Tpd52 like 1

Overview
NameTpd52 like 1
Smed IDSMED30013503
Length (bp)656
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tpd52 like 1 (SMED30013503) t-SNE clustered cells

Violin plots show distribution of expression levels for Tpd52 like 1 (SMED30013503) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tpd52 like 1 (SMED30013503) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tpd52 like 1 (SMED30013503) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013503

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30013503h1SMcG0003880 Contig988GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30013503h1SMcG0003880 Contig988GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30013503h1SMcG0003880 Contig988GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30013503h1SMcG0003880 Contig988GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30013503h1SMcG0003880 dd_Smed_v4_2467_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tpd52 like 1 vs. Ensembl Human
Match: TPD52L2 (TPD52 like 2 [Source:HGNC Symbol;Acc:HGNC:12007])

HSP 1 Score: 62.7734 bits (151), Expect = 7.577e-12
Identity = 33/102 (32.35%), Postives = 58/102 (56.86%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            K++EEI  LR  L+ K +   ++K +LG + L E++ +      +++ S+ Y KT E LS A  KTS  +      +S+KL + + S  +K  E++VG++ S
Sbjct:   32 KVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKS 133          
BLAST of Tpd52 like 1 vs. Ensembl Human
Match: TPD52L2 (TPD52 like 2 [Source:HGNC Symbol;Acc:HGNC:12007])

HSP 1 Score: 62.7734 bits (151), Expect = 1.206e-11
Identity = 33/102 (32.35%), Postives = 58/102 (56.86%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            K++EEI  LR  L+ K +   ++K +LG + L E++ +      +++ S+ Y KT E LS A  KTS  +      +S+KL + + S  +K  E++VG++ S
Sbjct:   55 KVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKS 156          
BLAST of Tpd52 like 1 vs. Ensembl Human
Match: AC036214.3 (novel protein, TPD52-MRPS28 readthrough)

HSP 1 Score: 63.1586 bits (152), Expect = 2.199e-11
Identity = 39/112 (34.82%), Postives = 60/112 (53.57%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAA 499
            K++EEI  L   L+ K +  A+IK KLG   L E++ +   G +++  ++ Y KT E LS A  K S        +++KKL + K S  +K  E KV +L  S K+   FA+
Sbjct:   85 KVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKGSPKNVESFAS 196          
BLAST of Tpd52 like 1 vs. Ensembl Human
Match: TPD52L1 (TPD52 like 1 [Source:HGNC Symbol;Acc:HGNC:12006])

HSP 1 Score: 60.077 bits (144), Expect = 9.831e-11
Identity = 34/105 (32.38%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            ++++EI+ LR  LS K +   +IK KLG  L++E++ +F     +++ +T Y KT E LS A  K +         +SKK  + + S  +K  E +V + V+S+K
Sbjct:   45 QLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMRNSPTFKSFEERVETTVTSLK 149          
BLAST of Tpd52 like 1 vs. Ensembl Human
Match: TPD52 (tumor protein D52 [Source:HGNC Symbol;Acc:HGNC:12005])

HSP 1 Score: 60.077 bits (144), Expect = 1.797e-10
Identity = 36/102 (35.29%), Postives = 55/102 (53.92%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            K++EEI  L   L+ K +  A+IK KLG   L E++ +   G +++  ++ Y KT E LS A  K S        +++KKL + K S  +K  E KV +L S
Sbjct:   85 KVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKS 186          
BLAST of Tpd52 like 1 vs. Ensembl Celegans
Match: F13E6.1 (pep chromosome:WBcel235:X:10675706:10677109:-1 gene:WBGene00008745.1 transcript:F13E6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13E6.1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.435e-12
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 2
Query:  107 PANNSSA-------DIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK-------DAFFFAAYGPP----PISDE 526
            P N+SS+         +++ L  +L K +EEIS L+  LS + +  A++K KLG T   E+  D    +K + ++  Y KT EV ++           T D V +K ++ + S+ +K  E+K+GS +++ K       D    AA GP     P+++E
Sbjct:   44 PQNDSSSSNKIVLSQAEKDLLRTELDKTEEEISTLKQVLSARQKHAAELKRKLGLTPFSELSQDINRSLKTVTDTDAYQKTAEVAAA-----------TSDTVKEKWNDMRNSSLFKSFESKLGSALNNAKMAASTSIDHLAGAARGPSQTGTPVAEE 190          
BLAST of Tpd52 like 1 vs. Ensembl Fly
Match: CG5174 (gene:FBgn0034345 transcript:FBtr0301149)

HSP 1 Score: 79.7221 bits (195), Expect = 3.032e-18
Identity = 55/162 (33.95%), Postives = 87/162 (53.70%), Query Frame = 2
Query:   47 FEKVFYNLML--DSYDTLLE-VSPANN-SSADI--------------DREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            ++KVF  +    D+   L E  SPAN+ +SA+I               R +   +L +++EEI+ LRT L+ K +  + +K KLG T+  E+  D   G+KN+KEST Y +T  VL S  +KT++V       +S KL + K S + + +E  VGS   ++K
Sbjct:    6 YDKVFEEVAFKGDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQRTESVLKSTGEKTASVFGSITSGISSKLSQMKNSESMRSIEASVGSAYENVK 167          
BLAST of Tpd52 like 1 vs. Ensembl Fly
Match: CG5174 (gene:FBgn0034345 transcript:FBtr0086689)

HSP 1 Score: 78.9518 bits (193), Expect = 3.745e-18
Identity = 49/140 (35.00%), Postives = 77/140 (55.00%), Query Frame = 2
Query:  104 SPANN-SSADI--------------DREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            SPAN+ +SA+I               R +   +L +++EEI+ LRT L+ K +  + +K KLG T+  E+  D   G+KN+KEST Y +T  VL S  +KT++V       +S KL + K S + + +E  VGS   ++K
Sbjct:   14 SPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQRTESVLKSTGEKTASVFGSITSGISSKLSQMKNSESMRSIEASVGSAYENVK 153          
BLAST of Tpd52 like 1 vs. Ensembl Fly
Match: CG5174 (gene:FBgn0034345 transcript:FBtr0086687)

HSP 1 Score: 78.9518 bits (193), Expect = 5.045e-18
Identity = 42/114 (36.84%), Postives = 67/114 (58.77%), Query Frame = 2
Query:  137 REKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            R +   +L +++EEI+ LRT L+ K +  + +K KLG T+  E+  D   G+KN+KEST Y +T  VL S  +KT++V       +S KL + K S + + +E  VGS   ++K
Sbjct:   40 RAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQRTESVLKSTGEKTASVFGSITSGISSKLSQMKNSESMRSIEASVGSAYENVK 153          
BLAST of Tpd52 like 1 vs. Ensembl Fly
Match: CG5174 (gene:FBgn0034345 transcript:FBtr0301148)

HSP 1 Score: 67.781 bits (164), Expect = 1.197e-13
Identity = 55/174 (31.61%), Postives = 84/174 (48.28%), Query Frame = 2
Query:   71 MLDSYDT--LLE-VSPANN-SSADI--------------DREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTT--------------------YHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            M D Y+T  L E  SPAN+ +SA+I               R +   +L +++EEI+ LRT L+ K +  + +K KLG T+  E+  D   G+KN+KEST                     Y +T  VL S  +KT++V       +S KL + K S + + +E  VGS   ++K
Sbjct:    1 MEDLYNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMKNSESMRSIEASVGSAYENVK 174          
BLAST of Tpd52 like 1 vs. Ensembl Fly
Match: CG5174 (gene:FBgn0034345 transcript:FBtr0086684)

HSP 1 Score: 67.0106 bits (162), Expect = 1.318e-13
Identity = 49/160 (30.63%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  104 SPANN-SSADI--------------DREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTT--------------------YHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            SPAN+ +SA+I               R +   +L +++EEI+ LRT L+ K +  + +K KLG T+  E+  D   G+KN+KEST                     Y +T  VL S  +KT++V       +S KL + K S + + +E  VGS   ++K
Sbjct:   14 SPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVYEAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQMKNSESMRSIEASVGSAYENVK 173          
BLAST of Tpd52 like 1 vs. Ensembl Zebrafish
Match: tpd52 (tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503-680])

HSP 1 Score: 65.4698 bits (158), Expect = 6.242e-13
Identity = 39/129 (30.23%), Postives = 71/129 (55.04%), Query Frame = 2
Query:   95 LEVSPANNSSADIDREK--LEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSM 475
            ++ +P +  +   ++E+  L  +L+K++EEI  L   L+ K +Q A+IK KLG T L+E++ +   G  ++  ST Y KT E LS    K +         +++KL + + + ++K  E KV +L + M
Sbjct:   23 VDAAPCSPCTVLTEQEQAELHSELQKVEEEIQTLSQVLAAKEKQVAEIKRKLGITPLNELKQNLSKGWHDVTTSTAYKKTSETLSQVGQKATTAFSSVGTAITRKLEDVRNTPSFKSFEEKVETLKTKM 151          
BLAST of Tpd52 like 1 vs. Ensembl Zebrafish
Match: tpd52 (tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503-680])

HSP 1 Score: 65.4698 bits (158), Expect = 8.000e-13
Identity = 39/129 (30.23%), Postives = 71/129 (55.04%), Query Frame = 2
Query:   95 LEVSPANNSSADIDREK--LEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSM 475
            ++ +P +  +   ++E+  L  +L+K++EEI  L   L+ K +Q A+IK KLG T L+E++ +   G  ++  ST Y KT E LS    K +         +++KL + + + ++K  E KV +L + M
Sbjct:   22 VDAAPCSPCTVLTEQEQAELHSELQKVEEEIQTLSQVLAAKEKQVAEIKRKLGITPLNELKQNLSKGWHDVTTSTAYKKTSETLSQVGQKATTAFSSVGTAITRKLEDVRNTPSFKSFEEKVETLKTKM 150          
BLAST of Tpd52 like 1 vs. Ensembl Zebrafish
Match: tpd52l1 (tpd52 like 1 [Source:ZFIN;Acc:ZDB-GENE-050522-121])

HSP 1 Score: 65.0846 bits (157), Expect = 1.090e-12
Identity = 38/107 (35.51%), Postives = 63/107 (58.88%), Query Frame = 2
Query:  158 LKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            L K++EEI+ L+  L+ K ++  ++K KLG T L E++ +F     +++ ST Y KT E LS+A  +TS         +S+K  + + S ++K  E KV S VS++K
Sbjct:   43 LTKLEEEITTLKQVLASKEKRHLELKQKLGITALSELRHNFNKSWNDMQTSTVYKKTSETLSTAGQRTSAAFSNLGTAISRKFGDMRNSPSFKSFEEKVESTVSNIK 149          
BLAST of Tpd52 like 1 vs. Ensembl Zebrafish
Match: tpd52l2b (tpd52 like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-822])

HSP 1 Score: 63.929 bits (154), Expect = 2.707e-12
Identity = 35/100 (35.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSL 463
            K++EEI+ LR  LS K +  +++K KLG + L E + +     ++++ S  Y KT E LS A  KTS  +      +S+KL + + S  +K  E+KVG++
Sbjct:   57 KVEEEINTLRQVLSAKERHASELKRKLGLSPLTEFKQNITKSWQDVQTSNAYKKTQETLSQAGQKTSAALSTVGTAISRKLGDMRNSPTFKSFEDKVGNI 156          
BLAST of Tpd52 like 1 vs. Ensembl Zebrafish
Match: tpd52 (tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503-680])

HSP 1 Score: 58.151 bits (139), Expect = 3.703e-10
Identity = 39/138 (28.26%), Postives = 71/138 (51.45%), Query Frame = 2
Query:   95 LEVSPANNSSADIDREK--LEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAK---------ESNAYKEVENKVGSLVSSM 475
            ++ +P +  +   ++E+  L  +L+K++EEI  L   L+ K +Q A+IK KLG T L+E++ +   G  ++  ST Y KT E LS    K +         +++KL + +          + ++K  E KV +L + M
Sbjct:   23 VDAAPCSPCTVLTEQEQAELHSELQKVEEEIQTLSQVLAAKEKQVAEIKRKLGITPLNELKQNLSKGWHDVTTSTAYKKTSETLSQVGQKATTAFSSVGTAITRKLEDVRLQSFSNSFGNTPSFKSFEEKVETLKTKM 160          
BLAST of Tpd52 like 1 vs. Ensembl Xenopus
Match: tpd52 (tumor protein D52 [Source:NCBI gene;Acc:100135218])

HSP 1 Score: 57.7658 bits (138), Expect = 1.018e-9
Identity = 35/98 (35.71%), Postives = 51/98 (52.04%), Query Frame = 2
Query:  176 EISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            EI  L   L+ K +  A IK KLG T L E++ +   G+ ++  +T Y +T E LS A  K S        +++KKL + K S  YK  E +V +L S
Sbjct:   86 EIQTLSQVLAAKEKHHADIKRKLGVTALSELKQNISKGLHDVASTTVYKRTSETLSHAGQKASAAFSSVGSVITKKLEDVKNSPTYKSFEERVENLKS 183          
BLAST of Tpd52 like 1 vs. Ensembl Xenopus
Match: tpd52 (tumor protein D52 [Source:NCBI gene;Acc:100135218])

HSP 1 Score: 56.6102 bits (135), Expect = 1.346e-9
Identity = 35/98 (35.71%), Postives = 51/98 (52.04%), Query Frame = 2
Query:  176 EISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            EI  L   L+ K +  A IK KLG T L E++ +   G+ ++  +T Y +T E LS A  K S        +++KKL + K S  YK  E +V +L S
Sbjct:   43 EIQTLSQVLAAKEKHHADIKRKLGVTALSELKQNISKGLHDVASTTVYKRTSETLSHAGQKASAAFSSVGSVITKKLEDVKNSPTYKSFEERVENLKS 140          
BLAST of Tpd52 like 1 vs. Ensembl Xenopus
Match: tpd52 (tumor protein D52 [Source:NCBI gene;Acc:100135218])

HSP 1 Score: 56.6102 bits (135), Expect = 1.496e-9
Identity = 35/98 (35.71%), Postives = 51/98 (52.04%), Query Frame = 2
Query:  176 EISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            EI  L   L+ K +  A IK KLG T L E++ +   G+ ++  +T Y +T E LS A  K S        +++KKL + K S  YK  E +V +L S
Sbjct:   46 EIQTLSQVLAAKEKHHADIKRKLGVTALSELKQNISKGLHDVASTTVYKRTSETLSHAGQKASAAFSSVGSVITKKLEDVKNSPTYKSFEERVENLKS 143          
BLAST of Tpd52 like 1 vs. Ensembl Mouse
Match: Tpd52l2 (tumor protein D52-like 2 [Source:MGI Symbol;Acc:MGI:1913564])

HSP 1 Score: 63.929 bits (154), Expect = 3.255e-12
Identity = 34/102 (33.33%), Postives = 58/102 (56.86%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            K++EEI  LR  L+ K +   ++K +LG + L E++ +      +++ ST Y KT E LS A  KTS  +      +S+KL + + S  +K  E++VG++ S
Sbjct:   55 KVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSTAYKKTQETLSQAGQKTSAALSTMGSAISRKLGDMRNSATFKSFEDRVGTIKS 156          
BLAST of Tpd52 like 1 vs. Ensembl Mouse
Match: Tpd52l1 (tumor protein D52-like 1 [Source:MGI Symbol;Acc:MGI:1298386])

HSP 1 Score: 62.003 bits (149), Expect = 1.429e-11
Identity = 40/137 (29.20%), Postives = 72/137 (52.55%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPI--VVNSASQN 568
            ++++EI+ LR  LS K +   +IK KLG  L++E++ +F     +++ +T Y KT E LS A  K +         +SKK  + + S+ +K  E +V + V+S+K       +G        +EE +    +++SQN
Sbjct:   45 QLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSRSWHDMQTTTAYKKTHETLSHAGQKATAAFNNVGTAISKKFGDMRNSSTFKSFEERVETTVASLKTKVGGTNHGGGS-----FEEVLNSTAHASSQN 176          
BLAST of Tpd52 like 1 vs. Ensembl Mouse
Match: Tpd52 (tumor protein D52 [Source:MGI Symbol;Acc:MGI:107749])

HSP 1 Score: 58.5362 bits (140), Expect = 1.896e-10
Identity = 36/107 (33.64%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDA 484
            K++EEI  L   L+ K +  A++K KLG + L E + +   G +++  +  Y KT E LS A  K S        +++KKL + K S  +K  E KV +L S +  A
Sbjct:   22 KVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGA 128          
BLAST of Tpd52 like 1 vs. Ensembl Mouse
Match: Tpd52 (tumor protein D52 [Source:MGI Symbol;Acc:MGI:107749])

HSP 1 Score: 59.3066 bits (142), Expect = 2.591e-10
Identity = 36/107 (33.64%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDA 484
            K++EEI  L   L+ K +  A++K KLG + L E + +   G +++  +  Y KT E LS A  K S        +++KKL + K S  +K  E KV +L S +  A
Sbjct:   84 KVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGA 190          
BLAST of Tpd52 like 1 vs. Ensembl Mouse
Match: Tpd52 (tumor protein D52 [Source:MGI Symbol;Acc:MGI:107749])

HSP 1 Score: 58.5362 bits (140), Expect = 2.648e-10
Identity = 36/107 (33.64%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDA 484
            K++EEI  L   L+ K +  A++K KLG + L E + +   G +++  +  Y KT E LS A  K S        +++KKL + K S  +K  E KV +L S +  A
Sbjct:   45 KVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGA 151          
BLAST of Tpd52 like 1 vs. UniProt/SwissProt
Match: sp|P55326|YZG1_CAEEL (Uncharacterized protein F13E6.1 OS=Caenorhabditis elegans OX=6239 GN=F13E6.1 PE=3 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 4.370e-11
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 2
Query:  107 PANNSSA-------DIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK-------DAFFFAAYGPP----PISDE 526
            P N+SS+         +++ L  +L K +EEIS L+  LS + +  A++K KLG T   E+  D    +K + ++  Y KT EV ++           T D V +K ++ + S+ +K  E+K+GS +++ K       D    AA GP     P+++E
Sbjct:   44 PQNDSSSSNKIVLSQAEKDLLRTELDKTEEEISTLKQVLSARQKHAAELKRKLGLTPFSELSQDINRSLKTVTDTDAYQKTAEVAAA-----------TSDTVKEKWNDMRNSSLFKSFESKLGSALNNAKMAASTSIDHLAGAARGPSQTGTPVAEE 190          
BLAST of Tpd52 like 1 vs. UniProt/SwissProt
Match: sp|P55327|TPD52_HUMAN (Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 8.628e-10
Identity = 36/102 (35.29%), Postives = 55/102 (53.92%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            K++EEI  L   L+ K +  A+IK KLG   L E++ +   G +++  ++ Y KT E LS A  K S        +++KKL + K S  +K  E KV +L S
Sbjct:   85 KVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKS 186          
BLAST of Tpd52 like 1 vs. UniProt/SwissProt
Match: sp|Q62393|TPD52_MOUSE (Tumor protein D52 OS=Mus musculus OX=10090 GN=Tpd52 PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 1.812e-9
Identity = 36/107 (33.64%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDA 484
            K++EEI  L   L+ K +  A++K KLG + L E + +   G +++  +  Y KT E LS A  K S        +++KKL + K S  +K  E KV +L S +  A
Sbjct:   84 KVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGA 190          
BLAST of Tpd52 like 1 vs. UniProt/SwissProt
Match: sp|Q95212|TPD52_RABIT (Tumor protein D52 OS=Oryctolagus cuniculus OX=9986 GN=TPD52 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 2.441e-9
Identity = 35/102 (34.31%), Postives = 55/102 (53.92%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVS 469
            K++EEI  L   L+ + +  A+IK KLG   L E++ +   G +++  ++ Y KT E LS A  K S        +++KKL + K S  +K  E KV +L S
Sbjct:   45 KVEEEIQTLSQVLAAREKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKS 146          
BLAST of Tpd52 like 1 vs. UniProt/SwissProt
Match: sp|O54818|TPD53_MOUSE (Tumor protein D53 OS=Mus musculus OX=10090 GN=Tpd52l1 PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.917e-7
Identity = 40/150 (26.67%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHE-------------AKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPI--VVNSASQN 568
            ++++EI+ LR  LS K +   +IK KLG  L++E++ +F     +++ +T Y KT E LS A  K +         +SKK  +              + S+ +K  E +V + V+S+K       +G        +EE +    +++SQN
Sbjct:   45 QLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSRSWHDMQTTTAYKKTHETLSHAGQKATAAFNNVGTAISKKFGDMRYSIRHSISMPAMRNSSTFKSFEERVETTVASLKTKVGGTNHGGGS-----FEEVLNSTAHASSQN 189          
BLAST of Tpd52 like 1 vs. TrEMBL
Match: A0A443SJK2 (Tumor protein D54-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_02291 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.268e-18
Identity = 50/118 (42.37%), Postives = 73/118 (61.86%), Query Frame = 2
Query:  137 REKLEDDLK----KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            REKL+++ K    K +EEI  LR  LS K++   ++K KLG T+  E Q D   G+KNI+EST Y KT +V+  A +KT++V       + +KL E K SNA+K  E +V S V+++K
Sbjct:    6 REKLQEEWKLELAKTEEEIQTLRQVLSSKVRHAQELKRKLGITVWKEFQADLGQGVKNIQESTAYQKTADVVKIAGEKTTSVFGTLGGSIGRKLGEVKNSNAFKSFEERVSSTVTTVK 123          
BLAST of Tpd52 like 1 vs. TrEMBL
Match: A0A3S3Q243 (Tumor protein D54-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_12996 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.832e-18
Identity = 52/118 (44.07%), Postives = 73/118 (61.86%), Query Frame = 2
Query:  137 REKLEDD----LKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            R +LE++    L K +EEI  LR  LS K++   ++K KLG T+  E Q D   G+KNI+EST Y KT EV+  A +KT++V       V++KL E K SNA+K  E +V S VS++K
Sbjct:   33 RAQLEEEWRLELTKTEEEIQTLRQVLSAKVRHAQELKRKLGITVWKEFQQDLGQGVKNIQESTAYQKTSEVVKIAGEKTTSVFGTLGGSVARKLGEVKNSNAFKSFEERVSSTVSNVK 150          
BLAST of Tpd52 like 1 vs. TrEMBL
Match: A0A3Q0KH09 (Putative tumor protein d52 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.384e-18
Identity = 50/136 (36.76%), Postives = 79/136 (58.09%), Query Frame = 2
Query:  125 ADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEY 532
            +D +  +L+ +L +++EEI  L+ TL +K ++  +IK  LG+T L  +Q D   GI  ++++  Y KT E+LS AKDKT NV  + K+ V   +   + S   K + +KVGS  S++KD    + YG PP    EY
Sbjct:   21 SDEENARLQVELSQVEEEIRLLQETLVVKQRRLNEIKKALGFTTLSTLQYDLMEGIHKLEDTEAYIKTSELLSKAKDKTVNVAQDAKEKVESTISAIRNSEVVKSLNDKVGSAYSTVKDVIIHSTYGHPPDDGTEY 156          
BLAST of Tpd52 like 1 vs. TrEMBL
Match: A0A4Y2C699 (Tumor protein D52 OS=Araneus ventricosus OX=182803 GN=Tpd52_1 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.742e-18
Identity = 48/115 (41.74%), Postives = 73/115 (63.48%), Query Frame = 2
Query:  137 REKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKD 481
            +E+   +L K ++EI+ LR  LS K++   ++K KLG T+  E + D + GI+NI+ES  Y KT + L +A +KT+  +      VSKKL E K+S A+K +E KVGS  S++KD
Sbjct:   50 QEEWTRELAKTEDEINTLRQVLSSKIRHMQELKRKLGITVWKEFKEDMEQGIRNIQESQAYQKTSQTLKTASEKTTEALGTIGASVSKKLEEVKQSQAFKSLEEKVGSAYSNVKD 164          
BLAST of Tpd52 like 1 vs. TrEMBL
Match: A0A1A8KMW8 (Tumor protein D52-like 1 OS=Nothobranchius kuhntae OX=321403 GN=TPD52L1 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 7.181e-18
Identity = 55/162 (33.95%), Postives = 93/162 (57.41%), Query Frame = 2
Query:   86 DTLLEVSPANNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPIVVNSASQNT 571
            D + EV+  N+   + +RE+++ DL K++EEIS L+  L+ K +Q A++K KLG +   E +++F  G ++++ ST Y KT E LS+A  +TS V       +++K  + + S+++K  E KV S VS++K        GP P    E       N++SQ+T
Sbjct:   21 DLVSEVNLNNSVMTEEEREEIQQDLLKLEEEISTLKQVLASKERQHAELKQKLGISAFSEFRSNFNRGWQDMQSSTAYKKTSETLSTAGQRTSAVFNNLGSAITRKFGDMRNSSSFKSFEEKVESTVSTIKT----KVGGPGPGGSFEDVLSSAANASSQDT 178          
BLAST of Tpd52 like 1 vs. Ensembl Cavefish
Match: tpd52l1 (TPD52 like 1 [Source:NCBI gene;Acc:103022083])

HSP 1 Score: 71.2478 bits (173), Expect = 4.452e-15
Identity = 48/151 (31.79%), Postives = 87/151 (57.62%), Query Frame = 2
Query:  113 NNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPIVVNSASQ 565
            NN+  + ++E++ ++L K++EEI+ LR  LS K ++ +++K +LG T L E++ +   G  +++ ST Y KT E LS+A  KT+         +S+K  + + S ++K  E KV S V+++K      + G        +EE  V++SA+Q
Sbjct:   35 NNTITEEEKEEMHNELTKLEEEITTLRQVLSSKEKRHSELKQRLGITPLSELRHNLSRGWNDMQTSTAYKKTSETLSTAGQKTTAAFSNLGSAISRKFGDMRNSPSFKSFEEKVESTVTNIKSKVGGTSSGGS------FEE--VLSSAAQ 177          
BLAST of Tpd52 like 1 vs. Ensembl Cavefish
Match: tpd52l2b (TPD52 like 2 [Source:NCBI gene;Acc:103029088])

HSP 1 Score: 64.6994 bits (156), Expect = 1.168e-12
Identity = 36/100 (36.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query:  164 KIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSL 463
            K++EEI  LR  L  K +  A++K KLG + L E + +   G ++++ S  Y KT E LS A  KTS         +S+KL + + S  +K  E+KVG++
Sbjct:   57 KVEEEILTLRQVLVAKERHAAELKRKLGLSPLTEFKQNISKGWQDVQTSNAYKKTQETLSQAGQKTSAAFTTMGSAISRKLGDMRNSPTFKSFEDKVGNI 156          
BLAST of Tpd52 like 1 vs. Ensembl Cavefish
Match: tpd52 (tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503-680])

HSP 1 Score: 64.3142 bits (155), Expect = 5.712e-12
Identity = 36/110 (32.73%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  146 LEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSM 475
            L ++L K++EEI  L   L+ K +Q A+IK KLG T L+E++ +     + +  ST Y +T E LS A  K +         +S+KL + + +  +K  E++V S+ + M
Sbjct:  143 LRNELIKVEEEIQTLSQVLASKEKQVAEIKRKLGITPLNELRQNLNKSWQEVTTSTAYRRTSETLSQAGQKATAAFTSVGSAISRKLEDVRNTPTFKSFEDRVESIKTKM 252          
BLAST of Tpd52 like 1 vs. Ensembl Cavefish
Match: tpd52 (tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503-680])

HSP 1 Score: 63.5438 bits (153), Expect = 5.816e-12
Identity = 36/110 (32.73%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  146 LEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSM 475
            L ++L K++EEI  L   L+ K +Q A+IK KLG T L+E++ +     + +  ST Y +T E LS A  K +         +S+KL + + +  +K  E++V S+ + M
Sbjct:   90 LRNELIKVEEEIQTLSQVLASKEKQVAEIKRKLGITPLNELRQNLNKSWQEVTTSTAYRRTSETLSQAGQKATAAFTSVGSAISRKLEDVRNTPTFKSFEDRVESIKTKM 199          
BLAST of Tpd52 like 1 vs. Ensembl Cavefish
Match: tpd52l1 (TPD52 like 1 [Source:NCBI gene;Acc:103022083])

HSP 1 Score: 62.3882 bits (150), Expect = 1.294e-11
Identity = 48/164 (29.27%), Postives = 87/164 (53.05%), Query Frame = 2
Query:  113 NNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHE-------------AKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPIVVNSASQ 565
            NN+  + ++E++ ++L K++EEI+ LR  LS K ++ +++K +LG T L E++ +   G  +++ ST Y KT E LS+A  KT+         +S+K  +              + S ++K  E KV S V+++K      + G        +EE  V++SA+Q
Sbjct:   35 NNTITEEEKEEMHNELTKLEEEITTLRQVLSSKEKRHSELKQRLGITPLSELRHNLSRGWNDMQTSTAYKKTSETLSTAGQKTTAAFSNLGSAISRKFGDMSYSIRHSVSMPTMRNSPSFKSFEEKVESTVTNIKSKVGGTSSGG------SFEE--VLSSAAQ 190          
BLAST of Tpd52 like 1 vs. Ensembl Sea Lamprey
Match: tpd52 (tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503-680])

HSP 1 Score: 77.7962 bits (190), Expect = 6.334e-18
Identity = 43/126 (34.13%), Postives = 73/126 (57.94%), Query Frame = 2
Query:  107 PANNSSA--DIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            P  +SSA  D++ E+L ++L K++EEI+ L+  L+ K    A+IK KLG   + E++ +   G +++  S+ Y KT E L  A  KT+  +     ++S+ L + K S  +K  E +VGS V+ +K
Sbjct:   66 PTLSSSALSDVETEELREELAKVEEEIATLKQVLAAKEHHLAEIKQKLGIGTITELKANLSKGWQDVTSSSAYKKTSETLVHAGQKTTAAISSVGSVLSRTLGDVKNSPTFKSFEERVGSTVTGLK 191          
BLAST of Tpd52 like 1 vs. Ensembl Medaka
Match: tpd52l1 (TPD52 like 1 [Source:NCBI gene;Acc:101159154])

HSP 1 Score: 67.781 bits (164), Expect = 1.076e-13
Identity = 46/140 (32.86%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  158 LKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPI--VVNSASQNT 571
            L K++EEI  L+  LS K +Q+A+++ KLG T L E++ +F     +++ S  + KT E  S+A  KTS         +++KL + + S ++K  E KV S VS++K        GP       +EE +    N++SQ T
Sbjct:   51 LVKLEEEIGTLKQVLSSKEKQQAELRQKLGITPLSELKNNFSRSWHDVQTSVAFKKTSETFSTAGQKTSAAFSTFGSAITRKLGDMRNSPSFKSFEEKVESTVSTIKTK--VGGSGP----GGNFEEVLSSAANASSQET 184          
BLAST of Tpd52 like 1 vs. Ensembl Medaka
Match: tpd52l2b (TPD52 like 2 [Source:NCBI gene;Acc:101168606])

HSP 1 Score: 66.6254 bits (161), Expect = 2.664e-13
Identity = 41/123 (33.33%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  143 KLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTG----------------IKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSL 463
            +L  +L K++EEI+ LR  LS K +  +++K KLG T LDE++ +   G                + +I  S  Y KT E LS A  KTS  +      +S+KL + + S  +K  E++VG+L
Sbjct:   52 ELRSELTKVEEEINTLRQVLSAKERHASELKRKLGLTPLDELRHNLTKGWQDVQTSNAYLTASATLDDIAHSEAYKKTQETLSQAGQKTSAALSTVGTAISRKLGDMRNSPTFKSFEDRVGNL 174          
BLAST of Tpd52 like 1 vs. Ensembl Medaka
Match: tpd52 (tumor protein D52 [Source:NCBI gene;Acc:101168132])

HSP 1 Score: 65.4698 bits (158), Expect = 5.401e-13
Identity = 41/128 (32.03%), Postives = 70/128 (54.69%), Query Frame = 2
Query:   86 DTLLEVSPANNSSADIDREKLE--DDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSL 463
            D +  V P++   A  + E+LE  ++L K++EEI  L   L++K ++ A IK KLG T L+E++ +     + +  ST Y +T E LS A  K +        ++S+K  + K +  +K +E KV +L
Sbjct:   17 DAVTSVGPSSAPPAITEDERLELQEELTKVEEEIQTLSQVLAVKERRLADIKRKLGITPLNELKQNISKTWQEVTTSTAYRRTSETLSQASLKATAAFSNMGSVLSRKFEDVKNAPTFKSLEEKVETL 144          
BLAST of Tpd52 like 1 vs. Ensembl Medaka
Match: tpd52l2b (TPD52 like 2 [Source:NCBI gene;Acc:101168606])

HSP 1 Score: 65.0846 bits (157), Expect = 1.182e-12
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = 2
Query:  146 LEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAK 418
            L  +L K++EEI+ LR  LS K +  +++K KLG T LDE++ +   G ++++ S  Y KT E LS A  KTS  +      +S+KL + +
Sbjct:   53 LRSELTKVEEEINTLRQVLSAKERHASELKRKLGLTPLDELRHNLTKGWQDVQTSNAYKKTQETLSQAGQKTSAALSTVGTAISRKLGDMR 143          
BLAST of Tpd52 like 1 vs. Ensembl Medaka
Match: tpd52l1 (TPD52 like 1 [Source:NCBI gene;Acc:101159154])

HSP 1 Score: 56.9954 bits (136), Expect = 8.332e-10
Identity = 47/156 (30.13%), Postives = 76/156 (48.72%), Query Frame = 2
Query:  158 LKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEA----------KESN------AYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPI--VVNSASQNT 571
            L K++EEI  L+  LS K +Q+A+++ KLG T L E++ +F     +++ S  + KT E  S+A  KTS         +++KL +           + SN      ++K  E KV S VS++K        GP       +EE +    N++SQ T
Sbjct:   44 LVKLEEEIGTLKQVLSSKEKQQAELRQKLGITPLSELKNNFSRSWHDVQTSVAFKKTSETFSTAGQKTSAAFSTFGSAITRKLGDMSMAGLELLFPRRSNSIGNSPSFKSFEEKVESTVSTIKTK--VGGSGP----GGNFEEVLSSAANASSQET 193          
BLAST of Tpd52 like 1 vs. Planmine SMEST
Match: SMESG000013104.1 (SMESG000013104.1)

HSP 1 Score: 338.191 bits (866), Expect = 4.480e-120
Identity = 169/169 (100.00%), Postives = 169/169 (100.00%), Query Frame = 2
Query:   71 MLDSYDTLLEVSPANNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPIVVNSASQNTDK 577
            MLDSYDTLLEVSPANNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPIVVNSASQNTDK
Sbjct:    1 MLDSYDTLLEVSPANNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPISDEEYEEPIVVNSASQNTDK 169          
BLAST of Tpd52 like 1 vs. Planmine SMEST
Match: SMESG000057565.1 (SMESG000057565.1)

HSP 1 Score: 75.485 bits (184), Expect = 8.108e-17
Identity = 43/125 (34.40%), Postives = 73/125 (58.40%), Query Frame = 2
Query:  104 SPANNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            +P+N  S  +D E L + L K +EEI  LR  L++KL+    +K +LG T ++E++ D   G+  IKES T+  T  V+ + KDKTS  +    +  S+K+   + +  +K +E K+G+  +S+K
Sbjct:   29 NPSNEVSESVDEESLREQLSKTEEEIITLRQVLNVKLKLAQDLKRQLGITAINEMKEDIIHGLNTIKESNTFKATSVVMKNVKDKTSITLSSASNKFSQKMGMLRNTTTFKSIEGKMGNAYTSVK 153          
BLAST of Tpd52 like 1 vs. Planmine SMEST
Match: SMESG000057565.1 (SMESG000057565.1)

HSP 1 Score: 75.8702 bits (185), Expect = 8.235e-17
Identity = 43/127 (33.86%), Postives = 74/127 (58.27%), Query Frame = 2
Query:  104 SPANNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDA 484
            +P+N  S  +D E L + L K +EEI  LR  L++KL+    +K +LG T ++E++ D   G+  IKES T+  T  V+ + KDKTS  +    +  S+K+   + +  +K +E K+G+  +S+K +
Sbjct:   29 NPSNEVSESVDEESLREQLSKTEEEIITLRQVLNVKLKLAQDLKRQLGITAINEMKEDIIHGLNTIKESNTFKATSVVMKNVKDKTSITLSSASNKFSQKMGMLRNTTTFKSIEGKMGNAYTSVKHS 155          
BLAST of Tpd52 like 1 vs. Planmine SMEST
Match: SMESG000002442.1 (SMESG000002442.1)

HSP 1 Score: 59.6918 bits (143), Expect = 8.000e-11
Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  134 DREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            D+++L   LK+ + EI  LR  L +K++    ++  +G T +DE++ DF  G+  IK S  +  T  VL +AK KT + +    + +S+K    K++N YK++ +KV ++  S+K
Sbjct:   42 DKKQLILKLKETENEIETLRQVLGVKIRLAHHLRRTIGITPIDELKDDFNYGLNLIKSSDKFKSTTTVLQNAKLKTQSTLNTAGNKISEKWDILKQTNKYKQLTSKVSNVHDSIK 156          
BLAST of Tpd52 like 1 vs. Planmine SMEST
Match: SMESG000002442.1 (SMESG000002442.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.463e-10
Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  134 DREKLEDDLKKIQEEISDLRTTLSLKLQQEAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNVVFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMK 478
            D+++L   LK+ + EI  LR  L +K++    ++  +G T +DE++ DF  G+  IK S  +  T  VL +AK KT + +    + +S+K    K++N YK++ +KV ++  S+K
Sbjct:   42 DKKQLILKLKETENEIETLRQVLGVKIRLAHHLRRTIGITPIDELKDDFNYGLNLIKSSDKFKSTTTVLQNAKLKTQSTLNTAGNKISEKWDILKQTNKYKQLTSKVSNVHDSIK 156          
The following BLAST results are available for this feature:
BLAST of Tpd52 like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPD52L27.577e-1232.35TPD52 like 2 [Source:HGNC Symbol;Acc:HGNC:12007][more]
TPD52L21.206e-1132.35TPD52 like 2 [Source:HGNC Symbol;Acc:HGNC:12007][more]
AC036214.32.199e-1134.82novel protein, TPD52-MRPS28 readthrough[more]
TPD52L19.831e-1132.38TPD52 like 1 [Source:HGNC Symbol;Acc:HGNC:12006][more]
TPD521.797e-1035.29tumor protein D52 [Source:HGNC Symbol;Acc:HGNC:120... [more]
back to top
BLAST of Tpd52 like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F13E6.13.435e-1229.11pep chromosome:WBcel235:X:10675706:10677109:-1 gen... [more]
back to top
BLAST of Tpd52 like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG51743.032e-1833.95gene:FBgn0034345 transcript:FBtr0301149[more]
CG51743.745e-1835.00gene:FBgn0034345 transcript:FBtr0086689[more]
CG51745.045e-1836.84gene:FBgn0034345 transcript:FBtr0086687[more]
CG51741.197e-1331.61gene:FBgn0034345 transcript:FBtr0301148[more]
CG51741.318e-1330.63gene:FBgn0034345 transcript:FBtr0086684[more]
back to top
BLAST of Tpd52 like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpd526.242e-1330.23tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
tpd528.000e-1330.23tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
tpd52l11.090e-1235.51tpd52 like 1 [Source:ZFIN;Acc:ZDB-GENE-050522-121][more]
tpd52l2b2.707e-1235.00tpd52 like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-822... [more]
tpd523.703e-1028.26tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Tpd52 like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tpd521.018e-935.71tumor protein D52 [Source:NCBI gene;Acc:100135218][more]
tpd521.346e-935.71tumor protein D52 [Source:NCBI gene;Acc:100135218][more]
tpd521.496e-935.71tumor protein D52 [Source:NCBI gene;Acc:100135218][more]
back to top
BLAST of Tpd52 like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpd52l23.255e-1233.33tumor protein D52-like 2 [Source:MGI Symbol;Acc:MG... [more]
Tpd52l11.429e-1129.20tumor protein D52-like 1 [Source:MGI Symbol;Acc:MG... [more]
Tpd521.896e-1033.64tumor protein D52 [Source:MGI Symbol;Acc:MGI:10774... [more]
Tpd522.591e-1033.64tumor protein D52 [Source:MGI Symbol;Acc:MGI:10774... [more]
Tpd522.648e-1033.64tumor protein D52 [Source:MGI Symbol;Acc:MGI:10774... [more]
back to top
BLAST of Tpd52 like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55326|YZG1_CAEEL4.370e-1129.11Uncharacterized protein F13E6.1 OS=Caenorhabditis ... [more]
sp|P55327|TPD52_HUMAN8.628e-1035.29Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52... [more]
sp|Q62393|TPD52_MOUSE1.812e-933.64Tumor protein D52 OS=Mus musculus OX=10090 GN=Tpd5... [more]
sp|Q95212|TPD52_RABIT2.441e-934.31Tumor protein D52 OS=Oryctolagus cuniculus OX=9986... [more]
sp|O54818|TPD53_MOUSE2.917e-726.67Tumor protein D53 OS=Mus musculus OX=10090 GN=Tpd5... [more]
back to top
BLAST of Tpd52 like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SJK21.268e-1842.37Tumor protein D54-like protein OS=Leptotrombidium ... [more]
A0A3S3Q2431.832e-1844.07Tumor protein D54-like protein OS=Dinothrombium ti... [more]
A0A3Q0KH094.384e-1836.76Putative tumor protein d52 OS=Schistosoma mansoni ... [more]
A0A4Y2C6996.742e-1841.74Tumor protein D52 OS=Araneus ventricosus OX=182803... [more]
A0A1A8KMW87.181e-1833.95Tumor protein D52-like 1 OS=Nothobranchius kuhntae... [more]
back to top
BLAST of Tpd52 like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpd52l14.452e-1531.79TPD52 like 1 [Source:NCBI gene;Acc:103022083][more]
tpd52l2b1.168e-1236.00TPD52 like 2 [Source:NCBI gene;Acc:103029088][more]
tpd525.712e-1232.73tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
tpd525.816e-1232.73tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
tpd52l11.294e-1129.27TPD52 like 1 [Source:NCBI gene;Acc:103022083][more]
back to top
BLAST of Tpd52 like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpd526.334e-1834.13tumor protein D52 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Tpd52 like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tpd52 like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tpd52 like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpd52l11.076e-1332.86TPD52 like 1 [Source:NCBI gene;Acc:101159154][more]
tpd52l2b2.664e-1333.33TPD52 like 2 [Source:NCBI gene;Acc:101168606][more]
tpd525.401e-1332.03tumor protein D52 [Source:NCBI gene;Acc:101168132][more]
tpd52l2b1.182e-1237.36TPD52 like 2 [Source:NCBI gene;Acc:101168606][more]
tpd52l18.332e-1030.13TPD52 like 1 [Source:NCBI gene;Acc:101159154][more]
back to top
BLAST of Tpd52 like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013104.14.480e-120100.00SMESG000013104.1[more]
SMESG000057565.18.108e-1734.40SMESG000057565.1[more]
SMESG000057565.18.235e-1733.86SMESG000057565.1[more]
SMESG000002442.18.000e-1132.17SMESG000002442.1[more]
SMESG000002442.11.463e-1032.17SMESG000002442.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013503 ID=SMED30013503|Name=Tpd52 like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=656bp
GTTTAATTGTACTACTTGTATTTATTTAAATAATTAATTTTATTATTTTG
AAAAAGTTTTTTATAATCTGATGTTAGATTCTTATGATACACTTCTTGAA
GTATCACCTGCAAACAATAGTTCGGCAGATATCGACAGGGAAAAGTTGGA
AGATGATTTAAAAAAAATTCAAGAAGAAATTTCCGATTTGCGCACTACAC
TGTCTTTAAAATTGCAACAAGAAGCTCAAATAAAAAGTAAACTTGGTTAC
ACTTTACTTGACGAAATTCAAACTGATTTTCAAACTGGTATTAAAAATAT
TAAAGAATCAACTACATATCATAAAACAGTTGAAGTACTTTCATCTGCCA
AAGATAAAACATCCAACGTGGTTTTTGAAACAAAAGACATAGTCAGTAAA
AAATTACACGAAGCCAAAGAATCAAATGCTTATAAAGAAGTTGAAAACAA
AGTTGGTTCATTAGTATCATCAATGAAGGATGCATTCTTTTTCGCTGCAT
ATGGGCCCCCTCCAATCTCGGATGAAGAATATGAAGAACCGATAGTTGTC
AATTCTGCTTCACAGAATACTGATAAATAATATACAAACAGAATTTGAAC
TGATTTACTTTCATGCCACTTCAAAATTTATATGAATAAAGTGTTTCTTA
GTTTGT
back to top

protein sequence of SMED30013503-orf-1

>SMED30013503-orf-1 ID=SMED30013503-orf-1|Name=SMED30013503-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=170bp
MLDSYDTLLEVSPANNSSADIDREKLEDDLKKIQEEISDLRTTLSLKLQQ
EAQIKSKLGYTLLDEIQTDFQTGIKNIKESTTYHKTVEVLSSAKDKTSNV
VFETKDIVSKKLHEAKESNAYKEVENKVGSLVSSMKDAFFFAAYGPPPIS
DEEYEEPIVVNSASQNTDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0048471perinuclear region of cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000208testis
PLANA:0000224cement gland
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR007327TPD52
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0042803protein homodimerization activity
GO:0046982protein heterodimerization activity
Vocabulary: biological process
TermDefinition
GO:0009653anatomical structure morphogenesis
GO:0030183B cell differentiation
GO:0046903secretion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 16..50
IPR007327Tumour protein D52PFAMPF04201TPD52coord: 17..135
e-value: 1.1E-23
score: 83.6
IPR007327Tumour protein D52PANTHERPTHR19307TUMOR PROTEIN D52coord: 14..137