GCR056

Overview
NameGCR056
Smed IDSMED30013501
Length (bp)1340
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR056 (SMED30013501) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR056 (SMED30013501) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR056 (SMED30013501) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR056 (SMED30013501) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013501

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013501SMESG000030128.1 SmedASXL_011974SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013501SMESG000030128.1 dd_Smed_v6_16129_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR056 vs. Ensembl Human
Match: HCRTR1 (hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC:4848])

HSP 1 Score: 64.6994 bits (156), Expect = 1.097e-10
Identity = 82/342 (23.98%), Postives = 150/342 (43.86%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNM-NSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVF-----------------YMYYINNAANPIIYCFMNKNFRED 1211
            L ++     ++  N FI  L+++D +V  + +P ++ ++  +  +    +CK   +L   S+    L ++ IA+DR++ +C+P L   T +R++  +  ++ +S+    + V Q    + S     + N T + S C +  R+A+   P  Y   FF       +++Y   + ++   Y  I+R          +L G     TTS L       R+ KR  SD   D         + L  +P P    +A   + K+  +    KTA ML VV + + + +LP  + V + L     +F                 ++ Y N+AANPIIY F++  FRE 
Sbjct:   69 LAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSL---AIMVPQAAVMECSSVLPELANRTRLFSVCDE--RWADDLYPKIYHSCFF-------IVTYLAPLGLMAMAYFQIFR----------KLWGRQIPGTTSAL------VRNWKR-PSDQLGD-------LEQGLSGEPQP--RARAFLAEVKQ--MRARRKTAKMLMVVLLVFALCYLP--ISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQ 368          
BLAST of GCR056 vs. Ensembl Human
Match: HCRTR1 (hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC:4848])

HSP 1 Score: 64.6994 bits (156), Expect = 1.097e-10
Identity = 82/342 (23.98%), Postives = 150/342 (43.86%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNM-NSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVF-----------------YMYYINNAANPIIYCFMNKNFRED 1211
            L ++     ++  N FI  L+++D +V  + +P ++ ++  +  +    +CK   +L   S+    L ++ IA+DR++ +C+P L   T +R++  +  ++ +S+    + V Q    + S     + N T + S C +  R+A+   P  Y   FF       +++Y   + ++   Y  I+R          +L G     TTS L       R+ KR  SD   D         + L  +P P    +A   + K+  +    KTA ML VV + + + +LP  + V + L     +F                 ++ Y N+AANPIIY F++  FRE 
Sbjct:   69 LAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSL---AIMVPQAAVMECSSVLPELANRTRLFSVCDE--RWADDLYPKIYHSCFF-------IVTYLAPLGLMAMAYFQIFR----------KLWGRQIPGTTSAL------VRNWKR-PSDQLGD-------LEQGLSGEPQP--RARAFLAEVKQ--MRARRKTAKMLMVVLLVFALCYLP--ISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQ 368          
BLAST of GCR056 vs. Ensembl Human
Match: HCRTR2 (hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4849])

HSP 1 Score: 61.6178 bits (148), Expect = 1.384e-9
Identity = 70/337 (20.77%), Postives = 147/337 (43.62%), Query Frame = 3
Query:  255 IYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLM---------------VNSSLALNLPVFYMYYINNAANPIIYCFMNKNFRED 1211
            ++     ++  N FI  L+++D +V +  +P T+ ++  +       +CK   +L   S+    L ++ IA+DR++ +C+P +   T KR++  + I++++S ++ +     ++   V       N T + + C +  R+     P  Y + FF       L++Y   +C+++  Y+ I+R +                 T+S +  K+   + + +            P Q T+  M+         A+  + K+  +    KTA ML +V + + + +LP  ++                 +  A      ++ Y N+AANPIIY F++  FRE+
Sbjct:   79 VWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLA--NKTTLFTVCDE--RWGGEIYPKMYHICFF-------LVTYMAPLCLMVLAYLQIFRKLWCRQI----------PGTSSVVQRKWKPLQPVSQPRG---------PGQPTKSRMS---------AVAAEIKQ--IRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREE 374          
BLAST of GCR056 vs. Ensembl Human
Match: HCRTR2 (hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4849])

HSP 1 Score: 61.6178 bits (148), Expect = 1.384e-9
Identity = 70/337 (20.77%), Postives = 147/337 (43.62%), Query Frame = 3
Query:  255 IYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLM---------------VNSSLALNLPVFYMYYINNAANPIIYCFMNKNFRED 1211
            ++     ++  N FI  L+++D +V +  +P T+ ++  +       +CK   +L   S+    L ++ IA+DR++ +C+P +   T KR++  + I++++S ++ +     ++   V       N T + + C +  R+     P  Y + FF       L++Y   +C+++  Y+ I+R +                 T+S +  K+   + + +            P Q T+  M+         A+  + K+  +    KTA ML +V + + + +LP  ++                 +  A      ++ Y N+AANPIIY F++  FRE+
Sbjct:   79 VWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLA--NKTTLFTVCDE--RWGGEIYPKMYHICFF-------LVTYMAPLCLMVLAYLQIFRKLWCRQI----------PGTSSVVQRKWKPLQPVSQPRG---------PGQPTKSRMS---------AVAAEIKQ--IRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREE 374          
BLAST of GCR056 vs. Ensembl Human
Match: HCRTR1 (hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC:4848])

HSP 1 Score: 57.3806 bits (137), Expect = 2.595e-8
Identity = 79/336 (23.51%), Postives = 147/336 (43.75%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNM-NSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVF-----------------YMYYINNAANPIIYCFMN 1193
            L ++     ++  N FI  L+++D +V  + +P ++ ++  +  +    +CK   +L   S+    L ++ IA+DR++ +C+P L   T +R++  +  ++ +S+    + V Q    + S     + N T + S C +  R+A+   P  Y   FF       +++Y   + ++   Y  I+R          +L G     TTS L       R+ KR  SD   D         + L  +P P    +A   + K+  +    KTA ML VV + + + +LP  + V + L     +F                 ++ Y N+AANPIIY F++
Sbjct:   69 LAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSL---AIMVPQAAVMECSSVLPELANRTRLFSVCDE--RWADDLYPKIYHSCFF-------IVTYLAPLGLMAMAYFQIFR----------KLWGRQIPGTTSAL------VRNWKR-PSDQLGD-------LEQGLSGEPQP--RARAFLAEVKQ--MRARRKTAKMLMVVLLVFALCYLP--ISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLS 362          
BLAST of GCR056 vs. Ensembl Fly
Match: sNPF-R (gene:FBgn0036934 transcript:FBtr0332667)

HSP 1 Score: 53.5286 bits (127), Expect = 2.650e-7
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  246 VLIIYSQKRDKS---TANQFIKTLAISDCIVCLVIIPFT-IYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPF---LSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQS 650
            VL+ Y   R+++     N FI  LA+SD ++C++ +PFT +Y     W     + C    F    SI    L +T IAIDR+F + YPF   + L T     V ++++ L++ V     ++   T ++   +   N TL+++
Sbjct:   82 VLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFGRSL-CHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATV--PYGMYMKMTNELVNGTQTGNETLVEA 220          
BLAST of GCR056 vs. Ensembl Fly
Match: sNPF-R (gene:FBgn0036934 transcript:FBtr0074871)

HSP 1 Score: 53.5286 bits (127), Expect = 2.650e-7
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  246 VLIIYSQKRDKS---TANQFIKTLAISDCIVCLVIIPFT-IYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPF---LSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQS 650
            VL+ Y   R+++     N FI  LA+SD ++C++ +PFT +Y     W     + C    F    SI    L +T IAIDR+F + YPF   + L T     V ++++ L++ V     ++   T ++   +   N TL+++
Sbjct:   82 VLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFGRSL-CHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATV--PYGMYMKMTNELVNGTQTGNETLVEA 220          
BLAST of GCR056 vs. Ensembl Zebrafish
Match: npffr1l2 (neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc:ZDB-GENE-060526-110])

HSP 1 Score: 59.6918 bits (143), Expect = 3.198e-9
Identity = 67/340 (19.71%), Postives = 133/340 (39.12%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKN----STNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLP--ACLMVNSSLALN-----------LP-VFYMYYINNAANPIIYCFMNKNFRED 1211
            LI+   +R ++  N FI  LA+SD +V +  IP T+       W  + + +CK    +   S+      +  IA+DRF C+ YPF   +T+  +KV + ++++++VV+   S   +   +V  +      + N T     C +   +ANP   ++    +     LI                                    +  + ++ +         + S ++  D   P  + +     PG     + +       I  +  K   ML +VA+ + +++LP    +++     LN            P   ++ + N++ NPIIY + N+NF+  
Sbjct:   75 LIVLENRRMRTVTNLFILNLAVSDLLVGVFCIPTTLVDNLITGWPFT-NTVCKMSGLVQGMSVSASVFTLVAIAVDRFRCIVYPFQPKLTLLVAKVTIVMIWVLAVVIMCPSAVTLTVERVEHHYMVRGEDYNHTYPLFSCFE--NWANPQMRKVYTTVLFAHIYLIPL----------------------------------TLITLMYGRIGIKLYTTSVISGNDQHDGGQPHTSPQ----APGGQQEGRPL-------ISQKKIKVIKMLSIVALLFTISWLPLWTLMLLTDYGGLNEDELELLSGYVFPFAHWLAFSNSSVNPIIYGYYNENFKRG 366          
BLAST of GCR056 vs. Ensembl Zebrafish
Match: npffr1l2 (neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc:ZDB-GENE-060526-110])

HSP 1 Score: 59.6918 bits (143), Expect = 3.592e-9
Identity = 67/340 (19.71%), Postives = 133/340 (39.12%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKN----STNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLP--ACLMVNSSLALN-----------LP-VFYMYYINNAANPIIYCFMNKNFRED 1211
            LI+   +R ++  N FI  LA+SD +V +  IP T+       W  + + +CK    +   S+      +  IA+DRF C+ YPF   +T+  +KV + ++++++VV+   S   +   +V  +      + N T     C +   +ANP   ++    +     LI                                    +  + ++ +         + S ++  D   P  + +     PG     + +       I  +  K   ML +VA+ + +++LP    +++     LN            P   ++ + N++ NPIIY + N+NF+  
Sbjct:   71 LIVLENRRMRTVTNLFILNLAVSDLLVGVFCIPTTLVDNLITGWPFT-NTVCKMSGLVQGMSVSASVFTLVAIAVDRFRCIVYPFQPKLTLLVAKVTIVMIWVLAVVIMCPSAVTLTVERVEHHYMVRGEDYNHTYPLFSCFE--NWANPQMRKVYTTVLFAHIYLIPL----------------------------------TLITLMYGRIGIKLYTTSVISGNDQHDGGQPHTSPQ----APGGQQEGRPL-------ISQKKIKVIKMLSIVALLFTISWLPLWTLMLLTDYGGLNEDELELLSGYVFPFAHWLAFSNSSVNPIIYGYYNENFKRG 362          
BLAST of GCR056 vs. Ensembl Zebrafish
Match: CABZ01084347.1 (pyroglutamylated RFamide peptide receptor b [Source:NCBI gene;Acc:101886159])

HSP 1 Score: 51.6026 bits (122), Expect = 1.151e-6
Identity = 31/111 (27.93%), Postives = 62/111 (55.86%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPF--LSLMTVKRSKVCVFIVFLMSVVLG 572
            V ++  ++  ++  N FI +LA+SD ++    IPFT+    +   +   ++CK+  F+  ++I  G L +T IAI+R+  + YP       T KR+   + +V++ +V++G
Sbjct:   68 VYVVVRKRAIRTATNIFICSLAVSDLLITFFCIPFTLLQNISSEWLGGVLVCKTVPFVQTTAIVTGILTMTCIAIERYQGIVYPLKMKRQYTPKRAYRMLGLVWIAAVMVG 178          
BLAST of GCR056 vs. Ensembl Zebrafish
Match: si:dkey-1h24.2 (si:dkey-1h24.2 [Source:ZFIN;Acc:ZDB-GENE-060503-482])

HSP 1 Score: 51.6026 bits (122), Expect = 1.204e-6
Identity = 75/343 (21.87%), Postives = 134/343 (39.07%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANPTKYELL---FFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTS-VPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLP--------ACLMVNSSLAL-NLPVFY---MYYINNAANPIIYCFMNKNFREDVVNFF 1226
            ++++   KR ++  N F+ +LA+SD ++ +  IPF +     +  +    +CK+  +    S+      +  IAI+R+  +C P  S     RS     I     + + ++  + V +  V  N TN  +  +      +S+    T Y LL    F I     +I+Y                 +++    +     L     TS + N      S     SD      S  P       +T  GP   D+  +    E  LI   +   ML ++   + V ++P        A   +++  AL   P+ +   + Y +   NPIIYCFMN  FR+ ++  F
Sbjct:   78 IVVLIVNKRMRTVTNSFLLSLAVSDLMMAIFCIPFNLIPSLLEDFIFGAAMCKTVAYFMGISVSISTFSLVAIAIERYSAICNPLKSRAWQTRSHAYKVIAATWVLSVAIMVPYPVFSILVPFNKTNNITAHMCRLEWPISQVEQ-TWYVLLLSILFFIPGVVMIIAYG----------------LISRELYRGIQFELEQKKDTSGVKNGLNGGLSSCHDESDGCYIQVSKKPPAMELSTLTTSGPVKTDRP-RSNTSEAKLIAKKRVIRMLIIIVAMFFVCWMPLYSANTWKAFDQISAQRALSGAPISFIQLLSYTSACVNPIIYCFMNTRFRKALLATF 402          
BLAST of GCR056 vs. Ensembl Zebrafish
Match: CU915819.2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 51.2174 bits (121), Expect = 1.676e-6
Identity = 30/105 (28.57%), Postives = 52/105 (49.52%), Query Frame = 3
Query:  252 IIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSV 563
            I+   K  ++  N FI  LAISD +V +  +P T+       W     M+CK    +   S+      +  IA+DRF C+ YPF   +T+  +   + I+++++V
Sbjct:   70 IVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFG-SMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTATFIIVIIWVLAV 173          
BLAST of GCR056 vs. Ensembl Xenopus
Match: HCRTR2 (hypocretin (orexin) receptor 2 [Source:NCBI gene;Acc:100495420])

HSP 1 Score: 54.6842 bits (130), Expect = 1.655e-7
Identity = 24/105 (22.86%), Postives = 58/105 (55.24%), Query Frame = 3
Query:  255 IYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL 569
            ++     ++  N FI  L+++D +V ++ +P T+ ++  +       +CK   +L   S+    L ++ IA+DR++ +C+P +   T KR++  + I++++S  +
Sbjct:   77 VWKNHHMRTVTNYFIVNLSLADVLVTIICLPATLLVDITETWFFGKTLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRAQQSIVIIWIVSCAI 181          
BLAST of GCR056 vs. Ensembl Xenopus
Match: HCRTR2 (hypocretin (orexin) receptor 2 [Source:NCBI gene;Acc:100495420])

HSP 1 Score: 54.299 bits (129), Expect = 2.712e-7
Identity = 24/105 (22.86%), Postives = 58/105 (55.24%), Query Frame = 3
Query:  255 IYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL 569
            ++     ++  N FI  L+++D +V ++ +P T+ ++  +       +CK   +L   S+    L ++ IA+DR++ +C+P +   T KR++  + I++++S  +
Sbjct:   77 VWKNHHMRTVTNYFIVNLSLADVLVTIICLPATLLVDITETWFFGKTLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRAQQSIVIIWIVSCAI 181          
BLAST of GCR056 vs. Ensembl Xenopus
Match: tcf12 (transcription factor 12 (HTF4, helix-loop-helix transcription factors 4) [Source:Xenbase;Acc:XB-GENE-5799694])

HSP 1 Score: 50.8322 bits (120), Expect = 3.033e-6
Identity = 72/345 (20.87%), Postives = 136/345 (39.42%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTF-----KVSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALN----------LPVFYMY---YINNAANPIIYCFMNKNFREDVVNFF 1226
            + ++   KR ++  N F+ +LA+SD ++CL  +PFT+        +    +CK+  +    S+      +  I+++R+  +C P  S +   +S     I     +   ++S + + +      K+   + NM   L  S+    S Y        L   IV     I+Y     ++        +F ++  + K  L G  S S+  F        +SIK+      +  +S      E + +    +N             L+   +   ML V+ I + + + P     N+  A +          +P+ +++   Y +   NPIIYCFMNK FR   +  F
Sbjct:   53 IAVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFTLIPNLLRDFIFGSAVCKAATYFMGISVSVSTFNLVAISLERYSAICKPLQSRVWQTKSHALKVIAATWCLSFAIMSPYPIYSTLVPLNKIQNRTANMCRLLWPSDLTQQSWYVFLLLILFLVPGIV---MTIAYG----LISMELYRGIKFEMSQRKGKINLSGGGSISSNQFKNGDGCYLQSIKKRKKLEMHQLSSHHSAKIERVRSNSSAAN-------------LMAKKRVIRMLIVIVILFFICWTPV-FSANAWRAFDTDSADISLSGVPISFIHLLSYTSACVNPIIYCFMNKRFRMGFLATF 376          
BLAST of GCR056 vs. Ensembl Xenopus
Match: taf1b (TATA-box binding protein associated factor, RNA polymerase I, B [Source:Xenbase;Acc:XB-GENE-992275])

HSP 1 Score: 50.447 bits (119), Expect = 3.235e-6
Identity = 41/159 (25.79%), Postives = 79/159 (49.69%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFT-IYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGV------------LSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANP 683
            + +I   K  ++  N FI  LAI+D +V    +PFT +Y   ++WK    ++C  + +    S+    L + +IA+DR++C+ +   S ++   S + + I ++ + +L +            L  F +K    ++N TN +ST I S  + + +YA P
Sbjct:   61 IYMIVKYKNMRTVTNFFIANLAIADLMVDSFCLPFTLVYTLMDEWKFG-SVLCHLFPYAQAMSVNVSTLTLIVIALDRYWCIVFHLNSRISKNLSFLIISITWITAAILAIPLAVFREFRYEDLPPFNLKIAVCAENWTNRDST-IYSLSMLILQYALP 217          
BLAST of GCR056 vs. Ensembl Xenopus
Match: ENSXETT00000027496.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:146231200:146233060:1 gene:ENSXETG00000012873.1 transcript:ENSXETT00000027496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 3.847e-6
Identity = 39/132 (29.55%), Postives = 73/132 (55.30%), Query Frame = 3
Query:  171 LTNQIPTTXXXXXXXXXXXXXXXXXVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWK----VSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFL 554
            +T  IP TI +LI++ V      + +LII   K  ++T N ++ ++A+SD I+ L+ +PF +Y     WK    +    +C+  +F++        L IT ++I+R+  +C+P  S + + +++V   IVFL
Sbjct:   32 ITTLIPVTIVLLIVMVVGVIGNTITILIIRRYKEMRTTTNFYLSSMAMSDLII-LLSLPFDLY---RLWKSMPWIFGGFLCRFLHFISEGCTYSTILHITALSIERYLAICFPLKSKVLITKTRVKCVIVFL 159          
BLAST of GCR056 vs. Ensembl Mouse
Match: Npffr2 (neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:MGI:1860130])

HSP 1 Score: 54.299 bits (129), Expect = 1.719e-7
Identity = 40/136 (29.41%), Postives = 66/136 (48.53%), Query Frame = 3
Query:  252 IIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLG-----VLSVFQVKTFKVSKNSTNMNSTL 641
            I+   +   +  N FI  LAISD +V +  +P T+       W     M CK    +   S+      +  IA+DRF CV YPF   +TVK + V + I++ +++ +      +L V + K ++V  +S N  ST+
Sbjct:   69 IVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSM-CKISGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAIMLHVQEEKYYRVRLSSHNKTSTV 203          
BLAST of GCR056 vs. Ensembl Mouse
Match: Hcrtr2 (hypocretin (orexin) receptor 2 [Source:MGI Symbol;Acc:MGI:2680765])

HSP 1 Score: 53.9138 bits (128), Expect = 2.768e-7
Identity = 23/105 (21.90%), Postives = 58/105 (55.24%), Query Frame = 3
Query:  255 IYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL 569
            ++     ++  N FI  L+++D +V +  +P T+ ++  +       +CK   +L   S+    L ++ IA+DR++ +C+P +   T KR++  + +++++S ++
Sbjct:   79 VWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVSCII 183          
BLAST of GCR056 vs. Ensembl Mouse
Match: Hcrtr2 (hypocretin (orexin) receptor 2 [Source:MGI Symbol;Acc:MGI:2680765])

HSP 1 Score: 53.5286 bits (127), Expect = 2.810e-7
Identity = 23/105 (21.90%), Postives = 58/105 (55.24%), Query Frame = 3
Query:  255 IYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL 569
            ++     ++  N FI  L+++D +V +  +P T+ ++  +       +CK   +L   S+    L ++ IA+DR++ +C+P +   T KR++  + +++++S ++
Sbjct:   79 VWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVSCII 183          
BLAST of GCR056 vs. Ensembl Mouse
Match: Hcrtr1 (hypocretin (orexin) receptor 1 [Source:MGI Symbol;Acc:MGI:2385650])

HSP 1 Score: 52.7582 bits (125), Expect = 4.813e-7
Identity = 24/109 (22.02%), Postives = 59/109 (54.13%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGV 575
            L ++     ++  N FI  L+++D +V  + +P ++ ++  +  +    +CK   +L   S+    L ++ IA+DR++ +C+P L   T +R++  +  ++ +S+ + V
Sbjct:   69 LAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMV 177          
BLAST of GCR056 vs. Ensembl Mouse
Match: Hcrtr1 (hypocretin (orexin) receptor 1 [Source:MGI Symbol;Acc:MGI:2385650])

HSP 1 Score: 52.7582 bits (125), Expect = 4.813e-7
Identity = 24/109 (22.02%), Postives = 59/109 (54.13%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGV 575
            L ++     ++  N FI  L+++D +V  + +P ++ ++  +  +    +CK   +L   S+    L ++ IA+DR++ +C+P L   T +R++  +  ++ +S+ + V
Sbjct:   69 LAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMV 177          
BLAST of GCR056 vs. UniProt/SwissProt
Match: sp|O43613|OX1R_HUMAN (Orexin receptor type 1 OS=Homo sapiens OX=9606 GN=HCRTR1 PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 5.268e-10
Identity = 82/342 (23.98%), Postives = 150/342 (43.86%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNM-NSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVF-----------------YMYYINNAANPIIYCFMNKNFRED 1211
            L ++     ++  N FI  L+++D +V  + +P ++ ++  +  +    +CK   +L   S+    L ++ IA+DR++ +C+P L   T +R++  +  ++ +S+    + V Q    + S     + N T + S C +  R+A+   P  Y   FF       +++Y   + ++   Y  I+R          +L G     TTS L       R+ KR  SD   D         + L  +P P    +A   + K+  +    KTA ML VV + + + +LP  + V + L     +F                 ++ Y N+AANPIIY F++  FRE 
Sbjct:   69 LAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSL---AIMVPQAAVMECSSVLPELANRTRLFSVCDE--RWADDLYPKIYHSCFF-------IVTYLAPLGLMAMAYFQIFR----------KLWGRQIPGTTSAL------VRNWKR-PSDQLGD-------LEQGLSGEPQP--RARAFLAEVKQ--MRARRKTAKMLMVVLLVFALCYLP--ISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQ 368          
BLAST of GCR056 vs. UniProt/SwissProt
Match: sp|P56718|OX1R_RAT (Orexin receptor type 1 OS=Rattus norvegicus OX=10116 GN=Hcrtr1 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 9.643e-10
Identity = 82/342 (23.98%), Postives = 149/342 (43.57%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNM-NSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVF-----------------YMYYINNAANPIIYCFMNKNFRED 1211
            L ++     ++  N FI  L+++D +V  + +P ++ ++  +  +    +CK   +L   S+    L ++ IA+DR++ +C+P L   T +R++  +  ++  +V L V+ V Q    + S     + N T + S C +  R+A+   P  Y   FF        ++Y   + ++   Y  I+R          +L G     TTS L       R+ KR +               + L T+P P    +A   + K+  +    KTA ML VV + + + +LP  + V + L     +F                 ++ Y N+AANPIIY F++  FRE 
Sbjct:   69 LAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIW--AVSLAVM-VPQAAVMECSSVLPELANRTRLFSVCDE--RWADELYPKIYHSCFF-------FVTYLAPLGLMGMAYFQIFR----------KLWGPQIPGTTSAL------VRNWKRPSEQLEAQH--------QGLCTEPQP--RARAFLAEVKQ--MRARRKTAKMLMVVLLVFALCYLP--ISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQ 368          
BLAST of GCR056 vs. UniProt/SwissProt
Match: sp|Q0GBZ5|OX1R_BOVIN (Orexin receptor type 1 OS=Bos taurus OX=9913 GN=HCRTR1 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.035e-9
Identity = 81/342 (23.68%), Postives = 149/342 (43.57%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNM-NSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVF-----------------YMYYINNAANPIIYCFMNKNFRED 1211
            L ++     ++  N FI  L+++D +V  + +P ++ ++  +  +    +CK   +L   S+    L ++ IA+DR++ +C+P L   T +R++  +  ++  +V L V+ V Q    + S     + N T + S C +  R+A+   P  Y   FF       +++Y   + ++   Y  I+R          +L G     TTS L       R+ KR +               + L  +P P    +A   + K+  +    KTA ML VV + + + +LP  + V + L     +F                 ++ Y N+AANPIIY F++  FRE 
Sbjct:   69 LAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIW--AVSLAVM-VPQAAVMECSSVLPELANRTRLFSVCDE--RWADDLYPKIYHSCFF-------IVTYLAPLGLMAMAYFQIFR----------KLWGRQIPGTTSAL------VRNWKRPSVQLEEQG--------QGLGAEPQP--RARAFLAEVKQ--MRARRKTAKMLMVVLLVFALCYLP--ISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQ 368          
BLAST of GCR056 vs. UniProt/SwissProt
Match: sp|O43614|OX2R_HUMAN (Orexin receptor type 2 OS=Homo sapiens OX=9606 GN=HCRTR2 PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 6.648e-9
Identity = 70/337 (20.77%), Postives = 147/337 (43.62%), Query Frame = 3
Query:  255 IYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLM---------------VNSSLALNLPVFYMYYINNAANPIIYCFMNKNFRED 1211
            ++     ++  N FI  L+++D +V +  +P T+ ++  +       +CK   +L   S+    L ++ IA+DR++ +C+P +   T KR++  + I++++S ++ +     ++   V       N T + + C +  R+     P  Y + FF       L++Y   +C+++  Y+ I+R +                 T+S +  K+   + + +            P Q T+  M+         A+  + K+  +    KTA ML +V + + + +LP  ++                 +  A      ++ Y N+AANPIIY F++  FRE+
Sbjct:   79 VWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLA--NKTTLFTVCDE--RWGGEIYPKMYHICFF-------LVTYMAPLCLMVLAYLQIFRKLWCRQI----------PGTSSVVQRKWKPLQPVSQPRG---------PGQPTKSRMS---------AVAAEIKQ--IRARRKTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREE 374          
BLAST of GCR056 vs. UniProt/SwissProt
Match: sp|P56719|OX2R_RAT (Orexin receptor type 2 OS=Rattus norvegicus OX=10116 GN=Hcrtr2 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.081e-8
Identity = 67/337 (19.88%), Postives = 143/337 (42.43%), Query Frame = 3
Query:  255 IYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYAN---PTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLM---------------VNSSLALNLPVFYMYYINNAANPIIYCFMNKNFRED 1211
            ++     ++  N FI  L+++D +V +  +P T+ ++  +       +CK   +L   S+    L ++ IA+DR++ +C+P +   T KR++  + +++++S ++ +     ++  + S      N T + + C +  R+     P  Y + FF       L++Y   +C+++  Y+ I+R +                 T+S +  K+ + + + +           +     E            K I+ + K         TA ML VV + + + +LP  ++                 +  A      ++ Y N+AANPIIY F++  FRE+
Sbjct:   79 VWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVSCIIMIPQAIVME--RSSMLPGLANKTTLFTVCDE--RWGGEVYPKMYHICFF-------LVTYMAPLCLMVLAYLQIFRKLWCRQI----------PGTSSVVQRKWKQPQPVSQPRGSGQQSKARISAVAAE-----------IKQIRARRK---------TARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREE 374          
BLAST of GCR056 vs. TrEMBL
Match: A0A193KUN5 (GCR056 OS=Schmidtea mediterranea OX=79327 GN=gcr056 PE=2 SV=1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 364/366 (99.45%), Postives = 366/366 (100.00%), Query Frame = 3
Query:  150 MSTMTKELTNQIPTTXXXXXXXXXXXXXXXXXVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFFHQHLIKK 1247
            MSTMTKELTNQIPTTIGILIIISVIGSIGNLLVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVF+MSVVLGVLSVFQVKTFK+SKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFFHQHLIKK
Sbjct:    1 MSTMTKELTNQIPTTIGILIIISVIGSIGNLLVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFMMSVVLGVLSVFQVKTFKLSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFFHQHLIKK 366          
BLAST of GCR056 vs. TrEMBL
Match: A0A193KUG2 (GCR036 OS=Schmidtea mediterranea OX=79327 GN=gcr036 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 8.675e-76
Identity = 172/366 (46.99%), Postives = 234/366 (63.93%), Query Frame = 3
Query:  150 MSTMTKELTNQIPTTXXXXXXXXXXXXXXXXXVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTT-----------EELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDV 1214
            M+ MT++  +Q+  T+ +L +I VIGS+GN LV+I+Y++K D+ T   FI  LAI+DC  C+ IIP TIYIE+ +W +S   +CK YYF NN +IPF A LI+LIAIDR+ C+C+PF   MT+ +SKV V +V  +SV+LG+ S FQVK  K    +   NS     EC D+S+  N T  E LFF+IVQ+ QL+SY  CI +VICLY+ IY  VL   RKK+ LKG+ +    S+LW    +SRS      D + +   +P   T           +  +T P P +   ++ R   +T + QNF+TA ML VVA+ YI++FLPA LM+N    L +P+FYMYYINNAANPIIYCFMN  FRED+
Sbjct:   12 MTLMTQD-GSQVAATLIMLSVICVIGSLGNGLVIIVYTRKHDQLTTTLFINILAITDCFTCITIIPMTIYIEYWEWGISSAFLCKLYYFFNNCTIPFSAFLISLIAIDRYICICHPFNKFMTLFKSKVSVGLVLTVSVLLGIASTFQVKMIKGIHPNDLTNS----YECADISKLTNTTTTEKLFFSIVQKIQLLSYTTCIILVICLYVAIYCKVLQTRRKKSILKGIKNVKKPSYLW----ESRSNLTNVPDLDENPIKLPDGDTMLSSAKSTPNSKSFLTVPKPEHRRVSL-RSICDTQIFQNFRTAAMLSVVALMYIISFLPAFLMINYPQILYIPLFYMYYINNAANPIIYCFMNARFREDI 367          
BLAST of GCR056 vs. TrEMBL
Match: A0A193KUC3 (GCR110 OS=Schmidtea mediterranea OX=79327 GN=gcr110 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 7.121e-67
Identity = 173/394 (43.91%), Postives = 249/394 (63.20%), Query Frame = 3
Query:  174 TNQIPTTXXXXXXXXXXXXXXXXXVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMN--STLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLN------------------------SSSTTSFLWNKFFKS------RSIKRI-NSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIK--RKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNF-FHQHLIKK 1247
            T QIP T+ +L IISV+G IGNL V++IY ++ DK T+N F+  LA SD   C+ IIP TI+IEF++W +    +CKSY F NNS IPF ALLI+LIA+DR+FC+C+PFL +M + RSK+ + I  ++S +LG L+ FQV    + K  TN++    +  S C++ S +AN +  + LF+ I Q+SQL+SY+ICI +VI LY  IY  V+   RKK +LKG+N                         +S  S ++++F  S      R++K + N  +N+  ++ P  ++   +     +++   IK  +  ++T L+QN K A MLFVV ITYIVTFLPA LM N  + LNLPVFY+YY+NNAANPIIYCFMN+NFR  + +F F + +I+K
Sbjct:    4 TQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDIFTCIFIIPTTIFIEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQV---HIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGNPSTNHHHSNSPTNSSMNSLNNSVNNSSSIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK 394          
BLAST of GCR056 vs. TrEMBL
Match: A0A5J4NU14 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0011673 PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.916e-39
Identity = 88/197 (44.67%), Postives = 137/197 (69.54%), Query Frame = 3
Query:  150 MSTMTKELTNQIPTTXXXXXXXXXXXXXXXXXVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISY 740
            MS MT +L+NQIPT + +L++IS++G +GN+LV+I+Y  K DK TAN FI  LA+SD + C  ++P TI IE+ +W++   + CK YY LNN+ IPF +LLI+ IA DR+FC+C+PFL +MT+ R++  +F++  +S  +G  S+F V   ++ KN T+ N+T    EC + ++  N T  E + + IVQ+SQL+S+
Sbjct:    1 MSFMTADLSNQIPTVMAMLMVISIVGIVGNVLVIIVYMLKHDKLTANLFILVLAVSDLLSCSTLVPATICIEYIEWRMQSVVFCKVYYLLNNTFIPFSSLLISCIAFDRYFCLCHPFLRIMTLSRARRVIFVLISVSFTIGCSSMFLV---RLEKNDTSGNTTEKIYECTETTK-VNHTTLENMVYQIVQKSQLVSH 193          
BLAST of GCR056 vs. TrEMBL
Match: A0A193KU98 (GCR075 OS=Schmidtea mediterranea OX=79327 GN=gcr075 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 6.369e-39
Identity = 128/376 (34.04%), Postives = 209/376 (55.59%), Query Frame = 3
Query:  159 MTKELTNQIPTTXXXXXXXXXXXXXXXXXVLIIYS-QKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMN-STLIQSECIDVSRYANPT--KYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSR-------SIKRINSDSNNDDTSVP--------CQTTEELMTKPGPSNND-----KAIKRKF-KETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFRED 1211
            M+  + +QIP  +  + + S IG +GN +V++IY  Q+ +  T + FI  LA+ D   CL +IPFT+  EF  W +    +C  YY LN  ++PF +LL + +AIDR+  +C+PF  + TV R+K+ +  + L S+ L + +  Q     +++ ++N++     + +C D S+    T     L  F I+ +     Y  CI VVI LYILIYR ++    +K +L+G   + +   + + F   R       +I  +  + N +   +P        C +     ++    N++     ++I +   K++ L+QN ++A+MLFVVAI YI +F+PA LM N  ++LNL VFY+YY+NNAANPIIYCFMN+ FR D
Sbjct:    1 MSPSIEHQIPIAMITMCVNSFIGCVGNGIVILIYCVQRNENCTVSLFIFVLAVIDFSTCLCVIPFTVVNEFLLWYIGSPALCFIYYVLNTFNVPFSSLLTSCVAIDRYCSICHPFHQIFTVHRAKILIISLGLFSLFLAITTT-QFAFLSMAELASNISQGNKSEYKCTDPSQLTFHTVKSAHLKMFYILLKINHSCYVFCIIVVILLYILIYRAIILLRYRKRQLQGRIDAKSHE-MMSSFMAIRKSEVAIPNISLVGLNPNENYLKIPQIKSGSFACYSRSSCCSRNFSVNDNFQTQIRSISKSLIKDSDLLQNIRSAIMLFVVAIVYITSFIPALLMANKMISLNLAVFYLYYVNNAANPIIYCFMNQQFRAD 374          
BLAST of GCR056 vs. Ensembl Cavefish
Match: si:dkey-1h24.2 (cholecystokinin receptor-like [Source:NCBI gene;Acc:103032976])

HSP 1 Score: 56.9954 bits (136), Expect = 1.721e-8
Identity = 75/343 (21.87%), Postives = 147/343 (42.86%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANP-TKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTE-EL--MTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLP--------ACLMVNSSLAL-NLPVFY---MYYINNAANPIIYCFMNKNFREDVVNFF 1226
            ++++   KR ++  N F+ +LA+SD ++ +  +PFT+     +  +   ++CK+  +    S+      +  IAI+R+  +C P  S     RS     I     + + ++  + V +  VS N  N N+T       ++ R   P ++Y+  +  ++     I   +       +   +YR +            L     +S L N    + +I   + D +     VP +T   EL  ++   PS  D+  +    E  L+   +   ML ++ + + V ++P        A   +++  AL   P+ +   + Y +   NPIIYCFMNK FR+ ++  F
Sbjct:   32 IVVLIVNKRMRTVTNSFLLSLAVSDLMMAVFCMPFTLIPNLLEDFIFGAVMCKTVTYFMGISVSISTFSLVAIAIERYSAICNPLTSRAWQTRSHAYKVIAGTWVLSVAIMIPYPVFSTLVSFNKPN-NTT------ANMCRLDWPVSQYQFWYVLLLLILFFIPGGVMSIAYGLISRELYRGIQFE---------LEQKKDSSALSNGM--NGTISHGHDDGDGCYIQVPKKTPAMELCTLSTSAPSKTDRP-RSNTSEAKLLAKKRVIRMLIIIVVMFFVCWMPLYAANTWKAFDQLSAKRALSGAPISFIQLLSYTSACVNPIIYCFMNKRFRKALLATF 355          
BLAST of GCR056 vs. Ensembl Cavefish
Match: npffr1l2 (neuropeptide FF receptor 1-like [Source:NCBI gene;Acc:103036969])

HSP 1 Score: 57.3806 bits (137), Expect = 1.837e-8
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL-----GVLSVFQVKTFKVSKN 617
            LI+   +R ++  N FI  LA+SD +V +  IP T+       W  + + +CK    +   S+      +  IA+DRF C+ YPF   +T+  +KV + +++++++V+       L+V QV+   +  N
Sbjct:   89 LIVLENRRMRTVTNLFILNLAVSDLLVGVFCIPTTLVDNLITGWPFT-NTVCKMSGLVQGMSVSASVFTLVAIAVDRFRCIVYPFQPKLTLLVAKVTIAMIWVLALVIMCPSAATLTVTQVEHHYMVHN 216          
BLAST of GCR056 vs. Ensembl Cavefish
Match: npffr1l3 (neuropeptide FF receptor 1-like [Source:NCBI gene;Acc:111195007])

HSP 1 Score: 54.6842 bits (130), Expect = 1.136e-7
Identity = 32/108 (29.63%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL 569
            LI+   +   +  N FI  L+ISD +V +  IP T+       W  S D++CK    +  +S+      +  IA+DRF C+ YPF   +T+  +K  + +++L+++V+
Sbjct:   81 LIVLRNRHMWTVTNAFILNLSISDLLVGIFCIPTTLVDNLITGWPFS-DVMCKLSGLVQGTSVCASVFTLVAIAVDRFRCIVYPFKPKLTLLVAKATIGLIWLLALVI 187          
BLAST of GCR056 vs. Ensembl Cavefish
Match: si:dkey-1h24.2 (cholecystokinin receptor-like [Source:NCBI gene;Acc:103032976])

HSP 1 Score: 52.7582 bits (125), Expect = 4.016e-7
Identity = 73/342 (21.35%), Postives = 146/342 (42.69%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTE-EL--MTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLP--------ACLMVNSSLAL-NLPVFY---MYYINNAANPIIYCFMNKNFREDVVNFF 1226
            ++++   KR ++  N F+ +LA+SD ++ +  +PFT+     +  +   ++CK+  +    S+      +  IAI+R+  +C P  S     RS     I     + + ++  + V +  VS N  N N+T       ++ R   P          V++   +   + +  +    + I   +++    +     L     +S L N    + +I   + D +     VP +T   EL  ++   PS  D+  +    E  L+   +   ML ++ + + V ++P        A   +++  AL   P+ +   + Y +   NPIIYCFMNK FR+ ++  F
Sbjct:   89 IVVLIVNKRMRTVTNSFLLSLAVSDLMMAVFCMPFTLIPNLLEDFIFGAVMCKTVTYFMGISVSISTFSLVAIAIERYSAICNPLTSRAWQTRSHAYKVIAGTWVLSVAIMIPYPVFSTLVSFNKPN-NTT------ANMCRLDWPVSQ-------VEQIWYVLLLLILFFIPGGVMSIAYGLISRELYRGIQFELEQKKDSSALSNGM--NGTISHGHDDGDGCYIQVPKKTPAMELCTLSTSAPSKTDRP-RSNTSEAKLLAKKRVIRMLIIIVVMFFVCWMPLYAANTWKAFDQLSAKRALSGAPISFIQLLSYTSACVNPIIYCFMNKRFRKALLATF 413          
BLAST of GCR056 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 52.7582 bits (125), Expect = 4.985e-7
Identity = 30/105 (28.57%), Postives = 54/105 (51.43%), Query Frame = 3
Query:  252 IIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSV 563
            I+   K  ++  N FI  LAISD +V +  +P T+       W     ++CK    +   S+      + +IA+DRF C+ YPF   +T+  S V + I++++++
Sbjct:   78 IVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFG-SLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIVYPFKQKLTISTSTVIIVIIWVLAI 181          
BLAST of GCR056 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010661.1 (pep scaffold:Pmarinus_7.0:GL479584:296:6514:-1 gene:ENSPMAG00000009652.1 transcript:ENSPMAT00000010661.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 3.532e-8
Identity = 34/142 (23.94%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTI-YIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVS 668
            V ++   +R ++  + F+  LA++D  + L  +PFT   +    W     ++C    F    S+      +T I IDR++ VC+P  S MT  R KV + +++ +S+ + +       T  V+     +   L + +C++V 
Sbjct:   21 VWVLALGRRARTDISAFLINLALADLTMALFCLPFTFTEVLLQSWLFG-ALLCPLVRFAQTLSVSVSIYTLTTIGIDRYYAVCHPLHSRMTKSRGKVLIALIWAVSISISL----STTTLAVATRGPMLQ--LGKGKCLEVG 155          
BLAST of GCR056 vs. Ensembl Sea Lamprey
Match: ntsr1 (neurotensin receptor 1 (high affinity) [Source:ZFIN;Acc:ZDB-GENE-090313-372])

HSP 1 Score: 50.447 bits (119), Expect = 3.117e-7
Identity = 31/110 (28.18%), Postives = 59/110 (53.64%), Query Frame = 3
Query:  261 SQKRDKSTANQFIKTLAISDCIVCLVIIPFTIY--IEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTV---KRSKVCVFIVFLMSVVLGV 575
            ++     TA+  + ++A SD +  ++ +P  +Y  I  +D     D+ C+ YY+L +S      L IT ++++R+  VC+P L  MTV   +R++  V  V+  S +L +
Sbjct:   75 ARHLQHGTAHYHLVSMAASDLLTLMLGLPVELYNFIWVHDQWAFGDLGCRGYYYLRDSCTYATVLNITSLSVERYLAVCHP-LRAMTVASPRRTRRLVAAVWFTSFLLAL 183          
BLAST of GCR056 vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 49.2914 bits (116), Expect = 8.671e-7
Identity = 32/143 (22.38%), Postives = 67/143 (46.85%), Query Frame = 3
Query:  252 IIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKN-----STNMNSTLIQSECID 662
            ++   +R ++  N FI  LA+SD +V +  +P T+       W   + ++CK    +  +S+      +  IA+DRF C+ YPF   + +  +   + +++ +++ +   S   + T +VS+      S   N T    +C +
Sbjct:   73 VVLQSRRMRTVTNLFILNLAVSDLLVGIFCMPITLVDNLITGWPFGV-VVCKMSGLVQGTSVSASVFTLVAIAVDRFRCIVYPFKRKLRISHALFTILVIWALALSIMCPSALML-TAEVSRGHYMVYSDGSNDTHPLHQCWE 213          
BLAST of GCR056 vs. Ensembl Sea Lamprey
Match: mlnr (motilin receptor [Source:ZFIN;Acc:ZDB-GENE-130530-1015])

HSP 1 Score: 47.7506 bits (112), Expect = 2.792e-6
Identity = 28/124 (22.58%), Postives = 67/124 (54.03%), Query Frame = 3
Query:  255 IYSQKRD-KSTANQFIKTLAISDCIVCLVIIPFTIY--IEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLG----VLSVFQVKTFK 605
            ++S+  + ++T   ++ ++A+SD ++    +PF +Y    +  W    D +C+ + +++ S      L IT ++++R+  +C+P  + + + R +V   I+ L ++ LG    V+S+  V+  K
Sbjct:   67 VFSRTHEMRTTTYLYLSSMAVSDLLI-FSCMPFDLYRLWRYRPWLFG-DFLCRCFQYVSESCTYATILHITALSVERYLAICFPLWAKVAITRRRVRALILGLWALALGSAGPVISIVSVQVEK 188          
BLAST of GCR056 vs. Ensembl Sea Lamprey
Match: si:dkey-202l22.3 (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 46.595 bits (109), Expect = 7.586e-6
Identity = 28/94 (29.79%), Postives = 46/94 (48.94%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFN--DWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVK 521
            +L+I   KR  +  N  +  LA+SD +VCL  +P +    F    W V   ++C     L  +++    L +T IA+DR+  V YP    + V+
Sbjct:   89 ILVIARTKRLHNATNFLLGNLALSDLLVCLTCVPISAAFAFEPRGW-VYGALLCYLVALLQPATVHVSVLSLTAIALDRYVVVAYPIRRRVAVR 181          
BLAST of GCR056 vs. Ensembl Nematostella
Match: EDO50021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF31])

HSP 1 Score: 56.225 bits (134), Expect = 7.336e-9
Identity = 36/141 (25.53%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFT-IYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDV 665
            V++   ++R ++  NQFI  LA++D  VC++ IP + +Y     W      +CK+  +L   ++      +  IA DRF  + +P      + R+ + V  ++L+S  +     F V  +  S+ +  M   L  + CI+V
Sbjct:   17 VMLATRKRRMRNVTNQFIANLALADFTVCVITIPISLVYTNLGHWPFR-SWLCKTMPYLQGITVSASVGTLVAIASDRFIVIVFPTKRKFRISRTWITVVAIWLLSAAVA----FPVHLY--SEVTREMGDGLNVTSCIEV 150          
BLAST of GCR056 vs. Ensembl Nematostella
Match: EDO46030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR08])

HSP 1 Score: 53.5286 bits (127), Expect = 5.609e-8
Identity = 33/109 (30.28%), Postives = 58/109 (53.21%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFND--WKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVV 566
            V +I  +++ K+  N FI  LAI+D  + L+ IPF I ++  D  W      +CK  Y L    +      +T +++ R+  + +P    +TVKR+KV    ++++SVV
Sbjct:   26 VFVIMRRRKMKTVTNYFILNLAIADLTLTLICIPFDIPVQEMDYIWPYG-PFMCKILYPLQTMCLFASVFTLTSVSVARYRAIIHPLRPQLTVKRAKVITVFIWMLSVV 133          
BLAST of GCR056 vs. Ensembl Nematostella
Match: EDO39181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAU0])

HSP 1 Score: 50.447 bits (119), Expect = 5.797e-7
Identity = 33/111 (29.73%), Postives = 59/111 (53.15%), Query Frame = 3
Query:  252 IIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDM-------ICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSV 563
            ++ S    K+T N FI  LAISD ++ +V +P +++      + + ++       +CK + FL   SI    L +  I  DRF  + YPF +++T+  SK+ V +V+  S+
Sbjct:   24 VVLSNVHLKTTTNVFILNLAISDLLIAIVCMPSSMHSIVAHSRQTSEVSGIFGAFLCKLHQFLQGISITSSILTVECIGCDRFLAIVYPFKNIITLPISKIIVALVWFTSI 134          
BLAST of GCR056 vs. Ensembl Nematostella
Match: EDO45181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU09])

HSP 1 Score: 50.447 bits (119), Expect = 8.297e-7
Identity = 32/126 (25.40%), Postives = 65/126 (51.59%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIY-IEFNDWKVS---IDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRS---KVCVFIVFLMSVVLGVLSVFQVKTF 602
            +L+++  +R  +  N+FI  + ISD +V L ++P TI+ I ++ W +S    + +CK   F+ + S       +T I++DRF+ +  P  +    KR     + V  +F  ++    L + +++ F
Sbjct:   48 ILVVWKVRRMGNNTNRFIVNMCISDLMVTLCVLPPTIHSIYYDSWLMSGPVGEALCKLIPFIQDVSAAVSIFSMTAISLDRFYAIVLPMRTHFMTKRGCHISIGVIWLFASAIHFPYLLILRLREF 173          
BLAST of GCR056 vs. Ensembl Nematostella
Match: EDO39067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB76])

HSP 1 Score: 47.7506 bits (112), Expect = 9.068e-7
Identity = 30/107 (28.04%), Postives = 62/107 (57.94%), Query Frame = 3
Query:  252 IIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWK-VSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL 569
            II S +  K+++N  I  LA+ D +  L+ IPF   +E ++++ +  + +CK+ +     +    AL + LI++DR+  + +PF   +T K+ K+ +  ++++SV L
Sbjct:   27 IICSTRSMKTSSNFLILNLAVCDLLTPLISIPFDFAVEESNYQWLYGEYMCKTLWPAATLTATSSALTLALISLDRYRLIMHPFKPRLTTKQIKLAIACIYVISVAL 133          
BLAST of GCR056 vs. Ensembl Medaka
Match: ntsr1 (neurotensin receptor 1 [Source:NCBI gene;Acc:105354415])

HSP 1 Score: 54.299 bits (129), Expect = 1.482e-7
Identity = 32/108 (29.63%), Postives = 61/108 (56.48%), Query Frame = 3
Query:  276 KSTANQFIKTLAISDCIVCLVIIPFTIY--IEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPF--LSLMTVKRSKVCVFIVFLMSVVLGVLSVF 587
            +ST +  + +LA+SD ++ ++ +P  IY  I  +   V  D +C+ Y+FL +S     AL I  ++++R+  +C+PF   S+M+  R+K  +  ++L S  L    +F
Sbjct:   85 QSTVHYHLASLAVSDLLILIISMPIEIYNFIWVHHPWVFGDAVCRGYFFLRDSCSYATALNIASLSVERYMAICHPFKAKSIMSRSRTKKLISAMWLASFALSTPMLF 192          
BLAST of GCR056 vs. Ensembl Medaka
Match: npffr1l2 (neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc:ZDB-GENE-060526-110])

HSP 1 Score: 53.5286 bits (127), Expect = 2.407e-7
Identity = 41/150 (27.33%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL----GVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANP 683
            LI+   +  ++  N FI  LAISD +V +  IP T+       W  S + +CK   F+   S+      +  IA++RF C+ YP    +T+  +KV +  +++++VV+     V    +   F    ++ + N TL    C +   +ANP
Sbjct:   73 LIVLENRCMRTVTNLFILNLAISDLLVGIFCIPTTLVDNLITGWPFS-NTVCKMSGFVQGVSVSASVFTLVAIAVERFRCIVYPLQPKLTLLVAKVAIVSIWVLAVVILCPAAVALTVEKVPFHYMVHNNDFNQTLPLYTCYE--NFANP 219          
BLAST of GCR056 vs. Ensembl Medaka
Match: npffr1l2 (neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc:ZDB-GENE-060526-110])

HSP 1 Score: 53.5286 bits (127), Expect = 2.529e-7
Identity = 41/150 (27.33%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL----GVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANP 683
            LI+   +  ++  N FI  LAISD +V +  IP T+       W  S + +CK   F+   S+      +  IA++RF C+ YP    +T+  +KV +  +++++VV+     V    +   F    ++ + N TL    C +   +ANP
Sbjct:   69 LIVLENRCMRTVTNLFILNLAISDLLVGIFCIPTTLVDNLITGWPFS-NTVCKMSGFVQGVSVSASVFTLVAIAVERFRCIVYPLQPKLTLLVAKVAIVSIWVLAVVILCPAAVALTVEKVPFHYMVHNNDFNQTLPLYTCYE--NFANP 215          
BLAST of GCR056 vs. Ensembl Medaka
Match: si:dkey-1h24.2 (cholecystokinin receptor [Source:NCBI gene;Acc:101175467])

HSP 1 Score: 53.5286 bits (127), Expect = 2.565e-7
Identity = 81/352 (23.01%), Postives = 140/352 (39.77%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIE-FNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDV-SRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEE---LMTKPGPSNNDKAIKRKFK-------ETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALN----------LPVFYMY---YINNAANPIIYCFMNKNFREDVVNFF 1226
            ++++   KR ++  N F+ +LA+SD ++ +  +PFT+      D+     M CK   +L   S+      +  IAI+R+  +C P  S     RS    + V   + V+ +L +     F   K+    N T+     +D  S+ A  T Y LL FT+      +   + I     +   +YR +     +     G  +    S                    NDD     Q +++    +  P  S    AI+ K +       E  L    +   ML V+   Y V ++P    VN+  A +           P+ +++   Y +   NPIIYCFMN  FR+ +++ F
Sbjct:   45 IVVLTLNKRMRTVTNSFLLSLAVSDLMMAVFCMPFTLIPNILKDFIFGATM-CKIVTYLMGVSVSISTFSLVAIAIERYSAICNPLQSRAWQTRSH--AYRVIAATWVISLLIMVPYPFFSALKSFPKTNGTMGHMCRLDWPSQQAEQTWYVLLLFTLF----FVPGVVMITAYGLISRELYRGIQFELSQNKETTGQKNGVMGS--------------------NDDDGCYIQVSKKPSFAVELPTLSATSSAIQAKTERARSNTSEAKLQAKRRVIRMLMVIVALYFVCWMP-LYSVNTWKAFDDKSASKTLSGAPISFIHLLSYTSACVNPIIYCFMNTRFRKALLSTF 368          
BLAST of GCR056 vs. Ensembl Medaka
Match: npffr1l2 (neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc:ZDB-GENE-060526-110])

HSP 1 Score: 53.5286 bits (127), Expect = 2.647e-7
Identity = 41/150 (27.33%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  249 LIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEF-NDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVL----GVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANP 683
            LI+   +  ++  N FI  LAISD +V +  IP T+       W  S + +CK   F+   S+      +  IA++RF C+ YP    +T+  +KV +  +++++VV+     V    +   F    ++ + N TL    C +   +ANP
Sbjct:   66 LIVLENRCMRTVTNLFILNLAISDLLVGIFCIPTTLVDNLITGWPFS-NTVCKMSGFVQGVSVSASVFTLVAIAVERFRCIVYPLQPKLTLLVAKVAIVSIWVLAVVILCPAAVALTVEKVPFHYMVHNNDFNQTLPLYTCYE--NFANP 212          
BLAST of GCR056 vs. Planmine SMEST
Match: SMESG000030128.1 (SMESG000030128.1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 364/366 (99.45%), Postives = 366/366 (100.00%), Query Frame = 3
Query:  150 MSTMTKELTNQIPTTXXXXXXXXXXXXXXXXXVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFFHQHLIKK 1247
            MSTMTKELTNQIPTTIGILIIISVIGSIGNLLVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVF+MSVVLGVLSVFQVKTFK+SKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFFHQHLIKK
Sbjct:    1 MSTMTKELTNQIPTTIGILIIISVIGSIGNLLVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFMMSVVLGVLSVFQVKTFKLSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFFHQHLIKK 366          
BLAST of GCR056 vs. Planmine SMEST
Match: SMESG000064403.1 (SMESG000064403.1)

HSP 1 Score: 251.136 bits (640), Expect = 2.412e-79
Identity = 172/366 (46.99%), Postives = 234/366 (63.93%), Query Frame = 3
Query:  150 MSTMTKELTNQIPTTXXXXXXXXXXXXXXXXXVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTT-----------EELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDV 1214
            M+ MT++  +Q+  T+ +L +I VIGS+GN LV+I+Y++K D+ T   FI  LAI+DC  C+ IIP TIYIE+ +W +S   +CK YYF NN +IPF A LI+LIAIDR+ C+C+PF   MT+ +SKV V +V  +SV+LG+ S FQVK  K    +   NS     EC D+S+  N T  E LFF+IVQ+ QL+SY  CI +VICLY+ IY  VL   RKK+ LKG+ +    S+LW    +SRS      D + +   +P   T           +  +T P P +   ++ R   +T + QNF+TA ML VVA+ YI++FLPA LM+N    L +P+FYMYYINNAANPIIYCFMN  FRED+
Sbjct:   12 MTLMTQD-GSQVAATLIMLSVICVIGSLGNGLVIIVYTRKHDQLTTTLFINILAITDCFTCITIIPMTIYIEYWEWGISSAFLCKLYYFFNNCTIPFSAFLISLIAIDRYICICHPFNKFMTLFKSKVSVGLVLTVSVLLGIASTFQVKMIKGIHPNDLTNS----YECADISKLTNTTTTEKLFFSIVQKIQLLSYTTCIILVICLYVAIYCKVLQTRRKKSILKGIKNVKKPSYLW----ESRSNLTNVPDLDENPIKLPDGDTMLSSAKSTPNSKSFLTVPKPEHRRVSL-RSICDTQIFQNFRTAAMLSVVALMYIISFLPAFLMINYPQILYIPLFYMYYINNAANPIIYCFMNARFREDI 367          
BLAST of GCR056 vs. Planmine SMEST
Match: SMESG000078415.1 (SMESG000078415.1)

HSP 1 Score: 228.409 bits (581), Expect = 1.980e-70
Identity = 173/394 (43.91%), Postives = 249/394 (63.20%), Query Frame = 3
Query:  174 TNQIPTTXXXXXXXXXXXXXXXXXVLIIYSQKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMN--STLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLN------------------------SSSTTSFLWNKFFKS------RSIKRI-NSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIK--RKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNF-FHQHLIKK 1247
            T QIP T+ +L IISV+G IGNL V++IY ++ DK T+N F+  LA SD   C+ IIP TI+IEF++W +    +CKSY F NNS IPF ALLI+LIA+DR+FC+C+PFL +M + RSK+ + I  ++S +LG L+ FQV    + K  TN++    +  S C++ S +AN +  + LF+ I Q+SQL+SY+ICI +VI LY  IY  V+   RKK +LKG+N                         +S  S ++++F  S      R++K + N  +N+  ++ P  ++   +     +++   IK  +  ++T L+QN K A MLFVV ITYIVTFLPA LM N  + LNLPVFY+YY+NNAANPIIYCFMN+NFR  + +F F + +I+K
Sbjct:    4 TQQIPPTLALLSIISVVGGIGNLFVILIYIRQCDKVTSNLFMTVLAGSDIFTCIFIIPTTIFIEFHEWGIGSSFVCKSYMFFNNSLIPFSALLISLIAMDRYFCICHPFLQIMNLSRSKLFICIALMLSTLLGTLASFQV---HIEKKLTNLSDIGPMNMSFCVEASEWANRSMSQKLFYQITQKSQLVSYSICILIVIGLYSTIYYTVIKVRRKKDQLKGMNKMKRFKPKKLECKSHIKPKSQYRLENSDNSPIYSRFVVSNYPGCNRNVKPLGNPSTNHHHSNSPTNSSMNSLNNSVNNSSSIVIKTLKNVRDTTLLQNLKLAAMLFVVGITYIVTFLPANLMANGIIKLNLPVFYLYYVNNAANPIIYCFMNRNFRNKLKSFRFLRPVIRK 394          
BLAST of GCR056 vs. Planmine SMEST
Match: SMESG000037778.1 (SMESG000037778.1)

HSP 1 Score: 154.451 bits (389), Expect = 1.771e-42
Identity = 128/376 (34.04%), Postives = 209/376 (55.59%), Query Frame = 3
Query:  159 MTKELTNQIPTTXXXXXXXXXXXXXXXXXVLIIYS-QKRDKSTANQFIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMN-STLIQSECIDVSRYANPT--KYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXXXXXXXGLNSSSTTSFLWNKFFKSR-------SIKRINSDSNNDDTSVP--------CQTTEELMTKPGPSNND-----KAIKRKF-KETILIQNFKTALMLFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKNFRED 1211
            M+  + +QIP  +  + + S IG +GN +V++IY  Q+ +  T + FI  LA+ D   CL +IPFT+  EF  W +    +C  YY LN  ++PF +LL + +AIDR+  +C+PF  + TV R+K+ +  + L S+ L + +  Q     +++ ++N++     + +C D S+    T     L  F I+ +     Y  CI VVI LYILIYR ++    +K +L+G   + +   + + F   R       +I  +  + N +   +P        C +     ++    N++     ++I +   K++ L+QN ++A+MLFVVAI YI +F+PA LM N  ++LNL VFY+YY+NNAANPIIYCFMN+ FR D
Sbjct:    1 MSPSIEHQIPIAMITMCVNSFIGCVGNGIVILIYCVQRNENCTVSLFIFVLAVIDFSTCLCVIPFTVVNEFLLWYIGSPALCFIYYVLNTFNVPFSSLLTSCVAIDRYCSICHPFHQIFTVHRAKILIISLGLFSLFLAITTT-QFAFLSMAELASNISQGNKSEYKCTDPSQLTFHTVKSAHLKMFYILLKINHSCYVFCIIVVILLYILIYRAIILLRYRKRQLQGRIDAKSHE-MMSSFMAIRKSEVAIPNISLVGLNPNENYLKIPQIKSGSFACYSRSSCCSRNFSVNDNFQTQIRSISKSLIKDSDLLQNIRSAIMLFVVAIVYITSFIPALLMANKMISLNLAVFYLYYVNNAANPIIYCFMNQQFRAD 374          
BLAST of GCR056 vs. Planmine SMEST
Match: SMESG000064085.1 (SMESG000064085.1)

HSP 1 Score: 145.591 bits (366), Expect = 3.124e-39
Identity = 113/338 (33.43%), Postives = 176/338 (52.07%), Query Frame = 3
Query:  246 VLIIYSQKRDKSTANQF-IKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKTFKVSKNSTNMNSTLIQSE--------CIDVSRYANPTKYELLFFTIVQRSQLISYAXXXXXXXXXXXXXXRFVXXXXXX---XXXXXGLNSSSTTSFLWNKFF---KSRSIKRINSDSNNDDTSVPCQT---TEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVN-SSLALNLPVFYMYYINNAANPIIYCFMNKNF 1202
            VL++Y  KR     + F I  LA SD  VC++++P TIY+E   +++S ++ CKSYYFLN S++ F  LLI +IA DR+  +C+P  S++ + R+K  V  +F +SV  G+L++  VK     K ST+   T I S         C ++    N TK +++F+ IV++S    Y   I ++I  Y  I++ ++   RK              TT +    F    K R  K ++ +       + CQ    TE         N DK    KF+ +  +QN ++A +L VV   Y+++FLP  L+V    +  NL +++ YY+NNA NPIIYCFM   F
Sbjct:   34 VLLVYRNKRRHENNDIFFIIILAASDLAVCIILVPGTIYVELKAFEIS-EIACKSYYFLNTSNLVFSTLLILVIAFDRYLSICHPLKSILPLARAKKLVIFLFFISVTQGILAMLSVKL----KLSTSSPGTYISSNTSIVKKFICDEIKHNLNITKSQMIFYEIVEKSNHFLYTSSIILIILFYSSIFKVIIRFRRKDNYYKFAPHFTDDFTTEYQPKSFVSLPKPRP-KYLSPEIETSKWRICCQNDFKTEFKREHLSNRNTDK----KFERSKFLQNIRSASLLSVVTGAYVLSFLPVLLIVAFKVINFNLILYHFYYVNNAVNPIIYCFMKSRF 361          
The following BLAST results are available for this feature:
BLAST of GCR056 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCRTR11.097e-1023.98hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
HCRTR11.097e-1023.98hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
HCRTR21.384e-920.77hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC... [more]
HCRTR21.384e-920.77hypocretin receptor 2 [Source:HGNC Symbol;Acc:HGNC... [more]
HCRTR12.595e-823.51hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GCR056 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR056 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sNPF-R2.650e-728.87gene:FBgn0036934 transcript:FBtr0332667[more]
sNPF-R2.650e-728.87gene:FBgn0036934 transcript:FBtr0074871[more]
back to top
BLAST of GCR056 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr1l23.198e-919.71neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc... [more]
npffr1l23.592e-919.71neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc... [more]
CABZ01084347.11.151e-627.93pyroglutamylated RFamide peptide receptor b [Sourc... [more]
si:dkey-1h24.21.204e-621.87si:dkey-1h24.2 [Source:ZFIN;Acc:ZDB-GENE-060503-48... [more]
CU915819.21.676e-628.57neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
back to top
BLAST of GCR056 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCRTR21.655e-722.86hypocretin (orexin) receptor 2 [Source:NCBI gene;A... [more]
HCRTR22.712e-722.86hypocretin (orexin) receptor 2 [Source:NCBI gene;A... [more]
tcf123.033e-620.87transcription factor 12 (HTF4, helix-loop-helix tr... [more]
taf1b3.235e-625.79TATA-box binding protein associated factor, RNA po... [more]
ENSXETT00000027496.13.847e-629.55pep primary_assembly:Xenopus_tropicalis_v9.1:2:146... [more]
back to top
BLAST of GCR056 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npffr21.719e-729.41neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:... [more]
Hcrtr22.768e-721.90hypocretin (orexin) receptor 2 [Source:MGI Symbol;... [more]
Hcrtr22.810e-721.90hypocretin (orexin) receptor 2 [Source:MGI Symbol;... [more]
Hcrtr14.813e-722.02hypocretin (orexin) receptor 1 [Source:MGI Symbol;... [more]
Hcrtr14.813e-722.02hypocretin (orexin) receptor 1 [Source:MGI Symbol;... [more]
back to top
BLAST of GCR056 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43613|OX1R_HUMAN5.268e-1023.98Orexin receptor type 1 OS=Homo sapiens OX=9606 GN=... [more]
sp|P56718|OX1R_RAT9.643e-1023.98Orexin receptor type 1 OS=Rattus norvegicus OX=101... [more]
sp|Q0GBZ5|OX1R_BOVIN2.035e-923.68Orexin receptor type 1 OS=Bos taurus OX=9913 GN=HC... [more]
sp|O43614|OX2R_HUMAN6.648e-920.77Orexin receptor type 2 OS=Homo sapiens OX=9606 GN=... [more]
sp|P56719|OX2R_RAT1.081e-819.88Orexin receptor type 2 OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of GCR056 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUN50.000e+099.45GCR056 OS=Schmidtea mediterranea OX=79327 GN=gcr05... [more]
A0A193KUG28.675e-7646.99GCR036 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A193KUC37.121e-6743.91GCR110 OS=Schmidtea mediterranea OX=79327 GN=gcr11... [more]
A0A5J4NU141.916e-3944.67G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A193KU986.369e-3934.04GCR075 OS=Schmidtea mediterranea OX=79327 GN=gcr07... [more]
back to top
BLAST of GCR056 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-1h24.21.721e-821.87cholecystokinin receptor-like [Source:NCBI gene;Ac... [more]
npffr1l21.837e-827.91neuropeptide FF receptor 1-like [Source:NCBI gene;... [more]
npffr1l31.136e-729.63neuropeptide FF receptor 1-like [Source:NCBI gene;... [more]
si:dkey-1h24.24.016e-721.35cholecystokinin receptor-like [Source:NCBI gene;Ac... [more]
npffr2b4.985e-728.57neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
back to top
BLAST of GCR056 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010661.13.532e-823.94pep scaffold:Pmarinus_7.0:GL479584:296:6514:-1 gen... [more]
ntsr13.117e-728.18neurotensin receptor 1 (high affinity) [Source:ZFI... [more]
npffr1l38.671e-722.38neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
mlnr2.792e-622.58motilin receptor [Source:ZFIN;Acc:ZDB-GENE-130530-... [more]
si:dkey-202l22.37.586e-629.79prolactin releasing hormone receptor [Source:HGNC ... [more]
back to top
BLAST of GCR056 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR056 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO500217.336e-925.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460305.609e-830.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391815.797e-729.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451818.297e-725.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390679.068e-728.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR056 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntsr11.482e-729.63neurotensin receptor 1 [Source:NCBI gene;Acc:10535... [more]
npffr1l22.407e-727.33neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc... [more]
npffr1l22.529e-727.33neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc... [more]
si:dkey-1h24.22.565e-723.01cholecystokinin receptor [Source:NCBI gene;Acc:101... [more]
npffr1l22.647e-727.33neuropeptide FF receptor 1 like 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of GCR056 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030128.10.000e+099.45SMESG000030128.1[more]
SMESG000064403.12.412e-7946.99SMESG000064403.1[more]
SMESG000078415.11.980e-7043.91SMESG000078415.1[more]
SMESG000037778.11.771e-4234.04SMESG000037778.1[more]
SMESG000064085.13.124e-3933.43SMESG000064085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013501 ID=SMED30013501|Name=GCR056|organism=Schmidtea mediterranea sexual|type=transcript|length=1340bp
ATTTGTCATTAGTTAAATCAAAATATTTATTTTCCCTAATTCCAAAGAAT
AAAAAATCTAATTAAAGATAATTATGCTCGGATCATAAATACTGCAAACG
AAGATCTTTGTCAGTGTAATTCCAACGACAACTGTAACTATATAACATCA
TGTCAACCATGACTAAAGAGCTGACCAATCAAATTCCAACAACGATCGGA
ATTTTGATTATAATAAGCGTGATTGGATCAATAGGAAACCTTTTGGTGCT
TATTATTTATTCTCAGAAGCGCGATAAGTCTACGGCAAATCAATTCATTA
AAACTTTGGCTATATCTGATTGCATTGTGTGCTTGGTTATTATCCCATTC
ACCATTTATATCGAATTTAACGATTGGAAAGTGTCAATCGATATGATATG
TAAATCGTATTACTTTCTAAACAATAGTAGCATCCCATTTGGAGCTCTGC
TAATAACTTTAATAGCTATTGATAGATTCTTCTGTGTTTGTTATCCATTT
CTCTCTCTAATGACAGTGAAACGGTCAAAAGTTTGTGTTTTTATTGTCTT
TTTGATGTCTGTTGTGTTGGGAGTTCTCTCAGTTTTTCAAGTGAAAACCT
TTAAAGTGTCTAAAAATAGCACGAATATGAACTCTACTCTAATCCAATCT
GAATGCATTGACGTTTCAAGATACGCCAACCCAACGAAGTATGAGCTTCT
GTTTTTCACTATCGTTCAAAGAAGTCAACTCATCAGTTACGCCATTTGTA
TTTGTGTAGTAATTTGTCTTTATATTCTCATTTATCGGTTCGTTTTAGCT
GCTGCTAGAAAGAAAGCTCGCTTGAAAGGTTTAAACAGTTCTTCAACGAC
GTCCTTTCTCTGGAACAAGTTTTTTAAGTCTCGATCGATCAAACGAATAA
ATTCCGATTCGAATAACGACGATACTTCTGTGCCTTGCCAAACGACGGAA
GAACTAATGACAAAACCCGGACCATCAAACAATGACAAAGCCATAAAGCG
GAAGTTTAAAGAGACTATTTTGATTCAGAATTTCAAAACTGCTTTAATGT
TGTTTGTTGTTGCCATAACGTACATTGTCACCTTCTTGCCGGCATGTTTA
ATGGTTAACAGTTCTCTCGCTTTAAACTTGCCAGTGTTTTATATGTATTA
CATCAACAATGCAGCCAATCCGATCATTTACTGTTTCATGAATAAGAATT
TCCGAGAAGATGTTGTCAACTTTTTCCACCAACATTTGATCAAAAAATAG
ATACAGTTTGTTTTTGGAAGTTGCGTTAATAAAGTCGTAAAATTGCTTTC
GATGTTGTCGAATTGTCTCGAGCTTATCTGTGATTCTGCG
back to top

protein sequence of SMED30013501-orf-1

>SMED30013501-orf-1 ID=SMED30013501-orf-1|Name=SMED30013501-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=367bp
MSTMTKELTNQIPTTIGILIIISVIGSIGNLLVLIIYSQKRDKSTANQFI
KTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGAL
LITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFLMSVVLGVLSVFQVKT
FKVSKNSTNMNSTLIQSECIDVSRYANPTKYELLFFTIVQRSQLISYAIC
ICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIKRI
NSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALM
LFVVAITYIVTFLPACLMVNSSLALNLPVFYMYYINNAANPIIYCFMNKN
FREDVVNFFHQHLIKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 14..38
score: 23.8
coord: 326..352
score: 30.93
coord: 189..212
score: 16.51
coord: 46..67
score: 29.2
coord: 91..113
score: 21.19
coord: 297..321
score: 18.12
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 29..344
e-value: 1.5E-24
score: 86.7
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 97..113
NoneNo IPR availablePANTHERPTHR24230:SF135coord: 18..360
NoneNo IPR availablePANTHERPTHR24230G-PROTEIN COUPLED RECEPTORcoord: 18..360
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 30..348
e-value: 4.15406E-25
score: 100.815
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 15..362
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 194..216
NoneNo IPR availableTMHMMTMhelixcoord: 126..148
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 327..346
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 29..344
score: 24.745