K ++  K   D + ++      +TNEI  + ++   +T L N  +W+C +TG+  LT++EAL+SE+   + L+ SF +     VL      H S+  L  +    +  +   Y V E V +
Sbjct:    1 MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESEKKARQNLQ-SFPEPLIIPVLYLTSLTHRSR--LHEICDDIFAYVKDRYFVEETVEV 124          
BLAST of Zinc finger protein, putative vs. TrEMBL
Match: A0A1S3IXV7 (tyrosine-protein kinase BAZ1B OS=Lingula unguis OX=7574 GN=LOC106168497 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 3.572e-63
Identity = 238/887 (26.83%), Postives = 408/887 (46.00%), Query Frame = 1
Query: 1162 VKQLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIG-AKFGTDDVNNKSMTGDGNNSGRLFVSGGTDS----LITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYV-------EIE-----QXXXXXXXXXXXXXXPDHILTE------------------------------WNMFTTHDELKQ---LLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNE-----------------FLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRA---------RDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQCRL--DEATKTNKQPSRRSISTVGAA 3588
            +KQL+++  ++ S QQ    P  ++  +  + E++EE K+L  M+A++++ Y+ ++      + R K  E+    +D +L   K +P    +    GM  + +  +  V EF+  Y +LLMP     DDS  + +  L ++++S     +  L   + VLL+ LLQD      KE+ + L+++PV + T  E         + +   R+   +DG  + ++D +D      + EV   +              ++L+T+E  +LS EDK+ VL  L +RI+    V   +++ Q E  + +K+RI + KE N+KL+  +Q  +E  K  G  K G +  +     G          +  +++    L  +D + VV+RR  +  K    +E++ + +K    ++ E++           +K +      AK ++R  P+G+DR   RYW F      +Y+       EI+     +T T           P+   TE                               N++ T+D +K+   L+  L  +GIRES LK+EL+        ++Q V +     A RTN  +    GE + L  GFK+EL ETE  +R G LGGVE++ +WQ ++  +  + ++   L+     V E+F    +     + E                 +++AVE   T +RL++L   LD+C+ W KSA++ KC++CRK  ++  +LLCD CN  FH +CLRP L  IPEGEWFCP C P S+          +D   +T          S          +  H+E C VC +++    L  C++C K++H  CHEP LR+  R  W C  C++  +     N + SRR  +   +A
Sbjct:  515 LKQLVYQAAKVLSAQQRNILPPEVKELVDAKYERFEELKKLKTMSAEEKKEYMKKKIKMQHEKCRLKMIEKKKLYDDQDLSDLKSLPAPKLVPTPDGMVNELFGEVAMVTEFISSYSQLLMP-----DDSYAIMSDALMKALVSG-KEGYAYLGRVLVVLLQTLLQDGIAEDYKELKVPLSDVPVNLFTCSE---------LLRLCLRKHDVDDGASKHSEDTRDSEEMEEETEVPDNL-------------IQQLETMEFFELSPEDKLQVLRGLCHRIMGSYSVQDHMEEQQTEASQLWKQRIAELKEKNEKLREEKQKNKEAKKEGGEQKEGVEPASFYGKKGKKAPDSEPTSAAPSENEDLDLEGNDLASVVKRRRLMASKSAAIKEQKEQEKKLLLEKQNEEQRKAKF------EKEFLDGIARAKLVLRQAPIGTDRFHNRYWVFSHTTPGLYIEKGWAPKEIDYQVELETETPIKKEVKVEEKPESTATEEPAPDDEEKKEKRGRKKKTIQEETSFPHSGQNLWFTYDSVKEVDALIESLHPQGIRESNLKAELKK-------KYQDVCRAII-VAQRTNNELRTYDGE-TELWEGFKQELLETESRLRNGGLGGVENFDKWQAQLLKAKDVKDLGACLIQTQANVLEKFIQGAMAKKVPKVEDDTVTEAEIPTSPVVLAWMDAVENCVTVSRLHVLLGILDSCIKWEKSAENAKCKICRKKGEDAKLLLCDDCNQPFHLYCLRPVLLSIPEGEWFCPACIPSSQRRRERSRPNYKDMSGET----------SSEGEDDGDDEEIVHEEVCTVCEAADN---LILCSTCPKVYHQDCHEPALRRPPRGPWSCTDCKMGTNRTRGRNTRNSRRGTTAKPSA 1345          

HSP 2 Score: 181.8 bits (460), Expect = 5.291e-42
Identity = 108/276 (39.13%), Postives = 157/276 (56.88%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQEN--SPIKLSSDASSSDKENM-------KKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQ-KMKELSRTTE 837
            MPLL  K Y   K  K+    ++      T E   +++E  ++  LY   +W+C+ TG INLT++EA+KSEQ   ++LK  F   F   VL  VHHS  +L+ L+ + WT+IHQE+ V+E V +K  A  + I+KG +VKVD S S +   N  SP     +AS++ +E         KK  IP    Y Y++K+   DK++  IP+  + RT +PPSK+ +R+FIRAHA+R    Q  PWVVDEE+VK++ LP    +F +    KM E  R  E
Sbjct:    1 MPLLGRKPYTPAKPLKNFDPNETIYTIPQTKEQFRSKDEYEQRKTLYEDNVWSCQCTGHINLTYEEAVKSEQEVHRLLKEQFSPVFVKPVLLQVHHSTTALENLVDQVWTKIHQEFVVDESVALKHKAGGK-IIKGTIVKVDTSVSQNAVSNGSSPASDKENASNNQEEETNSTSGTPKKWSIPKFLPYRYNLKLEGQDKIISSIPALDLMRTTKPPSKELLRLFIRAHAVRMGPNQTGPWVVDEEMVKRHSLPGKFNDFFLQSPVKMAEAVRKAE 275          

HSP 3 Score: 77.411 bits (189), Expect = 3.629e-10
Identity = 45/160 (28.12%), Postives = 64/160 (40.00%), Query Frame = 1
Query: 3127 CRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVS---RARDADSDTVAMTFVPPAHSVTQSIKSKTRQNS---------------------HQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQCRLDEA 3534
            C VC  A   ++++LC +C   +H  C  PAL   P G W C  CK  +   R R+  +     T  P A    +    K                          H E C VC +++    L  C++C K +H  CHEP LR+  R  W C  C+ D +
Sbjct: 1279 CTVCEAA---DNLILCSTCPKVYHQDCHEPALRRPPRGPWSCTDCKMGTNRTRGRNTRNSRRGTTAKPSARRGQRRPNYKVESEESEESSSSEEEEEEDEEEEEIVHDEACTVCEATDN---LIYCSTCPKAYHQDCHEPALRRPPRGTWSCSACKEDSS 1432          

HSP 4 Score: 77.0258 bits (188), Expect = 4.557e-10
Identity = 44/124 (35.48%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 4249 QKKSCNGISAEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            QKKS N     KI   C  +L  +  H+ SWPF +PV   EVPDY+++I+ PI++  +  K     Y    D    F+ DV  +F N+  YN  DSD+      LEQ+F  +      G  Y R
Sbjct: 1475 QKKSANAAEEMKI---CEDILGRVWRHRTSWPFREPVKKNEVPDYFEVISRPIDLTTIKNKLICKDYPIPED----FIHDVELLFGNSATYNSTDSDVGKCGAKLEQYFIELLELKLPGYTYNR 1591          
BLAST of Zinc finger protein, putative vs. TrEMBL
Match: A0A183P3Y1 (WAC domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS9067 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.444e-57
Identity = 106/269 (39.41%), Postives = 172/269 (63.94%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDS----------TICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIF-EMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            MPL+S KL++LN + + KK  D+                T EIC + EEL RK  +YN+ IWTCR+TG+ NLT++EALK+E    + L+  F K FE ++L+ VH S   L++L+H  WT IH+++ + EPV +K+ +     ++G++  + +S++      +P+  ++  ++SDKEN+ KK  P+KKNY YSVK+  ++  +V D+P+ +I+R  R PSKD I+MFIR+HA+R+      PW+V+EEL++++++P   P   VDK K+
Sbjct:    1 MPLISTKLHVLNPVWRKKKPRDTEQQEEPEPKPAFIVPETQEICTSAEELQRKITIYNENIWTCRVTGKPNLTYREALKTEATAIRTLRKCFPKFFEKTILERVHLSTLPLESLVHSCWTIIHEQFHIAEPVKLKVDSVSNTPIRGIIDDIIKSQTVP----TPVPDNTSPNNSDKENVTKKNSPIKKNYAYSVKVLSDIPVVVHDVPACSIDRINRAPSKDHIKMFIRSHAMRYGPNFTGPWIVNEELLRRHKIPLKSPGCQVDKVKV 265          
BLAST of Zinc finger protein, putative vs. TrEMBL
Match: A0A2T7PJP6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_04917 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 2.543e-57
Identity = 225/905 (24.86%), Postives = 413/905 (45.64%), Query Frame = 1
Query: 1129 KLMKDNPSDPNVK--QLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLRE----KKREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDV--NNKSMTGDGNNSGRLFVSGGTDSLIT-----DDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISA-------------------PGAIYVEIEQXXXXXXXXXXXXXXPD-------HI-------LTE----------WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERFWNVPLK----------SANGRN-------------------------EFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHS-VTQSIKSKTRQNSHQEQCFVCHSSNGE-QQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQCRLDEATKTNKQPSRR 3564
            KLM+ N  +  VK   L+ K   + + QQ    P  I+  +  + +  EEKK+L+ MT ++REAY  E++ + ++QL+E    + +E   + ED +L     +P    +++   +  + +  +  V EFV  Y  LLMP      D++     D     I+        L+  + VLL+ L QD       E+ + L ++ V   T  EL+RL             + ++D N+ ++D  +    +V D                   + + L+T E  QL  + K+ +L+ L  R++    +  ++++ QRE  +  K+R ++ KE N+K +  +Q+K    +   +   +++   N+ ++T       +L  +   DS I      D+   +V+RR  +  K    +E+     + ++ ++ ++E  + ++   +++  +  + N A+ ++R  P+G DRH  RYW F +                    PG +  E  +      ++  ++++P+       H+       L E          W  + +  +L +LL  L  +GIRE  LK EL+     +     +  + N E         + DS     ++ GFK+EL + E+ +R G LGGV++Y  W+ ++ ++     M   L+ V  G+ ++F    +K          +  G N                         ++  AVE   T +RL++L S +D+C+ W KSA++ KC++CRK  D++ +LLCD CN AFH +CLRPAL  +P G+W+CP C P S+ R         T VP   +  ++S    + +    E+   C    G+ ++L +C SC+ ++H  CH+PPLR+  R +W C  C+ +  T+  K+P R+
Sbjct:  304 KLMQLNKEEDKVKFNMLLKKAVLVLTPQQKKNLPSPIKEKLQKKTDIMEEKKKLEKMTDEEREAYFKEKKEKQKQQLKEKLKARMKELRQRYEDQDLNL-HPLPAPRLVTMPENLPNELFGDIAMVTEFVSSYSGLLMP------DAEYPIYTDALMKAIAGGPQGFAYLSRVLGVLLQTLQQDELAEGYSELRVPLRDIAVNPYTVSELVRLC------------LRKHDSNDNSSDIAETDDSEVPDS------------------LVQLLETQEFYQLESDQKVALLKGLCLRLMSTYSLQDYMEERQREAIQLTKQRNSEMKEFNEKKRDKKQNKSSQRQSSSSFVHSENSQENSPAITIANFYGKKLDDTSTNDSAIDSQEDDDNLVSIVKRRRLMAAKAAAEKEKRELERRLQREKEHQEERTRREREQFETK--FKDSINLARTVLRHIPIGYDRHHNRYWIFTNTTPGLYIEKAGWVSQDISYNPGCVPQEKGRNDDSASSLATSSSTPEKNSSKATHLGPKRKKALVESTIPHSGQNLWFTYPSVKDLDELLKALHPQGIREGALKVELKKRYADICRGITAAQRNNLE---------LRDSDGNVEMIAGFKKELADIELRLRNGGLGGVQNYSSWEAKLMAAEDCVMMGACLLEVQEGILDKFLQGFMKRLKQSDKSDKAEEGDNSDADDEDKKSIKEERSLSAAEQRLQQWKGAVENCSTLSRLHVLLSMMDSCIKWEKSAENAKCKICRKKCDDDRLLLCDECNQAFHMYCLRPALVSVPRGDWYCPACMPQSKRR---------TQVPKRFADESESDAVSSEEEEGGERSTACQECGGQDEELIQCGSCHSVYHLDCHQPPLRRAPRGSWECSNCK-NGFTRQKKRPQRK 1150          

HSP 2 Score: 83.5741 bits (205), Expect = 4.153e-12
Identity = 43/127 (33.86%), Postives = 71/127 (55.91%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTRMTDTTN*GESFVDSMLSRK 4677
            C  +L+ +M H  SWPF++PVD +EVPDYY II  P++   M +K  +  Y+S  +    F+ D   +F NA  YN P+S++      +E+ F  + +KY  G   T++   ++ G+S  +S   R+
Sbjct: 1221 CEDILQRLMKHPNSWPFLEPVDKKEVPDYYSIIRKPMDFQTMQKKCARLSYSSPQE----FVEDAILVFSNAATYNQPNSEVYECMRVMERLFSELLAKYLPGYAITQVF-VSDVGDSSTNSARFRR 1342          
BLAST of Zinc finger protein, putative vs. TrEMBL
Match: A0A1S2ZE99 (tyrosine-protein kinase BAZ1B OS=Erinaceus europaeus OX=9365 GN=BAZ1B PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.713e-56
Identity = 221/789 (28.01%), Postives = 364/789 (46.13%), Query Frame = 1
Query: 1171 LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTK-----------LEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGR---LFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHF-----------------------------ISAPGAIYV----------EIEQXXXXXXXXXXXXXXPDHILTEWNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP---------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            +I K  +L S++  A+ P+ +R  +  R E  E KKR  +M+ +QR+ YL ++R +++ +L+EK +E   K            ED+EL   K +P    +    G+    +  +  V EF+ CY  LL+P     D    +TA  L ++ +S        L   + +LL+ LLQD       E+G+ L+E+P+T+ +A EL+RL L    D +E  +V + D N+++            D EV  E               EKL+T E  +L+ E+K+ +L  L +RIL    V   ++  Q+   E +K+R+   KE NDK +A +Q ++E+          +  N K   G G    R   +      D    D  S V  RR    + I+  +ERE +  + +   + E EE + +K    ++K++      AK +MR  P+G+DR+  RYW F                              S+PG  Y            +   +     +   TT+P      W +  +  EL +LLNCL  +GIRES LK  LE       D   S+       A + N  + +  G Q  L+   + +L E    +++G LG VE+  E++ RV S   L +  E ++++   V ++F   +  P                            K A+   ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCRK  +++ ++LCD CN AFH FCLRPAL+++P+GEW CP C+P +  R++
Sbjct:  459 VISKTARLLSSEDRARLPEELRSIVQKRFELLEHKKRWASMSEEQRKEYLKKKRAELKERLKEKAKERREKEMLERLEKQKRYEDHELP-GKNLPTFRLVDTPEGLPNTLFGDVAMVVEFLGCYSGLLLP-----DAQYPITAVSLMEA-LSAEKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSASELVRLCLRKS-DVQEESEVSDTDDNKDS--------ASFEDNEVQDE-------------FLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKERLAVLKEENDKKRAEKQKRKEI-------EARNKENGKEENGLGKTDRRKDTVKFQPQVDVEAEDMVSAVKSRR---LLAIQAKKEREIQERELKVKLEREAEEERTRKHKAAAEKAFQEGIARAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSINYRFNHHRRDHTSSPGEDYYPRGKKANLGKNVHVNTQHGPEVALETTTPKQGQNLWFLCDSQKELDELLNCLHPQGIRESQLKERLEKRYQ---DIIHSI-----HLARKPNLGLKSCDGNQE-LLNFLRSDLIEVATRLQKGGLGYVEETSEFEARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRRKPQSEDSAKAEEVDEEKKMAEEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNS 1199          

HSP 2 Score: 100.908 bits (250), Expect = 2.176e-17
Identity = 69/236 (29.24%), Postives = 109/236 (46.19%), Query Frame = 1
Query:  271 LKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVD------------------------------------------------RSRSNDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTT 834
            LK  F   +E  VL+ VHH+  SL+ L+  AW +I  +Y V E    ++   KE +LK  +VK+                                                 R   ND    SP KL +     +++    K +P K    Y VK+   DK++ ++P++++ RT RPP+K+ +R FIR +A+R    +N PWVV+++LVKKY LP+   +F +D  K   L+ +T
Sbjct:   37 LKEEFPTWYEKLVLEMVHHNTASLEKLVDSAWLEIMTKYAVGEECDFEVG--KEKMLKVRIVKIHPLEKVDEEAAEKKSDGACDSPSSDKENSSQIAQDHPKKEAIGKEDEGRRESLNDRARRSPRKLPTSLKKGERKWAPPKFLPHK----YDVKLQNEDKVISNVPADSLIRTERPPNKEILRYFIRHNALRAGTGENAPWVVEDDLVKKYSLPSKFSDFLLDPYKYMTLNPST 266          

HSP 3 Score: 80.4925 bits (197), Expect = 4.191e-11
Identity = 40/108 (37.04%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +L  M+ ++ SWPF +PV  +E  DYY +IT P++   M  K   G Y     S++ FL+D+ Q+F NAE+YN  DS +++ A+  EQ    +  K+  G  Y R
Sbjct: 1305 CEEILHKMVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTMQGKCSCGSYR----SVQEFLTDMKQVFANAELYNCRDSHVLSCAVKTEQCLVALLHKHLPGHPYVR 1408          
BLAST of Zinc finger protein, putative vs. TrEMBL
Match: A0A4S2LXT1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004119 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.753e-56
Identity = 115/300 (38.33%), Postives = 185/300 (61.67%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKK---DEDSTI-----------CHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIF-EMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTTEIQMFNKMKDEHRDATVDLT 894
            MPLL  +L++LN + K KK   DE + +               T E+C + +EL +KT +Y + +WTCR+TG+ NLT+++A KSE    ++LK +F KCFE  VL+ VH S   L+ L+H  WT + +++ V EPV +K+ +     + G++ +VD+S + D    S    ++  +SSDKEN+ K+  PVKKNY Y+VK+  ++  +V D+P+ +I+R  R PSK+ IRMFIRAHA+R+    + PW+VD +L+++Y++ +  P F VD+ K+K++S   E +   ++    R A VD T
Sbjct:    1 MPLLGARLHVLNPVWKKKKVVRDEQNPVELKEEEDKPPFIVPETQEVCTSAQELQQKTTVYGRNVWTCRVTGRSNLTYRDAAKSEATSHRILKKNFPKCFEKPVLETVHLSTLPLENLVHSCWTGLQEQFYVTEPVKLKVDSVSSQPIHGIINEVDKSHTVDSMPVSNTGSNTSPNSSDKENVTKRTTPVKKNYAYTVKVLSDVPLVVNDVPACSIDRLNRIPSKEHIRMFIRAHAMRYGPNFSGPWIVDADLLRRYKITSKSPGFEVDRVKLKQMSNAIEAEYLARLIKNDRQANVDGT 300          

HSP 2 Score: 152.91 bits (385), Expect = 3.246e-33
Identity = 76/194 (39.18%), Postives = 99/194 (51.03%), Query Frame = 1
Query: 3013 RNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSR-----------------------ARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTN-WHCCQCR 3522
            RNE +NA    +T ARLN+L + LDAC+ W KS +D +CR+CR  SD++++LLCD CN AFH +CLRP L  +P G+W+CP C+P SR                       A   D D+V    VP   S  +          H   C VC  +    +L  CT+C   FH  CH PPLR   R + W C  CR
Sbjct: 1251 RNEVMNA----RTLARLNLLHACLDACIRWEKSVEDARCRICRHKSDDDNLLLCDGCNRAFHLYCLRPPLRRVPAGDWYCPSCRPASRDLERRRREARLARSERRRRRQDVASSEDEDSV----VPERESAARDKVGP----KHDTTCLVCAEATSSSELVHCTNCPNAFHLSCHNPPLRHPPRGDVWLCTSCR 1432          

HSP 3 Score: 104.76 bits (260), Expect = 1.752e-18
Identity = 49/113 (43.36%), Postives = 68/113 (60.18%), Query Frame = 1
Query: 4291 KACY-HMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIY--ASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            +AC   +L  +  HK +WPF +PVD EEVPDYY+IITDP+++  +      G Y  A   + L+ F  D+G MF+NAE+YN  DSD+      LEQF K  +S+   G+ Y R
Sbjct: 1576 RACVTRILNAIYRHKCAWPFREPVDREEVPDYYEIITDPVDLGMVRAWISNGRYDAADPKEGLRNFACDLGTMFYNAELYNAADSDVWIAGSQLEQFVKNQFSQLNMGISYHR 1688          

HSP 4 Score: 78.5666 bits (192), Expect = 1.554e-10
Identity = 44/148 (29.73%), Postives = 79/148 (53.38%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVKQLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTKLEDNELEYAKQ----IPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASD 1545
            AQ+L+KL  ++  +P +   I  C ++  +  IA+ P  +R  +  R+E  +  K+L +MT D+R+AYL E R + R +    + + N   +D +L         +P+ +P+ +  G  +  + RL+SV EF  C++ LLM   D +D
Sbjct:  406 AQQLMKLAAESSGNPLITSCINICAKILCDADIARLPAELREKVCSRREAIQFHKKLLSMTPDERKAYLRENREKQRLE----RMKANRLCDDQDLLATDSRCVALPQTSPLHLPDGFTEPLFGRLLSVAEFFHCFQTLLMEGLDYAD 549          
BLAST of Zinc finger protein, putative vs. Ensembl Cavefish
Match: baz1b (bromodomain adjacent to zinc finger domain 1B [Source:NCBI gene;Acc:103028381])

HSP 1 Score: 198.749 bits (504), Expect = 8.858e-51
Identity = 205/797 (25.72%), Postives = 369/797 (46.30%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVKQ----LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREK-----------KREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQS-KQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVEI------------------------EQXXXXXXXXXXXXXXPDHILTEWNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCR-KASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            A  LL+  K+N    + K     L+ +  +  + +   + P+ ++  +  R E+ EEK+R   M+ ++++  L ++R +++ +LREK           +RE+  + ED E+E  K +P    + +  G+    +  +  V +F+ CY  LLMP     DD   +TA+ L +++ S        L   + VLL+ LLQD    +  E+ + L+E+P+T+ +  EL+          R   +  +   +E ++   +   G   D+ VS+E               E+L+T E+ +L+ ++K+ +L  L +RIL    V   ++D Q+     +++R+   KE N + KA +Q  K++M          ++   K+      N+ +  V    +    D  S V  RR    M ++  +E+E +  + ++  + E EE +L+K    ++K++     +AK +MR  PLG+DR+  RYW F      +Y+E                          Q           +T P      W +  +  +L++LL  L  +G+RES LK +LE        +FQ +   +   + + N  + A  G Q  L+   + ++ E    + +G LG +ED  E++ RV S   L +  E ++++   V ++F   +  P                             + A    ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCR K  D++ ++LCD CN AFH FCLRPAL+ IPEGEW CP C+P +  R +
Sbjct:  437 ALHLLRFYKENKGKEDKKNALSALVSRAAKTLTPEDRGRLPEELKEIVQKRWERLEEKRRWALMSEEEKQEVLKKKRAELKAKLREKAKERREKEMLLRREQQRRYEDQEIE-GKSLPAFRLVDMPEGLPNALFGDIAMVTDFLSCYSDLLMP-----DDQYPITAQALVEALASD-KGGFNYLNRVLVVLLQTLLQDELAEAYSELDMPLSEIPLTMHSVSELV----------RLCLRPSDAQCDESSHSSDEWSGGGSYDDVVSSE-------------FLERLETAEVFELTPQEKVSLLVALCHRILMTYSVEDHVEDMQQRAAGLWRERLATLKEANIRRKAEKQKLKEQMIASGCIAPKAEEAGAKAEKKKEGNTKKEQVKASQEP--EDMISTVKSRR---LMSMQAKKEKEEQERQNKERMEKEAEEERLRKQKVAAEKAFQEGIAKAKLVMRRTPLGTDRNHNRYWLFSDVVPGLYIEKGWVHESIDYNKDDEGSIASATNENGQRWMSAPENYIESTVPKQGQNLWFVCDSPKDLEELLESLHSQGVRESELKLKLEV-------KFQDIM-HSIHMSKKGNLGLRACDGHQE-LLKFLRSDIIEVASRLEKGGLGCMEDTAEFEARVESLEKLKDFGECVITLQKSVIKKFLQGFMAPKQKKKKKQSGEESGKTEEVDEDKKLAEEARVATAVEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKVGDDDKLILCDECNKAFHLFCLRPALYRIPEGEWLCPACQPTTARRSS 1189          

HSP 2 Score: 140.969 bits (354), Expect = 5.312e-33
Identity = 96/300 (32.00%), Postives = 148/300 (49.33%), Query Frame = 1
Query:   43 PLLSNKLYILNKIRKDKK---DEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVD-RSRSNDDQENSPIKLSSDASSSDKENM---------------------------------------KKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            PLL  K Y L K   +     +E   I H  T E   N+EE   +   Y+++IWTC+ TG   LT KEA + EQ  +++L+  +   FE  VL+ VHH+  SLD L+ + W +I  +Y V E     +   K M  +  VVK+     + ++Q    ++ + D+ SSDKEN                                        KK  +P    + Y VK+   DK++ D+P++++ RT RPP+K+ +R FIR +A+R    ++ PWVV++ELVKKY LP+   +F +D  K 
Sbjct:    3 PLLGRKPYPLVKPLAEPAGPGEEVYIIEH--TKEAFRNKEEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVTELLQEEYPVWFEKPVLEIVHHNTVSLDKLVDQVWVEILTKYAVGEECDFLVGKDKSM--RVTVVKIHPLENAQEEQAEKKMEGACDSPSSDKENASQENQKKEQPKEEDNKRESLSDRARRSPRKLPTSMKEEKKKWAMPKFLPHKYDVKLVNEDKVISDVPADSLFRTERPPNKEIMRYFIRHYALRLGMGESAPWVVEDELVKKYNLPSKFSDFLLDPHKF 298          

HSP 3 Score: 73.559 bits (179), Expect = 2.077e-12
Identity = 41/115 (35.65%), Postives = 59/115 (51.30%), Query Frame = 1
Query: 4276 AEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            A+++EK C  +L  M+  + SWPF +PV  EE  DY  II+ P++ + M  K+K   Y    D    F+ D+  +F NAE YN   S ++      EQ F  +  K   GV Y R
Sbjct: 1239 AQELEK-CEEILLKMIKFRYSWPFREPVSAEEAEDYQDIISTPMDFSTMQSKFKSSQYRGVQD----FIEDMKLVFSNAEEYNQLGSSVLQCTTRTEQAFTDLLHKILPGVTYLR 1348          
BLAST of Zinc finger protein, putative vs. Ensembl Cavefish
Match: baz1b (bromodomain adjacent to zinc finger domain 1B [Source:NCBI gene;Acc:103028381])

HSP 1 Score: 140.584 bits (353), Expect = 6.721e-33
Identity = 96/300 (32.00%), Postives = 148/300 (49.33%), Query Frame = 1
Query:   43 PLLSNKLYILNKIRKDKK---DEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDR-SRSNDDQENSPIKLSSDASSSDKENM---------------------------------------KKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            PLL  K Y L K   +     +E   I H  T E   N+EE   +   Y+++IWTC+ TG   LT KEA + EQ  +++L+  +   FE  VL+ VHH+  SLD L+ + W +I  +Y V E     +   K M +   VVK+     + ++Q    ++ + D+ SSDKEN                                        KK  +P    + Y VK+   DK++ D+P++++ RT RPP+K+ +R FIR +A+R    ++ PWVV++ELVKKY LP+   +F +D  K 
Sbjct:    3 PLLGRKPYPLVKPLAEPAGPGEEVYIIEH--TKEAFRNKEEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVTELLQEEYPVWFEKPVLEIVHHNTVSLDKLVDQVWVEILTKYAVGEECDFLVGKDKSMRV--TVVKIHPLENAQEEQAEKKMEGACDSPSSDKENASQENQKKEQPKEEDNKRESLSDRARRSPRKLPTSMKEEKKKWAMPKFLPHKYDVKLVNEDKVISDVPADSLFRTERPPNKEIMRYFIRHYALRLGMGESAPWVVEDELVKKYNLPSKFSDFLLDPHKF 298          

HSP 2 Score: 122.094 bits (305), Expect = 3.343e-27
Identity = 81/261 (31.03%), Postives = 134/261 (51.34%), Query Frame = 1
Query: 2602 WNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERF---WNVP----------------------------LKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRK-ASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            W +  +  +L++LL  L  +G+RES LK +LE        +FQ +   +   + + N  + A  G Q  L+   + ++ E    + +G LG +ED  E++ RV S   L +  E ++++   V ++F   +  P                             + A    ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCRK   D++ ++LCD CN AFH FCLRPAL+ IPEGEW CP C+P +  R +
Sbjct:  991 WFVCDSPKDLEELLESLHSQGVRESELKLKLEV-------KFQDIM-HSIHMSKKGNLGLRACDGHQE-LLKFLRSDIIEVASRLEKGGLGCMEDTAEFEARVESLEKLKDFGECVITLQKSVIKKFLQGFMAPKQKKKKKQSGEESGKTEEVDEDKKLAEEARVATAVEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKVGDDDKLILCDECNKAFHLFCLRPALYRIPEGEWLCPACQPTTARRSS 1242          

HSP 3 Score: 99.7525 bits (247), Expect = 2.210e-20
Identity = 121/488 (24.80%), Postives = 231/488 (47.34%), Query Frame = 1
Query: 1114 AQRLLKLMKDNPSDPNVKQ----LIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREK-----------KREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQS-KQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVE 2529
            A  LL+  K+N    + K     L+ +  +  + +   + P+ ++  +  R E+ EEK+R   M+ ++++  L ++R +++ +LREK           +RE+  + ED E+E  K +P    + +  G+    +  +  V +F+ CY  LLMP     DD   +TA+ L +++ S        L   + VLL+ LLQD    +  E+ + L+E+P+T+ +  EL+          R   +  +   +E ++   +   G   D+ VS+E               E+L+T E+ +L+ ++K+ +L  L +RIL    V   ++D Q+     +++R+   KE N + KA +Q  K++M          ++   K+      N+ +  V    +    D  S V  RR    M ++  +E+E +  + ++  + E EE +L+K    ++K++     +AK +MR  PLG+DR+  RYW F      +Y+E
Sbjct:  458 ALHLLRFYKENKGKEDKKNALSALVSRAAKTLTPEDRGRLPEELKEIVQKRWERLEEKRRWALMSEEEKQEVLKKKRAELKAKLREKAKERREKEMLLRREQQRRYEDQEIE-GKSLPAFRLVDMPEGLPNALFGDIAMVTDFLSCYSDLLMP-----DDQYPITAQALVEALASD-KGGFNYLNRVLVVLLQTLLQDELAEAYSELDMPLSEIPLTMHSVSELV----------RLCLRPSDAQCDESSHSSDEWSGGGSYDDVVSSE-------------FLERLETAEVFELTPQEKVSLLVALCHRILMTYSVEDHVEDMQQRAAGLWRERLATLKEANIRRKAEKQKLKEQMIASGCIAPKAEEAGAKAEKKKEGNTKKEQVKASQEP--EDMISTVKSRR---LMSMQAKKEKEEQERQNKERMEKEAEEERLRKQKVAAEKAFQEGIAKAKLVMRRTPLGTDRNHNRYWLFSDVVPGLYIE 910          

HSP 4 Score: 74.3294 bits (181), Expect = 1.043e-12
Identity = 41/115 (35.65%), Postives = 59/115 (51.30%), Query Frame = 1
Query: 4276 AEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            A+++EK C  +L  M+  + SWPF +PV  EE  DY  II+ P++ + M  K+K   Y    D    F+ D+  +F NAE YN   S ++      EQ F  +  K   GV Y R
Sbjct: 1353 AQELEK-CEEILLKMIKFRYSWPFREPVSAEEAEDYQDIISTPMDFSTMQSKFKSSQYRGVQD----FIEDMKLVFSNAEEYNQLGSSVLQCTTRTEQAFTDLLHKILPGVTYLR 1462          
BLAST of Zinc finger protein, putative vs. Ensembl Cavefish
Match: baz1a (bromodomain adjacent to zinc finger domain, 1A [Source:ZFIN;Acc:ZDB-GENE-030131-6105])

HSP 1 Score: 91.6633 bits (226), Expect = 6.162e-18
Identity = 43/133 (32.33%), Postives = 70/133 (52.63%), Query Frame = 1
Query: 2917 SVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQ-------AQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADS 3294
            S  L  + + L  +  G+  RF   PL  ++   +    +E+         + ++L +  S L+  V W+KS  + +C+VCRK  D  +MLLCD C+ + H FC+RP L  +P  +WFCP C+P  R+   +S
Sbjct:  976 SSNLRYLAQALAQIEQGIERRFLKAPLDGSDCGRQVKTVLERWRESLLGCSSLSQLFLHLSTLERSVIWAKSILNARCKVCRKKGDCENMLLCDGCDRSHHIFCVRPKLKAVPTEDWFCPECRPKQRSHRINS 1108          

HSP 2 Score: 57.7658 bits (138), Expect = 1.347e-7
Identity = 29/94 (30.85%), Postives = 49/94 (52.13%), Query Frame = 1
Query: 4294 ACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            AC  +  +++ H+ SWPF   V   +VPDYY II  PI ++ + EK     Y +  +    +++DV  MF N   YN  +++     + L+ +F
Sbjct: 1299 ACEQLSVDLVRHEDSWPFKKLVSRTQVPDYYDIIKKPIALSTIREKVNNCEYQTASE----YIADVELMFSNCLEYNPRNTNEAKAGLRLQAYF 1388          

HSP 3 Score: 55.4546 bits (132), Expect = 5.798e-7
Identity = 35/109 (32.11%), Postives = 60/109 (55.05%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKD-KKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKA 363
            MPLL  K ++  +   D + DE+  +C  +T+EI    +E   +T L N  +W+C +TG+  LT++EAL+SE+     L+N     F  +++  + H    L +L H+A
Sbjct:    1 MPLLHKKPFVRQRPPADLQPDEEVFLCK-VTHEIFRTYDEFFERTILCNSLVWSCAVTGKPGLTYQEALESEKKARLSLQN-----FPTTLMLPLLH----LTSLTHRA 99          
BLAST of Zinc finger protein, putative vs. Ensembl Cavefish
Match: baz1a (bromodomain adjacent to zinc finger domain, 1A [Source:ZFIN;Acc:ZDB-GENE-030131-6105])

HSP 1 Score: 81.2629 bits (199), Expect = 7.343e-15
Identity = 33/73 (45.21%), Postives = 47/73 (64.38%), Query Frame = 1
Query: 3076 SFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADS 3294
            S L+  V W+KS  + +C+VCRK  D  +MLLCD C+ + H FC+RP L  +P  +WFCP C+P  R+   +S
Sbjct: 1100 STLERSVIWAKSILNARCKVCRKKGDCENMLLCDGCDRSHHIFCVRPKLKAVPTEDWFCPECRPKQRSHRINS 1172          

HSP 2 Score: 55.0694 bits (131), Expect = 7.399e-7
Identity = 44/142 (30.99%), Postives = 73/142 (51.41%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKD-KKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKV 462
            MPLL  K ++  +   D + DE+  +C  +T+EI    +E   +T L N  +W+C +TG+  LT++EAL+SE+     L+N     F  +++  + H    L +L H+A  ++H E C +       T  KE    G +V V
Sbjct:    1 MPLLHKKPFVRQRPPADLQPDEEVFLC-KVTHEIFRTYDEFFERTILCNSLVWSCAVTGKPGLTYQEALESEKKARLSLQN-----FPTTLMLPLLH----LTSLTHRA--RLH-ELCDD-----IYTFVKERFFPGEIVDV 124          
BLAST of Zinc finger protein, putative vs. Ensembl Cavefish
Match: BPTF (nucleosome-remodeling factor subunit BPTF [Source:NCBI gene;Acc:103030154])

HSP 1 Score: 80.4925 bits (197), Expect = 1.877e-14
Identity = 36/109 (33.03%), Postives = 63/109 (57.80%), Query Frame = 1
Query: 4279 EKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFG 4605
            EK  +    +L+++ +HK +WPF++PVDPE+ PDYY +I +P++++ M E+  +  Y+     L  +++D+ ++F N   YN  DS     A  LE FF      ++ G
Sbjct: 2564 EKDYEGLRRILRSLQAHKMAWPFLEPVDPEDAPDYYGVIKEPMDLSTMEERLLKHHYS----KLTEYVADMTKIFDNCRYYNPSDSSFYQCAEVLETFFVQKLKAFKMG 2668          

HSP 2 Score: 54.6842 bits (130), Expect = 1.118e-6
Identity = 25/80 (31.25%), Postives = 42/80 (52.50%), Query Frame = 1
Query: 3052 QARLNMLQSFLDACVCWSKSAK----------DDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHC 3261
            +++L +LQ  +D  +  +++ +          DD CRVC    D   +L C++C+  +H  C+RP L  +PE EW C  C
Sbjct:  335 ESKLKVLQFLVDQFLATNRAREELMSEGVIQYDDHCRVCHSLGD---LLCCETCSAVYHLDCVRPPLKAVPEEEWQCEVC 411          
BLAST of Zinc finger protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010200.1 (pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 gene:ENSPMAG00000009229.1 transcript:ENSPMAT00000010200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 2.198e-13
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = 1
Query: 4201 CNGSGDSDDVVNK-APIQKKSCNGISAEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            C     ++DV+   +P+ ++  +G+           +L++M  HK +WPF++PVD EE P YY++I +P++++ + ++     Y+     L  F+ D+ +MF N   YN  +S     A  LE FF
Sbjct: 2736 CPNCQSAEDVMTALSPLTERDYDGLK---------RILRSMQVHKMAWPFLEPVDEEEAPGYYEVIKEPMDLSTIEKRLSSRFYS----KLAEFVGDMTKMFDNCRYYNPGESTFAKCAEVLETFF 2848          

HSP 2 Score: 52.7582 bits (125), Expect = 9.763e-7
Identity = 20/48 (41.67%), Postives = 28/48 (58.33%), Query Frame = 1
Query: 3118 DDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHC 3261
            DD CR C +  D   +L C++C   +H  C+RP L ++PE EW C  C
Sbjct:  290 DDHCRACHRLGD---LLCCETCPAVYHLECVRPPLAEVPEDEWQCEVC 334          
BLAST of Zinc finger protein, putative vs. Ensembl Sea Lamprey
Match: kat2b (K(lysine) acetyltransferase 2B [Source:NCBI gene;Acc:563942])

HSP 1 Score: 71.633 bits (174), Expect = 1.104e-12
Identity = 34/96 (35.42%), Postives = 57/96 (59.38%), Query Frame = 1
Query: 4300 YHMLKNMM----SHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            Y+ LK++M       ++WPF++PV   E PDYY +I  P+++  M E+ K   Y +     K+F++D+ ++F N   YN P+++    A TLE+FF
Sbjct:  738 YNTLKSIMQQVKGQPSAWPFMEPVKKSEAPDYYDVIRFPMDLKTMSERLKNRYYVTK----KLFMADMQRIFTNCREYNPPETEYYRCANTLERFF 829          
BLAST of Zinc finger protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008812.1 (pep scaffold:Pmarinus_7.0:GL478772:7873:35829:1 gene:ENSPMAG00000007951.1 transcript:ENSPMAT00000008812.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 1.625e-12
Identity = 31/92 (33.70%), Postives = 56/92 (60.87%), Query Frame = 1
Query: 4306 MLKNMMSHKASWPFIDPVDPEEV--PDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            ++K +  H+ +WPF  PVD  ++  PDYY II +P+++  + ++ +   Y + ++ ++    D   MF N  +YN P+ DI+ +A TLE+FF
Sbjct:   41 VMKALWKHQFAWPFHHPVDAAKLNLPDYYNIIKNPMDMGTIKKRLESNFYFTAVECIQ----DFSTMFTNCYIYNRPNDDIVLMAQTLEKFF 128          
BLAST of Zinc finger protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002602.1 (pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 gene:ENSPMAG00000002341.1 transcript:ENSPMAT00000002602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 4.067e-12
Identity = 37/115 (32.17%), Postives = 57/115 (49.57%), Query Frame = 1
Query: 3136 CRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQ---LAKCTSCNKLFHAHCHE 3471
            C +  D++ ML+CD+C+  FHT+CLRPA+  IP+  W C HC+  S   D  S +         H      +   +Q +    C VC  ++G +    L  C  C+++ HA C E
Sbjct:  264 CMQPGDDSKMLVCDACDKGFHTYCLRPAMQSIPKNTWKCKHCRSCS---DCGSRSAGAEPGSRWHRDYSLCERCHQQRASGRACPVCGRAHGRRPASTLLACQRCSRMVHAECEE 375          

HSP 2 Score: 56.225 bits (134), Expect = 7.717e-8
Identity = 35/114 (30.70%), Postives = 52/114 (45.61%), Query Frame = 1
Query: 3127 CRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQL-AKCTSCNKLFHAHC 3465
            C  C   SD   +LLCD C+ ++H +CL P LH +P+G W C  C  V   +   S+       P      Q+  ++    +    C VC  +  EQQL  +C  C++  H  C
Sbjct:  855 CESCGLTSDPGRLLLCDDCDISYHIYCLEPPLHTVPKGGWKCKWC--VCCLQCGASE-------PGFRCEWQNNHTQCAPCTSLSTCPVCSQAYREQQLIVQCRQCDRWMHGSC 959          
BLAST of Zinc finger protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008781.1 (pep scaffold:Pmarinus_7.0:GL478673:190102:212513:-1 gene:ENSPMAG00000007949.1 transcript:ENSPMAT00000008781.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 4.720e-12
Identity = 29/61 (47.54%), Postives = 37/61 (60.66%), Query Frame = 1
Query: 3109 SAKDDK-------CRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV 3270
            +AKDD        C VCR +  E+ +LLCD C+  +H  CL PAL  +P  EWFCP C+PV
Sbjct:  165 AAKDDGQEEEPTFCEVCRSSDREDRLLLCDGCDAGYHMECLDPALDTVPVEEWFCPQCRPV 225          
BLAST of Zinc finger protein, putative vs. Ensembl Yeast
Match: GCN5 (Catalytic subunit of ADA and SAGA histone acetyltransferase complexes; modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; relocalizes to the cytosol in response to hypoxia; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; greater involvement in repression of RNAPII-dependent transcription than in activation [Source:SGD;Acc:S000003484])

HSP 1 Score: 65.4698 bits (158), Expect = 3.789e-11
Identity = 33/94 (35.11%), Postives = 52/94 (55.32%), Query Frame = 1
Query: 4294 ACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            A  ++L  + +H A+WPF+ PV+ EEVPDYY  I +P++++ M  K +   Y    D    F+ D   +F N  +YN  ++     A  LE+FF
Sbjct:  335 AIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMED----FIYDARLVFNNCRMYNGENTSYYKYANRLEKFF 424          
BLAST of Zinc finger protein, putative vs. Ensembl Yeast
Match: JHD2 (JmjC domain family histone demethylase; promotes global demethylation of H3K4 and repression of noncoding intergenic transcription during sporulation; removes methyl groups added by Set1p methyltransferase; negatively regulated by H3K14 acetylation; protein levels regulated by Not4p polyubiquitin-mediated degradation; regulates sporulation timing by extending period of active transcription in opposition to programmed global transcriptional quiescence; regulates rDNA silencing [Source:SGD;Acc:S000003880])

HSP 1 Score: 63.5438 bits (153), Expect = 1.988e-10
Identity = 24/48 (50.00%), Postives = 30/48 (62.50%), Query Frame = 1
Query: 3118 DDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHC 3261
            DD C VCRK +D    +LCDSC+  FH +CL P L  +P G+W C  C
Sbjct:  235 DDACIVCRKTNDPKRTILCDSCDKPFHIYCLSPPLERVPSGDWICNTC 282          
BLAST of Zinc finger protein, putative vs. Ensembl Yeast
Match: RSC4 (Component of the RSC chromatin remodeling complex; found in close proximity to nucleosomal DNA; displaced from the surface of nucleosomal DNA after chromatin remodeling; acetylated (K25) by Gcn5p, altering replication stress tolerance; contains tandem bromodomains that recognize histone H3 acetylated on K14 (H3K14ac) by Gcn5p [Source:SGD;Acc:S000001716])

HSP 1 Score: 50.447 bits (119), Expect = 2.013e-6
Identity = 29/91 (31.87%), Postives = 51/91 (56.04%), Query Frame = 1
Query: 4330 KASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEF 4602
            K S PF++ VD +E+P+YY+I+  P+ ++ + +  + G Y+   D    F+ D+  +F NA ++N P + I   A TL  +F  +  K  F
Sbjct:  208 KLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYD----FIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFF 294          
BLAST of Zinc finger protein, putative vs. Ensembl Yeast
Match: RSC1 (Component of the RSC chromatin remodeling complex; required for expression of mid-late sporulation-specific genes; contains two essential bromodomains, a bromo-adjacent homology (BAH) domain, and an AT hook; RSC1 has a paralog, RSC2, that arose from the whole genome duplication [Source:SGD;Acc:S000003288])

HSP 1 Score: 48.9062 bits (115), Expect = 6.839e-6
Identity = 31/82 (37.80%), Postives = 45/82 (54.88%), Query Frame = 1
Query: 4339 WPFIDPVDPE-EVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKG 4581
            +P  + + P+ E PDYY II +PI++  + ++     Y S  D    F++D  Q+ +NA  YN  DS I   AI LE F KG
Sbjct:   32 YPIFNVLPPKKEYPDYYIIIRNPISLNTLKKRLPH--YTSPQD----FVNDFAQIPWNAMTYNAKDSVIYKYAILLESFIKG 107          
BLAST of Zinc finger protein, putative vs. Ensembl Nematostella
Match: EDO44814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU7])

HSP 1 Score: 74.3294 bits (181), Expect = 5.432e-14
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 3031 AVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHC 3261
            AV      ++L M  S L   + W KS     C++CRK  +E  +LLCD C+  +HT+C  P L  IPEG+W+C  C
Sbjct:   70 AVASVSNASQLAMCLSMLVGYIAWDKSIMKVFCQMCRKGDNEELLLLCDGCDRGYHTYCCMPKLTTIPEGDWYCMDC 146          

HSP 2 Score: 57.3806 bits (137), Expect = 2.064e-8
Identity = 31/98 (31.63%), Postives = 51/98 (52.04%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYS 4590
            C  +L  M  H  +WPF+ PV+ ++ P+YY+II  P++   M  K +   Y+S  +    F  D   +F N E +N  DS++      L +FF+  +S
Sbjct:  218 CRTILAEMEKHDDAWPFLIPVNAKQFPEYYKIIRKPMDFHTMKIKLRDYQYSSPQE----FAQDSRLVFANCEEFNEDDSEVGQAGKRLSKFFESRWS 311          
BLAST of Zinc finger protein, putative vs. Ensembl Nematostella
Match: EDO44054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWY0])

HSP 1 Score: 72.4034 bits (176), Expect = 6.439e-14
Identity = 24/47 (51.06%), Postives = 33/47 (70.21%), Query Frame = 1
Query: 3127 CRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP 3267
            C++CR+  D   MLLCD+C+   H +CL+P +  IPEG WFCP C+P
Sbjct:    1 CKLCRRKGDAEKMLLCDACDRGHHMYCLKPPIKHIPEGNWFCPDCRP 47          
BLAST of Zinc finger protein, putative vs. Ensembl Nematostella
Match: EDO43844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXH0])

HSP 1 Score: 75.8702 bits (185), Expect = 8.892e-14
Identity = 36/93 (38.71%), Postives = 58/93 (62.37%), Query Frame = 1
Query: 4309 LKNMMS----HKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            LKN+++    H ++WPF  PV+  E PDYY+ I  P+++  M E+ K G Y+S     K+F++D+ ++F N   YN PD++    A T+E+FF
Sbjct:  658 LKNILTQVKNHASAWPFQKPVERAEAPDYYEHIKYPMDLKTMTERLKSGYYSSK----KLFVADMRRIFQNCRTYNSPDTEYYKCANTVERFF 746          
BLAST of Zinc finger protein, putative vs. Ensembl Nematostella
Match: EDO44902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUH0])

HSP 1 Score: 67.3958 bits (163), Expect = 8.271e-13
Identity = 32/90 (35.56%), Postives = 54/90 (60.00%), Query Frame = 1
Query: 4306 MLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            ML+++ SHK +WPF++PV   +VP YY +I +P++++ + +K     YA    +L+ F+SDV ++F N   +N  D+     A  LE  F
Sbjct:   59 MLRSLQSHKMAWPFLEPVSGLDVPGYYDVIKEPMDLSTVEDKITSKKYA----TLEQFVSDVTRIFDNCRFFNGKDTPYYRCAEVLEAVF 144          
BLAST of Zinc finger protein, putative vs. Ensembl Nematostella
Match: EDO35777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKI4])

HSP 1 Score: 66.6254 bits (161), Expect = 3.468e-12
Identity = 27/47 (57.45%), Postives = 34/47 (72.34%), Query Frame = 1
Query: 3127 CRVCRKAS-DENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCK 3264
            C+VCR+ S  + ++LLCD CN  +H FCLRP+L  IP GEW CP CK
Sbjct:    1 CKVCRRKSRSDETLLLCDECNMGYHLFCLRPSLDRIPLGEWKCPACK 47          

HSP 2 Score: 49.6766 bits (117), Expect = 1.840e-6
Identity = 21/77 (27.27%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 4294 ACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYN 4524
            AC  +L  ++ ++ SWPF+ PV+ +EV DY +++++P+++  +    K  +     +  + F+  V  +F N + YN
Sbjct:  127 ACELILTELVRNEDSWPFLQPVNTKEVTDYLELVSEPMDLGTI----KDNLTLMRYEEAEAFVQHVRLVFINCDKYN 199          
BLAST of Zinc finger protein, putative vs. Ensembl Medaka
Match: baz1b (bromodomain adjacent to zinc finger domain 1B [Source:NCBI gene;Acc:101166730])

HSP 1 Score: 144.821 bits (364), Expect = 3.927e-34
Identity = 97/303 (32.01%), Postives = 149/303 (49.17%), Query Frame = 1
Query:   43 PLLSNKLYILNKIRKDK---KDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNE--------------------PVTIKLTAPKEMILKGVVVKVDRSRSNDDQEN-----------------------SPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            PLL  K Y L K   +     DE   I H  T E   N+EE   +   Y ++IWTC+ TG + LT KEA + EQ  +++L+  + + FE  VL+ VHH+  SLD L+  +W ++  +Y V+E                    P+      P E  L+G        + N  QEN                       SP KL    +++ KE  KK ++P    + Y VK+   DK++ D+P++++ RT RPP+K+ +R FIR +A+R    ++ PWVV++ELVKK+ LP+   +F +D  K 
Sbjct:    3 PLLGRKPYPLAKPLAEAPGPGDEVYIIEH--TKEAFRNKEEYEARLQKYGERIWTCKSTGSLQLTHKEAWEEEQEVTELLQEEYPQWFEKPVLEMVHHNTVSLDKLVEMSWLEVLTKYAVDEECDFLVGKDKSLRVKVVKIHPLENLEGEPAEKKLEGACDSPSSDKENASQENQRKEAPPREAESRRESLSDRARRSPRKL----TTALKEEKKKWVMPKFLPHKYDVKLINEDKVICDVPADSLFRTERPPTKEIMRYFIRHNALRLGKGESAPWVVEDELVKKFNLPSKFSDFLLDPHKF 299          

HSP 2 Score: 114.39 bits (285), Expect = 7.877e-25
Identity = 44/95 (46.32%), Postives = 64/95 (67.37%), Query Frame = 1
Query: 3004 ANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            A    ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCR+  D+  ++LCD CN AFH FCLRPAL+ IP GEW CP C+P    R +
Sbjct: 1140 ATAVEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRRKGDDEKLILCDECNKAFHLFCLRPALYRIPTGEWLCPACQPTVARRGS 1234          

HSP 3 Score: 85.8853 bits (211), Expect = 3.364e-16
Identity = 92/328 (28.05%), Postives = 160/328 (48.78%), Query Frame = 1
Query: 1159 NVKQLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREK-----------KREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEM-LAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXX-XXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDK 2103
            ++  L+ K  +  +     + P+ ++  +  R E  E+KKR  AM+ ++++  + ++R +++ +LREK           +RE++ + ED E+E  K +P    + I  G+    +  +  V +F+ CY  LLMP     +D   +TA  L +++    D S  + L   + VLL+ LLQD       E+ + L+E+P+T+ +A EL RL +        E+ Q  E+ G     DD+           V++E               EKL+T E+ +LS EDK+ +L  L +RIL    V   +D  Q+   E +K+R+   KEVND+
Sbjct:  484 SLSYLLTKAAKALTPDDRDRLPEELKELVQKRWELLEQKKRWAAMSEEEKKEEIQKKRAELKEKLREKAKERREKEMLVRREQSRRYEDQEIEGGKTLPAFKLVDIPEGLPNTLFGSVAMVVDFLHCYAGLLMP-----NDQYPITAMALMEALAG--DRSGFLYLNRVLVVLLQTLLQDELAEGYSELDMPLSEIPLTMHSASELARLCLRPCDAHGEESAQGSEDSGALGGFDDV-----------VTSE-------------FLEKLETSEVFELSPEDKVNLLVALCHRILMTYSVEDHVDAMQQRSAELWKERLAMLKEVNDR 780          

HSP 4 Score: 83.1889 bits (204), Expect = 2.153e-15
Identity = 43/124 (34.68%), Postives = 67/124 (54.03%), Query Frame = 1
Query: 4246 IQKKSCNGISAEKIE-KACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEY 4614
            +++ S  G   + +E + C  +LK +M  + SWPF +PV P+E  DY  II+ P++   M+ K+ QG Y  G D    FL D+  +F NAE YN   S +++  +  EQ F  +  K   G+ Y
Sbjct: 1323 VRQTSQTGPRRQALELEKCEEILKKLMKFRYSWPFREPVSPDEAEDYLDIISQPMDFQTMLGKFGQGSYRHGQD----FLEDLKLVFSNAEEYNQQGSTVLSCMVKTEQAFTELLQKLLPGLGY 1442          
BLAST of Zinc finger protein, putative vs. Ensembl Medaka
Match: baz1b (bromodomain adjacent to zinc finger domain 1B [Source:NCBI gene;Acc:101166730])

HSP 1 Score: 144.05 bits (362), Expect = 5.069e-34
Identity = 97/303 (32.01%), Postives = 150/303 (49.50%), Query Frame = 1
Query:   43 PLLSNKLYILNKIRKDKK---DEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNE--------------------PVTIKLTAPKEMILKGVVVKVDRSRSNDDQEN-----------------------SPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKM 813
            PLL  K Y L K   +     DE   I H  T E   N+EE   +   Y ++IWTC+ TG + LT KEA + EQ  +++L+  + + FE  VL+ VHH+  SLD L+  +W ++  +Y V+E                    P+      P E  L+G        + N  QEN                       SP KL    +++ KE  KK ++P    + Y VK+   DK++ D+P++++ RT RPP+K+ +R FIR +A+R    ++ PWVV++ELVKK+ LP+   +F +D  K+
Sbjct:    3 PLLGRKPYPLAKPLAEAPGPGDEVYIIEH--TKEAFRNKEEYEARLQKYGERIWTCKSTGSLQLTHKEAWEEEQEVTELLQEEYPQWFEKPVLEMVHHNTVSLDKLVEMSWLEVLTKYAVDEECDFLVGKDKSLRVKVVKIHPLENLEGEPAEKKLEGACDSPSSDKENASQENQRKEAPPREAESRRESLSDRARRSPRKL----TTALKEEKKKWVMPKFLPHKYDVKLINEDKVICDVPADSLFRTERPPTKEIMRYFIRHNALRLGKGESAPWVVEDELVKKFNLPSKFSDFLLDPHKV 299          

HSP 2 Score: 113.62 bits (283), Expect = 9.882e-25
Identity = 44/95 (46.32%), Postives = 64/95 (67.37%), Query Frame = 1
Query: 3004 ANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDA 3288
            A    ++  A+ +AQT +R+++L   LDAC+ W  SA++ +C+VCR+  D+  ++LCD CN AFH FCLRPAL+ IP GEW CP C+P    R +
Sbjct: 1098 ATAVEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRRKGDDEKLILCDECNKAFHLFCLRPALYRIPTGEWLCPACQPTVARRGS 1192          

HSP 3 Score: 85.8853 bits (211), Expect = 2.998e-16
Identity = 92/328 (28.05%), Postives = 160/328 (48.78%), Query Frame = 1
Query: 1159 NVKQLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREK-----------KREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEM-LAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXX-XXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDK 2103
            ++  L+ K  +  +     + P+ ++  +  R E  E+KKR  AM+ ++++  + ++R +++ +LREK           +RE++ + ED E+E  K +P    + I  G+    +  +  V +F+ CY  LLMP     +D   +TA  L +++    D S  + L   + VLL+ LLQD       E+ + L+E+P+T+ +A EL RL +        E+ Q  E+ G     DD+           V++E               EKL+T E+ +LS EDK+ +L  L +RIL    V   +D  Q+   E +K+R+   KEVND+
Sbjct:  468 SLSYLLTKAAKALTPDDRDRLPEELKELVQKRWELLEQKKRWAAMSEEEKKEEIQKKRAELKEKLREKAKERREKEMLVRREQSRRYEDQEIEGGKTLPAFKLVDIPEGLPNTLFGSVAMVVDFLHCYAGLLMP-----NDQYPITAMALMEALAG--DRSGFLYLNRVLVVLLQTLLQDELAEGYSELDMPLSEIPLTMHSASELARLCLRPCDAHGEESAQGSEDSGALGGFDDV-----------VTSE-------------FLEKLETSEVFELSPEDKVNLLVALCHRILMTYSVEDHVDAMQQRSAELWKERLAMLKEVNDR 764          

HSP 4 Score: 84.3445 bits (207), Expect = 9.949e-16
Identity = 41/108 (37.96%), Postives = 59/108 (54.63%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTR 4620
            C  +LK +M  + SWPF +PV P+E  DY  II+ P++   M+ K+ QG Y  G D    FL D+  +F NAE YN   S +++  +  EQ F  +  K   G+ Y R
Sbjct: 1257 CEEILKKLMKFRYSWPFREPVSPDEAEDYLDIISQPMDFQTMLGKFGQGSYRHGQD----FLEDLKLVFSNAEEYNQQGSTVLSCMVKTEQAFTELLQKLLPGLGYLR 1360          
BLAST of Zinc finger protein, putative vs. Ensembl Medaka
Match: BAZ1A (bromodomain adjacent to zinc finger domain 1A [Source:NCBI gene;Acc:101167005])

HSP 1 Score: 90.8929 bits (224), Expect = 1.037e-17
Identity = 33/68 (48.53%), Postives = 47/68 (69.12%), Query Frame = 1
Query: 3076 SFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRA 3279
            S L+  + WS+S  + +CR+CR+  D ++MLLCD C+   HT CLRP L  +PEG+WFCP C+P  R+
Sbjct: 1100 SSLERSILWSRSILNARCRICRRKGDADNMLLCDGCDRGHHTHCLRPRLKSVPEGDWFCPDCRPKQRS 1167          

HSP 2 Score: 63.1586 bits (152), Expect = 2.949e-9
Identity = 33/94 (35.11%), Postives = 48/94 (51.06%), Query Frame = 1
Query: 4294 ACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFF 4575
            AC  +   ++ H+ SWPF+  V   +VPDYY II  PI ++ + EK     Y S  +    F+ DV  MF N   YN   ++     + L+QFF
Sbjct: 1340 ACEQLTVELVRHEDSWPFMKLVSKTQVPDYYDIIKKPIALSTIREKVNNCQYQSTGE----FICDVELMFSNCLQYNPRHTNEAKAGVRLQQFF 1429          

HSP 3 Score: 54.299 bits (129), Expect = 1.393e-6
Identity = 32/100 (32.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKES 339
            MPLL  K +I  K   D + ++      +T+EI    +E   +T L N  +W+C +TG+  LT+ EA++SEQ   + L+ SF +     +L     S+ S
Sbjct:    1 MPLLHRKAFIRQKPPADLRPDEEVFLCKITHEIFRTYDEFFERTILCNSLVWSCALTGRAGLTYLEAVESEQRARQSLR-SFPRALLVPLLHLAAMSQRS 99          
BLAST of Zinc finger protein, putative vs. Ensembl Medaka
Match: chd4a (chromodomain-helicase-DNA-binding protein 4 [Source:NCBI gene;Acc:101174845])

HSP 1 Score: 84.3445 bits (207), Expect = 9.554e-16
Identity = 44/133 (33.08%), Postives = 59/133 (44.36%), Query Frame = 1
Query: 3121 DKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            D C VC++  +   ++LCD+C  A+H  CL P +   PEG W CPHC+      +A  D      V  A             + H E C VC       +L  C SC   +H HC  PPL +I    W C +C
Sbjct:  367 DYCEVCQQGGE---IILCDTCPRAYHMVCLDPDMEKAPEGTWSCPHCEKEGIQWEARED------VSDAEEDNGETGEMEEDDHHMEFCRVCKDGG---ELLCCDSCPSSYHIHCLNPPLPEIPNGEWICPRC 487          
BLAST of Zinc finger protein, putative vs. Ensembl Medaka
Match: chd3 (chromodomain-helicase-DNA-binding protein 3 [Source:NCBI gene;Acc:101167742])

HSP 1 Score: 83.9593 bits (206), Expect = 1.457e-15
Identity = 43/139 (30.94%), Postives = 61/139 (43.88%), Query Frame = 1
Query: 3121 DKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKT------RQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            D C VC++  +   ++LCD+C  A+H  CL P L   PEG+W CPHC+      +A  +            V   + S          + H E C VC       +L  C +C   +H HC  PPL +I    W C +C
Sbjct:  339 DYCEVCQQGGE---IILCDTCPRAYHLVCLEPELDKAPEGKWSCPHCEKEGIQWEAKDEDFEDFEEDSEDRVISEVSSGVPAGGDDEDDDHMEFCRVCKDGG---ELLCCDTCTSSYHIHCLNPPLPEIPNGEWLCPRC 471          

HSP 2 Score: 62.7734 bits (151), Expect = 3.746e-9
Identity = 23/51 (45.10%), Postives = 29/51 (56.86%), Query Frame = 1
Query: 3118 DDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPV 3270
            DD    CR   D   +L CD+C  ++H  CL P L +IP GEW CP C P+
Sbjct:  424 DDHMEFCRVCKDGGELLCCDTCTSSYHIHCLNPPLPEIPNGEWLCPRCLPI 474          
BLAST of Zinc finger protein, putative vs. Planmine SMEST
Match: SMESG000002851.1 (SMESG000002851.1)

HSP 1 Score: 2642.07 bits (6847), Expect = 0.000e+0
Identity = 1526/1533 (99.54%), Postives = 1530/1533 (99.80%), Query Frame = 1
Query:   40 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTTEIQMFNKMKDEHRDATVDLTRSDDEENNLSMKRKSLXXXXXXXXXXXXXXXXXXXFDGPMXXXXXXXXXXXXXXXXXAIXXXXXXXXXXXXXXAQRLLKLMKDNPSDPNVKQLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGEXXXXXXXXGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVEIEQXXXXXXXXXXXXXXPDHILTEWNMFTTHDELKQLLNCLSDKGIRXXXXXXXXXXXXXXXTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQCRLDEATKTNKQPSRRSISTVGAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLVKKKPFXXXXXXXXXXXXXXXXXXXQKSSVKPPLRKKSRITKSNQAAEESKPSVKSLKLESIXXXXXXXXXXXXXXLPYLFAKRSANRKRSSVTGAGNVKYHGEXXXXXXXXXXXXKAPAPKKLCNGMSVEKTEPDLXXXXXXXXXXXXXXXXXXNVKQERQSCNGSGDSDDVVNKAPIQKKSCNGISAEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTRMTDTTN 4638
            MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSN+DQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTTEIQMFNKMKDEHRDATVDLTRSDDEENNLSMKRKSLVNETKEKLVKNKKLKQTTLFDGPMTTTTTSNASQRNSNSSNAIRSPLSSPTRSLPPLAQRLLKLMKDNPSDPNVKQLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGELLRLVLLLGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSI+DKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDV NKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRLSIEMKIKESEERERRLEKERQYQKLEKEEIQLKKLLDQSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVEIEQTSTGTGTIGNNTTSPDHILTEWNMFTTHDELKQLLNCLSDKGIRESLLKSELESLLPKLTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQCRLDEATKTNKQPSRRSISTVGAADVNDNSD NDDDQNSSSNEDPDQNSRKRN+TKKRNKARNGLVKKKPFSEVEKDDEDDVEDRSEGESQKSSVKPPLRKKSRITKSNQAAEESKPSVKSLKLESINNSDSDESDQDVDNLPYLFAKRSANRKRSSVTGAGNVKYHGEDGDSNGDDNDNNKAPAPKKLCNGMSVEKTEPDLSSSKRSTSRKRGSVTGTGNVKQERQ+CNGSGDSDDVVNKAPIQKKS NGISAEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTRMTDTTN
Sbjct:    1 MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQKIWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKESLDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNEDQENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSETIERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPEFAVDKQKMKELSRTTEIQMFNKMKDEHRDATVDLTRSDDEENNLSMKRKSLVNETKEKLVKNKKLKQTTLFDGPMTTTTTSNASQRNSNSSNAIRSPLSSPTRSLPPLAQRLLKLMKDNPSDPNVKQLIFKCGQLFSNQQIAKFPDLIRVPITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTKLEDNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDASDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEMGLALTELPVTVCTAGELLRLVLLLGIDKRETRQVVENDGNEETNDDIKDQHGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIDDKIGVLELLQNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMCKLIGAKFGTDDVTNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRLSIEMKIKESEERERRLEKERQYQKLEKEEIQLKKLLDQSQKSYFTATNEAKQLMRIQPLGSDRHFRRYWHFISAPGAIYVEIEQTSTGTGTIGNNTTSPDHILTEWNMFTTHDELKQLLNCLSDKGIRESLLKSELESLLPKLTDEFQSVSKENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDYVEWQKRVNSSVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQCRLDEATKTNKQPSRRSISTVGAADVNDNSDGNDDDQNSSSNEDPDQNSRKRNRTKKRNKARNGLVKKKPFSEVEKDDEDDVEDRSEGESQKSSVKPPLRKKSRITKSNQAAEESKPSVKSLKLESINNSDSDESDQDVDNLPYLFAKRSANRKRSSVTGAGNVKYHGEDGDSNGDDNDNNKAPAPKKLCNGMSVEKTEPDLSSSKRSTSRKRGSVTGTGNVKQERQTCNGSGDSDDVVNKAPIQKKSFNGISAEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGIYSKYEFGVEYTRMTDTTN 1533          
BLAST of Zinc finger protein, putative vs. Planmine SMEST
Match: SMESG000068165.1 (SMESG000068165.1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.670e-19
Identity = 62/202 (30.69%), Postives = 89/202 (44.06%), Query Frame = 1
Query: 2923 TLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAK---CTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            T N+   TL S    V+      P + A+ R   L A    Q  A +  L +     + W KS     C++CRK  +E  +LLCDSC+  +HT+C RP L  IPEG+WFC  C  VS+A D                              Q+ C+VC    G+ + A+   C  C ++ HA C +P + ++ R  W C  C
Sbjct: 1469 TDNKKSSTLASKLESVNSSV--TPPELADWRKSILEANNDKQLLACMRTLTN----AIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDC--VSKATD------------------------------QKLCYVC----GQPKTARTTVCMVCKRMLHAICAKPTMTRVPRK-WTCHNC 1627          

HSP 2 Score: 54.6842 bits (130), Expect = 8.181e-7
Identity = 29/94 (30.85%), Postives = 48/94 (51.06%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFK 4578
            C   L  ++     +PF+ PVD ++VP Y ++I  P++ + +  K    +Y S  +    FL+D+  +F N E +N  DSDI      L  FF+
Sbjct: 1789 CRKFLLEILDLNLVYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNE----FLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFE 1878          
BLAST of Zinc finger protein, putative vs. Planmine SMEST
Match: SMESG000068165.1 (SMESG000068165.1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.692e-19
Identity = 62/202 (30.69%), Postives = 89/202 (44.06%), Query Frame = 1
Query: 2923 TLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAK---CTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            T N+   TL S    V+      P + A+ R   L A    Q  A +  L +     + W KS     C++CRK  +E  +LLCDSC+  +HT+C RP L  IPEG+WFC  C  VS+A D                              Q+ C+VC    G+ + A+   C  C ++ HA C +P + ++ R  W C  C
Sbjct: 1468 TDNKKSSTLASKLESVNSSV--TPPELADWRKSILEANNDKQLLACMRTLTN----AIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDC--VSKATD------------------------------QKLCYVC----GQPKTARTTVCMVCKRMLHAICAKPTMTRVPRK-WTCHNC 1626          

HSP 2 Score: 54.6842 bits (130), Expect = 8.112e-7
Identity = 29/94 (30.85%), Postives = 48/94 (51.06%), Query Frame = 1
Query: 4297 CYHMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFK 4578
            C   L  ++     +PF+ PVD ++VP Y ++I  P++ + +  K    +Y S  +    FL+D+  +F N E +N  DSDI      L  FF+
Sbjct: 1788 CRKFLLEILDLNLVYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNE----FLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFE 1877          
BLAST of Zinc finger protein, putative vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.227e-14
Identity = 44/136 (32.35%), Postives = 63/136 (46.32%), Query Frame = 1
Query: 3121 DKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP---VSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            D C VC++  +   ++LCD+C  AFH  CL P L + PEG W CPHC+    V+ +R     T       P +    +  ++  ++ HQE C  C        L  C  C   +H  C  PPL +I    W C +C
Sbjct:  366 DYCEVCQQGGE---IMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGG---DLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRC 495          
BLAST of Zinc finger protein, putative vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.248e-14
Identity = 44/136 (32.35%), Postives = 63/136 (46.32%), Query Frame = 1
Query: 3121 DKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKP---VSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 3519
            D C VC++  +   ++LCD+C  AFH  CL P L + PEG W CPHC+    V+ +R     T       P +    +  ++  ++ HQE C  C        L  C  C   +H  C  PPL +I    W C +C
Sbjct:  366 DYCEVCQQGGE---IMLCDTCPRAFHLVCLDPELEEAPEGSWSCPHCEKEGVVAASRSTTPATGGDMSQNPQNIRKSAQPNEEEKDEHQEFCNECKDGG---DLICCAKCPVSYHPECLYPPLSEIPEGPWLCPRC 495          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BAZ1B3.433e-3231.94bromodomain adjacent to zinc finger domain 1B [Sou... [more]
BAZ1B3.433e-3231.94bromodomain adjacent to zinc finger domain 1B [Sou... [more]
BAZ1A1.653e-1933.33bromodomain adjacent to zinc finger domain 1A [Sou... [more]
BAZ1A3.909e-1933.33bromodomain adjacent to zinc finger domain 1A [Sou... [more]
BAZ1A3.909e-1933.33bromodomain adjacent to zinc finger domain 1A [Sou... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
athp-23.415e-1341.11AT Hook plus PHD finger transcription factor [Sou... [more]
chd-32.366e-1225.55Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
baz-23.889e-1227.21Bromodomain Adjacent to Zinc finger domain, 2A/2B,... [more]
let-4185.418e-1128.89pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
pcaf-11.858e-934.78P300/CBP Associated Factor homolog [Source:UniPro... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tou9.550e-2328.49gene:FBgn0033636 transcript:FBtr0088091[more]
tou5.011e-1627.07gene:FBgn0033636 transcript:FBtr0333071[more]
tou5.442e-1627.07gene:FBgn0033636 transcript:FBtr0333070[more]
tou5.646e-1627.07gene:FBgn0033636 transcript:FBtr0113066[more]
Gcn53.656e-1434.00gene:FBgn0020388 transcript:FBtr0075969[more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
baz1b6.183e-3332.12bromodomain adjacent to zinc finger domain, 1B [So... [more]
baz1b6.890e-3332.12bromodomain adjacent to zinc finger domain, 1B [So... [more]
baz1b6.915e-3332.12bromodomain adjacent to zinc finger domain, 1B [So... [more]
baz1a2.307e-1646.27bromodomain adjacent to zinc finger domain, 1A [So... [more]
baz1a1.105e-1546.27bromodomain adjacent to zinc finger domain, 1A [So... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BAZ1B5.136e-4825.34bromodomain adjacent to zinc finger domain 1B [Sou... [more]
BAZ1B6.085e-4825.34bromodomain adjacent to zinc finger domain 1B [Sou... [more]
BAZ1B1.085e-4725.34bromodomain adjacent to zinc finger domain 1B [Sou... [more]
BAZ1B6.960e-4725.22bromodomain adjacent to zinc finger domain 1B [Sou... [more]
BAZ1A1.034e-1834.15bromodomain adjacent to zinc finger domain 1A [Sou... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Baz1b3.191e-3231.94bromodomain adjacent to zinc finger domain, 1B [So... [more]
Baz1a2.411e-1834.48bromodomain adjacent to zinc finger domain 1A [Sou... [more]
Baz1a2.492e-1834.48bromodomain adjacent to zinc finger domain 1A [Sou... [more]
Chd44.001e-1530.37chromodomain helicase DNA binding protein 4 [Sourc... [more]
Chd44.393e-1530.37chromodomain helicase DNA binding protein 4 [Sourc... [more]
back to top
BLAST of Zinc finger protein, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2BIL7|BAZ1B_DANRE6.118e-3232.12Tyrosine-protein kinase BAZ1B OS=Danio rerio OX=79... [more]
sp|Q9UIG0|BAZ1B_HUMAN1.649e-3131.94Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9... [more]
sp|Q9Z277|BAZ1B_MOUSE2.232e-3131.94Tyrosine-protein kinase BAZ1B OS=Mus musculus OX=1... [more]
sp|A8DZJ1|BAZ1B_XENLA8.226e-3026.90Tyrosine-protein kinase BAZ1B OS=Xenopus laevis OX... [more]
sp|Q9NRL2|BAZ1A_HUMAN1.877e-1833.33Bromodomain adjacent to zinc finger domain protein... [more]
back to top
BLAST of Zinc finger protein, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IXV73.572e-6326.83tyrosine-protein kinase BAZ1B OS=Lingula unguis OX... [more]
A0A183P3Y11.444e-5739.41WAC domain-containing protein OS=Schistosoma matth... [more]
A0A2T7PJP62.543e-5724.86Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S2ZE991.713e-5628.01tyrosine-protein kinase BAZ1B OS=Erinaceus europae... [more]
A0A4S2LXT12.753e-5638.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
baz1b8.858e-5125.72bromodomain adjacent to zinc finger domain 1B [Sou... [more]
baz1b6.721e-3332.00bromodomain adjacent to zinc finger domain 1B [Sou... [more]
baz1a6.162e-1832.33bromodomain adjacent to zinc finger domain, 1A [So... [more]
baz1a7.343e-1545.21bromodomain adjacent to zinc finger domain, 1A [So... [more]
BPTF1.877e-1433.03nucleosome-remodeling factor subunit BPTF [Source:... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010200.12.198e-1329.37pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 g... [more]
kat2b1.104e-1235.42K(lysine) acetyltransferase 2B [Source:NCBI gene;A... [more]
ENSPMAT00000008812.11.625e-1233.70pep scaffold:Pmarinus_7.0:GL478772:7873:35829:1 ge... [more]
ENSPMAT00000002602.14.067e-1232.17pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 g... [more]
ENSPMAT00000008781.14.720e-1247.54pep scaffold:Pmarinus_7.0:GL478673:190102:212513:-... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
GCN53.789e-1135.11Catalytic subunit of ADA and SAGA histone acetyltr... [more]
JHD21.988e-1050.00JmjC domain family histone demethylase; promotes g... [more]
RSC42.013e-631.87Component of the RSC chromatin remodeling complex;... [more]
RSC16.839e-637.80Component of the RSC chromatin remodeling complex;... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448145.432e-1440.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440546.439e-1451.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438448.892e-1438.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449028.271e-1335.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357773.468e-1257.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger protein, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
baz1b3.927e-3432.01bromodomain adjacent to zinc finger domain 1B [Sou... [more]
baz1b5.069e-3432.01bromodomain adjacent to zinc finger domain 1B [Sou... [more]
BAZ1A1.037e-1748.53bromodomain adjacent to zinc finger domain 1A [Sou... [more]
chd4a9.554e-1633.08chromodomain-helicase-DNA-binding protein 4 [Sourc... [more]
chd31.457e-1530.94chromodomain-helicase-DNA-binding protein 3 [Sourc... [more]
back to top
BLAST of Zinc finger protein, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002851.10.000e+099.54SMESG000002851.1[more]
SMESG000068165.12.670e-1930.69SMESG000068165.1[more]
SMESG000068165.12.692e-1930.69SMESG000068165.1[more]
SMESG000068192.11.227e-1432.35SMESG000068192.1[more]
SMESG000068192.11.248e-1432.35SMESG000068192.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013516 ID=SMED30013516|Name=Zinc finger protein, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=4846bp
TGTTCAACTTAAATTACTATTTGAATATTTAGATTTTAGATGCCATTATT
ATCCAACAAGCTCTACATTTTAAATAAGATTAGAAAAGACAAAAAGGACG
AGGATTCTACAATATGTCATTCTCTTACGAATGAAATATGTGAAAATGAA
GAAGAATTAAATAGAAAAACGTTTTTATATAATCAAAAAATATGGACTTG
TAGAATTACTGGACAAATAAATTTGACTTTTAAAGAAGCTTTAAAATCCG
AACAAGGTTGTTCAAAAATGTTAAAAAACTCGTTTAAGAAATGTTTTGAA
GCATCAGTTTTACAATTTGTTCATCACAGCAAAGAAAGTTTGGATACTCT
TATACATAAAGCTTGGACTCAAATTCACCAAGAGTATTGTGTAAATGAAC
CTGTGACAATTAAACTAACAGCACCGAAGGAAATGATTCTTAAAGGTGTA
GTAGTTAAAGTTGACAGATCTCGATCAAATGATGATCAAGAAAATTCTCC
TATTAAACTTAGTTCTGATGCCTCAAGTAGTGATAAGGAAAATATGAAAA
AGAAAATTATTCCAGTCAAAAAGAACTATTTTTACAGTGTTAAAATTTTT
GAAATGGATAAATTAGTCAAAGATATTCCATCAGAAACTATTGAGCGAAC
TTTGAGGCCACCTTCAAAAGATCAGATCCGAATGTTCATTCGTGCTCATG
CAATCAGACACTCTGGTAAACAGAATAATCCCTGGGTAGTTGATGAGGAA
CTGGTCAAGAAATATCGATTACCAAATTTAGAGCCAGAATTCGCCGTTGA
CAAACAAAAGATGAAAGAATTATCGAGGACAACAGAAATCCAAATGTTCA
ATAAAATGAAAGACGAGCACAGAGACGCGACAGTCGATTTGACTAGGAGT
GATGATGAGGAGAACAATTTATCGATGAAGAGAAAATCGCTGGTCAATGA
AACGAAAGAGAAATTAGTTAAAAATAAAAAATTAAAACAAACAACGCTGT
TTGACGGTCCGATGACAACTACGACAACAAGTAATGCTAGTCAACGCAAT
TCCAACTCGAGCAATGCAATACGGTCGCCTCTGTCGAGTCCGACGCGCTC
GCTGCCACCGTTGGCTCAACGGCTACTGAAGTTAATGAAAGACAATCCAT
CAGATCCGAACGTCAAACAATTGATATTCAAATGCGGCCAGCTGTTCAGC
AATCAACAGATTGCCAAGTTCCCAGATTTGATCCGTGTCCCGATCACTGA
CAGGAAGGAGAAATACGAGGAGAAAAAGCGACTAGACGCCATGACTGCAG
ACCAGAGAGAAGCATATCTCAATGAGAGGCGCAACCAAATGCGGCGTCAG
TTACGGGAGAAAAAGCGTGAAGAAAACACTAAATTGGAAGATAATGAATT
GGAATATGCGAAGCAAATCCCGGAAGGAACCCCGATCTCCATTGAAGGCG
GCATGAATCAAGATCAATGGGCGCGATTGGTGTCAGTGTGTGAGTTCGTG
CGCTGCTACAAACGGCTGCTAATGCCGTCGAGTGATGCGTCAGATGATAG
CAAAGTTTTGACTGCTCGCGATCTCTGTCAGTCGGTTATCAGCAAATGTG
ACAACTCACATGAAATGCTTGCGGAATTCGTGTGCGTCCTCCTCAAACCG
TTGCTACAAGACAGTCGAATCAGGAGTCGCAAAGAGATGGGATTGGCATT
GACCGAGTTGCCAGTGACCGTATGCACTGCCGGTGAGCTTTTGCGACTAG
TTCTGTTACTCGGAATCGATAAACGAGAAACTCGTCAAGTAGTCGAAAAT
GATGGGAACGAGGAGACAAATGACGATATAAAGGACCAGCACGGAGATGT
CGCTGATGAAGAGGTATCGACAGAGATCTGGAACTGTAACCATAACAAGC
GGATAGCCGGACCGATTTGCGAGAAACTGCAAACTGTCGAACTGCAACAG
TTGAGCATTGAAGACAAAATCGGCGTATTAGAGCTTTTGCAAAATCGGAT
TCTCGAGCTGGACATTGTCAGTTCATTCATTGATGACTACCAGCGGGAGG
TGTGCGAGGCGTACAAGAAGCGGATTACCGACACAAAGGAGGTCAATGAC
AAATTGAAAGCCGTCAGACAGAGTAAGCAGGAAATGTGCAAATTAATCGG
TGCCAAGTTTGGCACCGATGACGTCAATAATAAATCGATGACTGGTGATG
GAAACAACTCGGGGCGATTGTTTGTCAGTGGAGGAACTGACTCATTGATA
ACTGACGACACGAGCCAGGTTGTCAGAAGGCGTCTGTCGATTGAAATGAA
AATCAAGGAATCCGAGGAGCGGGAGCGCAGGCTGGAGAAAGAACGGCAAT
ATCAGAAGCTAGAGAAAGAAGAAATTCAGTTAAAGAAGCTATTAGATCAA
TCTCAAAAATCATATTTTACTGCCACGAATGAAGCTAAACAATTGATGCG
AATACAACCACTCGGTTCCGATCGGCATTTCCGTCGGTATTGGCACTTCA
TATCAGCACCAGGGGCCATTTATGTCGAGATAGAGCAAACTAGCACAGGA
ACTGGAACTATCGGCAACAATACTACATCTCCCGATCATATACTGACCGA
ATGGAACATGTTCACAACCCACGACGAACTCAAACAATTGCTCAACTGCC
TCTCGGACAAGGGCATACGGGAGAGTCTTCTGAAATCAGAACTCGAGTCG
TTGCTGCCTAAATTGACCGATGAATTCCAGTCGGTATCCAAGGAAAACGA
GGAACAAGCAGCTCGTACAAACCCGCCGGTCGTGGCCGATTCCGGAGAGC
AATCATTTCTCGTGACAGGATTCAAGCGGGAACTGAAGGAAACAGAAATC
TCGATCAGACAGGGCAGTCTCGGTGGGGTTGAGGATTATGTTGAGTGGCA
AAAACGAGTCAATTCATCGGTAACCCTCAACGAAATGAAAGAAACTCTTG
TGTCAGTATTCCTCGGTGTTCATGAGCGGTTCTGGAACGTGCCATTGAAA
TCAGCCAATGGGCGCAATGAATTCCTTAACGCAGTCGAACAGGCACAAAC
CCAAGCCAGACTGAATATGCTGCAATCCTTCCTTGACGCCTGTGTCTGTT
GGAGCAAATCTGCAAAGGATGACAAATGTCGCGTCTGTAGAAAGGCGTCA
GATGAAAACTCGATGCTCCTCTGCGACAGTTGTAATCACGCATTTCACAC
GTTTTGCTTGCGACCGGCCTTGCATGATATCCCAGAAGGCGAGTGGTTTT
GTCCGCATTGCAAGCCGGTTTCCCGGGCCCGTGACGCTGACTCAGACACC
GTTGCTATGACATTTGTCCCACCCGCCCACTCAGTAACCCAATCGATCAA
ATCCAAAACCCGACAAAACTCACACCAGGAACAGTGCTTCGTGTGCCACA
GTTCCAACGGTGAACAGCAATTAGCTAAGTGTACCTCATGCAACAAATTA
TTCCACGCCCATTGCCATGAGCCCCCTCTCAGACAAATCCGACGGACCAA
TTGGCACTGTTGCCAGTGTCGACTGGACGAGGCCACCAAAACCAATAAGC
AACCATCGAGACGTTCTATCTCAACTGTCGGTGCTGCAGATGTCAATGAC
AATTCCGATGTTAACGATGACGATCAGAACTCCTCGAGCAATGAAGATCC
CGATCAAAACAGCAGGAAACGCAATAAAACCAAAAAACGAAACAAAGCCC
GTAATGGACTAGTCAAAAAGAAACCATTCAGTGAAGTTGAGAAAGACGAC
GAAGATGACGTCGAAGATCGCAGTGAAGGAGAATCTCAGAAATCGTCAGT
GAAACCTCCATTGAGAAAGAAATCGAGAATTACGAAATCCAATCAAGCTG
CAGAGGAATCGAAACCGTCTGTAAAATCATTAAAATTAGAGTCGATTAAT
AATTCCGATTCCGATGAGTCTGATCAAGATGTCGACAATTTGCCGTATCT
GTTTGCTAAACGTTCCGCCAATCGGAAACGAAGTTCAGTTACCGGTGCAG
GAAACGTGAAATACCACGGTGAAGATGGTGACAGTAATGGCGATGATAAC
GACAATAATAAAGCTCCAGCCCCGAAGAAACTCTGCAACGGAATGTCAGT
CGAAAAGACCGAGCCTGATTTATCAAGTTCTAAACGTTCCACCAGTCGGA
AGCGCGGTTCAGTAACCGGTACAGGAAATGTCAAGCAGGAAAGGCAATCC
TGTAACGGTAGCGGTGACAGTGATGATGTTGTGAATAAAGCTCCAATCCA
AAAGAAATCTTGCAACGGGATATCAGCGGAAAAGATCGAGAAAGCTTGCT
ATCATATGCTGAAAAATATGATGAGTCACAAGGCCTCCTGGCCATTCATT
GATCCCGTCGATCCAGAAGAGGTCCCTGATTACTATCAGATCATCACTGA
TCCGATTAATATCGCTCAAATGATGGAGAAATACAAACAGGGAATATATG
CGTCAGGTATTGATTCTCTCAAAATATTTCTTTCCGATGTCGGGCAAATG
TTTTTCAATGCCGAGGTTTACAATATGCCCGACAGTGATATCATGAATCT
GGCAATCACCCTTGAGCAGTTCTTCAAAGGCATTTATAGTAAATATGAGT
TCGGAGTCGAGTATACCAGAATGACCGACACGACAAACTGAGGAGAAAGC
TTTGTAGATTCTATGTTATCCCGAAAATTGTTAATATATATTTATAATAA
TAATATGACATTGTGTTCTTTGCTGCATTTATCATAACCGTCGTTTTGTG
ACTATTAACCCCCGTTACTGCCTCGCCACCACTGTTACTCCACTAGCCTA
TTTGTAAATAGTTGACATGTACTTCTTTTATCGTCGTAATAGTAAT
back to top

protein sequence of SMED30013516-orf-1

>SMED30013516-orf-1 ID=SMED30013516-orf-1|Name=SMED30013516-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1534bp
MPLLSNKLYILNKIRKDKKDEDSTICHSLTNEICENEEELNRKTFLYNQK
IWTCRITGQINLTFKEALKSEQGCSKMLKNSFKKCFEASVLQFVHHSKES
LDTLIHKAWTQIHQEYCVNEPVTIKLTAPKEMILKGVVVKVDRSRSNDDQ
ENSPIKLSSDASSSDKENMKKKIIPVKKNYFYSVKIFEMDKLVKDIPSET
IERTLRPPSKDQIRMFIRAHAIRHSGKQNNPWVVDEELVKKYRLPNLEPE
FAVDKQKMKELSRTTEIQMFNKMKDEHRDATVDLTRSDDEENNLSMKRKS
LVNETKEKLVKNKKLKQTTLFDGPMTTTTTSNASQRNSNSSNAIRSPLSS
PTRSLPPLAQRLLKLMKDNPSDPNVKQLIFKCGQLFSNQQIAKFPDLIRV
PITDRKEKYEEKKRLDAMTADQREAYLNERRNQMRRQLREKKREENTKLE
DNELEYAKQIPEGTPISIEGGMNQDQWARLVSVCEFVRCYKRLLMPSSDA
SDDSKVLTARDLCQSVISKCDNSHEMLAEFVCVLLKPLLQDSRIRSRKEM
GLALTELPVTVCTAGELLRLVLLLGIDKRETRQVVENDGNEETNDDIKDQ
HGDVADEEVSTEIWNCNHNKRIAGPICEKLQTVELQQLSIEDKIGVLELL
QNRILELDIVSSFIDDYQREVCEAYKKRITDTKEVNDKLKAVRQSKQEMC
KLIGAKFGTDDVNNKSMTGDGNNSGRLFVSGGTDSLITDDTSQVVRRRLS
IEMKIKESEERERRLEKERQYQKLEKEEIQLKKLLDQSQKSYFTATNEAK
QLMRIQPLGSDRHFRRYWHFISAPGAIYVEIEQTSTGTGTIGNNTTSPDH
ILTEWNMFTTHDELKQLLNCLSDKGIRESLLKSELESLLPKLTDEFQSVS
KENEEQAARTNPPVVADSGEQSFLVTGFKRELKETEISIRQGSLGGVEDY
VEWQKRVNSSVTLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVE
QAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNH
AFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVT
QSIKSKTRQNSHQEQCFVCHSSNGEQQLAKCTSCNKLFHAHCHEPPLRQI
RRTNWHCCQCRLDEATKTNKQPSRRSISTVGAADVNDNSDVNDDDQNSSS
NEDPDQNSRKRNKTKKRNKARNGLVKKKPFSEVEKDDEDDVEDRSEGESQ
KSSVKPPLRKKSRITKSNQAAEESKPSVKSLKLESINNSDSDESDQDVDN
LPYLFAKRSANRKRSSVTGAGNVKYHGEDGDSNGDDNDNNKAPAPKKLCN
GMSVEKTEPDLSSSKRSTSRKRGSVTGTGNVKQERQSCNGSGDSDDVVNK
APIQKKSCNGISAEKIEKACYHMLKNMMSHKASWPFIDPVDPEEVPDYYQ
IITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSD
IMNLAITLEQFFKGIYSKYEFGVEYTRMTDTTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036427Bromodomain-like_sf
IPR001487Bromodomain
IPR001965Znf_PHD
IPR013083Znf_RING/FYVE/PHD
IPR019787Znf_PHD-finger
IPR013136WSTF_Acf1_Cbp146
IPR028941WHIM2_dom
IPR001841Znf_RING
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0016301kinase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 748..791
NoneNo IPR availableCOILSCoilCoilcoord: 424..459
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1328..1342
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1368..1394
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 322..353
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1269..1287
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1171..1186
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 899..918
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1168..1396
NoneNo IPR availablePANTHERPTHR46802FAMILY NOT NAMEDcoord: 272..1079
coord: 36..171
coord: 172..266
coord: 1110..1530
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 1445..1461
score: 34.53
coord: 1483..1502
score: 37.93
coord: 1431..1444
score: 41.93
IPR001487BromodomainSMARTSM00297bromo_6coord: 1409..1521
e-value: 2.7E-23
score: 93.4
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 1421..1505
e-value: 2.4E-16
score: 59.6
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 1428..1502
score: 18.198
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 1115..1161
e-value: 0.067
score: 22.3
coord: 1029..1075
e-value: 1.9E-14
score: 64.0
IPR013136WSTF/Acf1/Cbp146PFAMPF10537WAC_Acf1_DNA_bdcoord: 28..122
e-value: 2.0E-22
score: 79.6
IPR013136WSTF/Acf1/Cbp146PROSITEPS51136WACcoord: 22..130
score: 25.94
IPR028941WHIM2 domainPFAMPF15613WSDcoord: 803..886
e-value: 5.6E-16
score: 58.8
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 1392..1525
e-value: 5.7E-27
score: 96.1
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 1397..1519
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 1030..1076
e-value: 1.1E-12
score: 47.6
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1113..1163
score: 8.876
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1027..1077
score: 10.416
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1020..1093
e-value: 2.1E-18
score: 67.7
coord: 1099..1184
e-value: 1.2E-11
score: 46.0
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 1030..1075
score: 10.409
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1020..1076
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1103..1167