slc5a-2

Overview
Nameslc5a-2 (AKN21417.1)
Smed IDSMED30013493
Length (bp)2123
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc5a-2 (SMED30013493) t-SNE clustered cells

Violin plots show distribution of expression levels for slc5a-2 (SMED30013493) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc5a-2 (SMED30013493) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc5a-2 (SMED30013493) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013493

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013493SMESG000013622.1 PL05005B2B08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30013493SMESG000013622.1 dd_Smed_v4_6663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30013493SMESG000013622.1 Smed-slc5a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc5a-2 vs. Ensembl Human
Match: SLC5A1 (solute carrier family 5 member 1 [Source:HGNC Symbol;Acc:HGNC:11036])

HSP 1 Score: 511.531 bits (1316), Expect = 6.768e-173
Identity = 326/658 (49.54%), Postives = 461/658 (70.06%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWAS-CRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDV-TKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI +++ YFV+V+ VGLWA    NRG+VGG+FLAGR M W P+GASLFASNIGSGHF+GLAG+GA+SGIAI  FE NA+ ++++LGW+F+P+YI  G+ TMPEYL+KRFGG RI++YL++++LLLYIFTKISAD+++GAIFI  ++ L LY ++ +LL   A++ I GGL AVI+TD +QTVIML+G+  L   +F E+GGY+  + +Y +++P      N +TFQ         C  P  ++ H  R     +LPWPG IFG++I ++WYWCTDQVIVQR L+AKN++  K G +LC +LK++PM+++V PGM SR+L+T+++AC +P EC++ CG + GC+++AYP LV+E++P G RGLML+VMLASL+SSLTSIFNSAST+FT DI+ ++RK AS+ ELMI GR+F+LV++ I IAW+PIVQS  S +LF YIQS+TSYL PPI AV+LLA+FWKR NE GAF GL+ GL+IG+SR  TE AY    C E +  P+++  VHYL+F I+LF I+ I  V  SLLT P+   H   L  W+ R    +R +D   E    E + +   K+ I++ T+        +R+A +  CG+E        P +T +E + ++       E P W+ V+N   + L+T+ +F   ++A
Sbjct:   25 NAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAIPTIVSDGN-TTFQE-------KCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQRCLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKPIPDVHLYRLC-WSLRNSKEER-IDLDAE----EENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQ----HGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA 664          
BLAST of slc5a-2 vs. Ensembl Human
Match: SLC5A4 (solute carrier family 5 member 4 [Source:HGNC Symbol;Acc:HGNC:11039])

HSP 1 Score: 499.975 bits (1286), Expect = 1.793e-168
Identity = 302/657 (45.97%), Postives = 439/657 (66.82%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V++ YF++V+ VGLWA  + NRG++GG+FLAGR M W P+GASLFASNIGS H++GLAG+GA+SG+A   FE  +  +LLILGWIF+P+YI +G+ TMPEYLKKRFGG R+++YL++++L + +   ISAD++AGAIFI+ ++ L LY ++ ILL   AV+   GGL +VI+TD +QT+IMLIG+  LM  +F E+GGYE+   +Y  + P      N +   +        C  P  ++ H  R +   ++PWPG+IFG+ I+++WYWCT+QVIVQR L  K+++  K+  ++CA+LK+LPM+L+V PGM SR+L+TD VAC +P EC + CG + GC++ AYP +VLE++P G RGLML+VMLASL+SSLTSIFNSAST+FT D++ ++RK AS+ EL+I GR+FVL++  + I W+P+VQ S   +L HY +S++SYL PPI AV++LA+F KR NE+GAF GLM GL +GL R  TE AY    C   +  P ++  VHYL+F I+LF  ++++++  SLLT P+   H   L  W  R    +R +D   E    E   +   + Y + ++G        +KA +  CG++        P LT +E E + K      E P W+ +VN   + L+ + +F  G+YA
Sbjct:   25 NAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISAS--------CYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEKELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLC-WVLRNSTEER-IDIDAEEKSQEETDDGVEEDYPEKSRGC------LKKAYDLFCGLQ------KGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA 659          
BLAST of slc5a-2 vs. Ensembl Human
Match: SLC5A9 (solute carrier family 5 member 9 [Source:HGNC Symbol;Acc:HGNC:22146])

HSP 1 Score: 497.664 bits (1280), Expect = 3.498e-167
Identity = 332/668 (49.70%), Postives = 450/668 (67.37%), Query Frame = 2
Query:   80 LEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFW--NCRKEYSKREVDKGT----ENPCYENDFEVDAKKYIDVTKGSNLP----LPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            L   DI VV+ YFV V+ VG+W+S R +RG++GGYFLAGR M W P+GASL +SN+GSG FIGLAG+GA+ G+A+  FE NA ++LL LGW+F+PVYI+ G+ TMP+YLKKRFGG RI++Y++V++L+LYIFTKIS D+++GA+FI+ ++   LY S  ILL+  AV+ I GGL AVI+TD +QTVIM+ GA  LM   F ++G Y  L  RY Q++P              VPN    C +P  +A H +R     ++PWPG+IFGLT+ + W WCTDQVIVQR+L+AK+L+ AK G +L  +LK+LPM+ IV PGM SR LF DEV C  P+ C+RICG   GCS++AYPKLV+ ++P G RGLM+AV++A+L+SSLTSIFNS+ST+FT D+WQR R+ +++ ELM+VGRVFV+ +V I I WIPI+QSSN  +LF YIQ+VTSYL+PPI A++LLA+F KR  E GAF GL+ GL +GL R   E +YP   CGE +  P+VL   HYL+F ILL G+T I+ V  SL T P+       L +W  NC     ++E  + T    E P  E      A +  + + G   P      W +   +W CG   L    +Q +  A++    QKL  SI+E+P W+ V N   + L+ I IF WG++A
Sbjct:   33 LHAYDISVVVIYFVFVIAVGIWSSIRASRGTIGGYFLAGRSMSWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATWLLLALGWVFVPVYIAAGVVTMPQYLKKRFGGQRIQVYMSVLSLILYIFTKISTDIFSGALFIQMALGWNLYLSTGILLVVTAVYTIAGGLMAVIYTDALQTVIMVGGALVLMFLGFQDVGWYPGLEQRYRQAIPNV-----------TVPNT--TCHLPRPDAFHILRDPVSGDIPWPGLIFGLTVLATWCWCTDQVIVQRSLSAKSLSHAKGGSVLGGYLKILPMFFIVMPGMISRALFPDEVGCVDPDVCQRICGARVGCSNIAYPKLVMALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFTIDVWQRFRRKSTEQELMVVGRVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIFCKRVTEPGAFWGLVFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHESTPEISERPAGECPAGGGAAE--NSSLGQEQPEAPSRSWGKLLWSWFCG---LSGTPEQALSPAEKAALEQKL-TSIEEEPLWRHVCNINAVLLLAINIFLWGYFA 681          
BLAST of slc5a-2 vs. Ensembl Human
Match: SLC5A2 (solute carrier family 5 member 2 [Source:HGNC Symbol;Acc:HGNC:11037])

HSP 1 Score: 494.197 bits (1271), Expect = 5.484e-166
Identity = 320/664 (48.19%), Postives = 457/664 (68.83%), Query Frame = 2
Query:   92 DIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNP-VPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKG--------TENPCYENDFEVDAKKYIDVTKGSNLPLP-WYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            DI V+  YF+LV+GVGLW+ CR NRG+VGGYFLAGR M W PVGASLFASNIGSGHF+GLAG+GA+SG+A+A FE NA+F++L+LGW+F PVY++ G+ TMP+YL+KRFGG RIR+YL+V++L LYIFTKIS D+++GA+FI+Q++   +Y SVI LL    ++ + GGL A+++TD +QT ++L GA  LM  +F E+GGY  L  +Y       G   + +  ++P V N    C  P  ++ H +R     +LPWP ++ GLTI S WYWC+DQVIVQR LA K+LT  K+G +LC +LK+ PM+L+V PGM SR+L+ DEVAC +PE C+R+CG E GCS++AYP+LV++++P G RGLMLAVMLA+L+SSL SIFNS+ST+FT DI+ RLR  A D EL++VGR++V+ +V + +AW+P+VQ++   +LF YIQ+V+SYL+PP+ AV++LALF  R NE+GAF GL+ GL++GL+R   E ++    C + +  P+ L  VHYL+F I+LF  + ++++T SL TAP+ R+H   L+F     +  + ++D           +N C E+  E++  +          P P  +R+ + W CG+         P LT +E     +    I EDP W  VVN   L ++ + +F WGFYA
Sbjct:   25 DILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTAGVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYL------GAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRCLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDRELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLLTLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ---------APAPSLFRQCLLWFCGMSR-GGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLMMAVAVFLWGFYA 672          
BLAST of slc5a-2 vs. Ensembl Human
Match: SLC5A11 (solute carrier family 5 member 11 [Source:HGNC Symbol;Acc:HGNC:23091])

HSP 1 Score: 486.493 bits (1251), Expect = 6.217e-163
Identity = 330/677 (48.74%), Postives = 449/677 (66.32%), Query Frame = 2
Query:   80 LEGGDIGVVIGYFVLVLGVGLWASCRN-RGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYR-------------------KAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            LE GDI V++ YF+ VL VGLW++ +  R +V GYFLAG  M W PVGASLFASN+GSGHFIGLAGSGA++GI+++ +ELN +F +L+L WIFLP+YI+  + TMPEYL+KRFGG+RI I LAV+ L +YIFTKIS D+YAGAIFI+QS+ L LY +++ LL   AV+ + GGL AVI+TD +QT+IMLIGA  LM  SF  +GG E L  +YF +L  + R  N S            CG+P ++A H  R    ++LPWPGV+FG++I S+WYWCTDQVIVQR LAAKNL+ AK G L+ A+LK+LP++++VFPGM SR+LF D+VAC  PE C++IC    GCSD+AYPKLVLE+LPTG RGLM+AVM+A+L+SSLTSIFNSASTIFT D+W  LR  AS+ ELMIVGRVFVL++V + I WIP+VQ+S   +LF YIQS++SYL PP+  V+++  FWKR NEKGAF GL+SGL++GL R   +  Y    C + +  P ++  +HYL+F ++L  +TLI   T S  T P  +     L  W  R +     V K    P       +      + +  S++     +                   KAI W+CGI++ K  ++ P          + +  S++E+P  K +++   +  ++  IF WG++A
Sbjct:   24 LEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFLAGGDMVWWPVGASLFASNVGSGHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIYIAGQVTTMPEYLRKRFGGIRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITAVYTVAGGLAAVIYTDALQTLIMLIGALTLMGYSFAAVGGMEGLKEKYFLAL-ASNRSENSS------------CGLPREDAFHIFRDPLTSDLPWPGVLFGMSIPSLWYWCTDQVIVQRTLAAKNLSHAKGGALMAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKICSNPSGCSDIAYPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIVGRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGAFWGLISGLLLGLVRLVLDFIYVQPRCDQPDERPVLVKSIHYLYFSMILSTVTLITVSTVSWFTEPPSKEMVSHLT-WFTRHD---PVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQE-KGKEELPA-------RAEAIIVSLEENPLVKTLLDVNLIFCVSCAIFIWGYFA 675          
BLAST of slc5a-2 vs. Ensembl Celegans
Match: ZK822.5 (pep chromosome:WBcel235:IV:11938574:11940604:1 gene:WBGene00014092.1 transcript:ZK822.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK822.5)

HSP 1 Score: 50.8322 bits (120), Expect = 2.358e-6
Identity = 82/343 (23.91%), Postives = 156/343 (45.48%), Query Frame = 2
Query:  479 ISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMIT--SFVELGGYENLVTRYFQS--LPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNS-ASTIFTFDIWQRLRKSASDVELMIVGRVFVLV--MVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFI 1486
            +S  LYA ++ +   +Q+  +  V+I      ++  LGGL AV+WTD +Q VIM  G   L+    S   +GG E +++  + S  + + GR                D  I   N++            W  +  G TI  +  +  +Q+ +QR  +  +L  A+S I+       +   ++ F G  +   F +   CN P E   +  KE     +++ + +L+  P G  GL ++ ++++ +S+L+S  NS A+ I+   +   L    +D     + ++ VL+  + + G+A++  V   +       SV   +S P+ A+++LALF+ +   K   I
Sbjct:    1 MSVVLYAPSVALSPVLQINKWYLVLIFGCTTTLYTCLGGLKAVVWTDSLQAVIMYTGVFTLIYKGLSHPRVGGLERVLSIAWDSGRISELGR---------------MDWRIDQYNSL------------WINLFSG-TIVWLASFGVNQLAIQRYASLPSLKVAQSIIIYTLAPFTVLCSIVAFVGFIALAYFYN---CN-PLETGEV--KESDHITISFARDILQPTP-GLFGLYVSCIMSATLSTLSSGMNSMAAAIYEDFLKNSLDGKITDTGATRLNKIIVLICGLSSTGLAFLAEVLGGS--LRICISVMGAMSGPMVAIFVLALFFPKSGSKSCLI 306          
BLAST of slc5a-2 vs. Ensembl Celegans
Match: ZK822.5 (pep chromosome:WBcel235:IV:11937418:11940604:1 gene:WBGene00014092.1 transcript:ZK822.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK822.5)

HSP 1 Score: 50.8322 bits (120), Expect = 2.994e-6
Identity = 82/343 (23.91%), Postives = 156/343 (45.48%), Query Frame = 2
Query:  479 ISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMIT--SFVELGGYENLVTRYFQS--LPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNS-ASTIFTFDIWQRLRKSASDVELMIVGRVFVLV--MVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFI 1486
            +S  LYA ++ +   +Q+  +  V+I      ++  LGGL AV+WTD +Q VIM  G   L+    S   +GG E +++  + S  + + GR                D  I   N++            W  +  G TI  +  +  +Q+ +QR  +  +L  A+S I+       +   ++ F G  +   F +   CN P E   +  KE     +++ + +L+  P G  GL ++ ++++ +S+L+S  NS A+ I+   +   L    +D     + ++ VL+  + + G+A++  V   +       SV   +S P+ A+++LALF+ +   K   I
Sbjct:  147 MSVVLYAPSVALSPVLQINKWYLVLIFGCTTTLYTCLGGLKAVVWTDSLQAVIMYTGVFTLIYKGLSHPRVGGLERVLSIAWDSGRISELGR---------------MDWRIDQYNSL------------WINLFSG-TIVWLASFGVNQLAIQRYASLPSLKVAQSIIIYTLAPFTVLCSIVAFVGFIALAYFYN---CN-PLETGEV--KESDHITISFARDILQPTP-GLFGLYVSCIMSATLSTLSSGMNSMAAAIYEDFLKNSLDGKITDTGATRLNKIIVLICGLSSTGLAFLAEVLGGS--LRICISVMGAMSGPMVAIFVLALFFPKSGSKSCLI 452          
BLAST of slc5a-2 vs. Ensembl Celegans
Match: ZK822.5 (pep chromosome:WBcel235:IV:11937384:11940604:1 gene:WBGene00014092.1 transcript:ZK822.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK822.5)

HSP 1 Score: 50.8322 bits (120), Expect = 2.994e-6
Identity = 82/343 (23.91%), Postives = 156/343 (45.48%), Query Frame = 2
Query:  479 ISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMIT--SFVELGGYENLVTRYFQS--LPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNS-ASTIFTFDIWQRLRKSASDVELMIVGRVFVLV--MVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFI 1486
            +S  LYA ++ +   +Q+  +  V+I      ++  LGGL AV+WTD +Q VIM  G   L+    S   +GG E +++  + S  + + GR                D  I   N++            W  +  G TI  +  +  +Q+ +QR  +  +L  A+S I+       +   ++ F G  +   F +   CN P E   +  KE     +++ + +L+  P G  GL ++ ++++ +S+L+S  NS A+ I+   +   L    +D     + ++ VL+  + + G+A++  V   +       SV   +S P+ A+++LALF+ +   K   I
Sbjct:  147 MSVVLYAPSVALSPVLQINKWYLVLIFGCTTTLYTCLGGLKAVVWTDSLQAVIMYTGVFTLIYKGLSHPRVGGLERVLSIAWDSGRISELGR---------------MDWRIDQYNSL------------WINLFSG-TIVWLASFGVNQLAIQRYASLPSLKVAQSIIIYTLAPFTVLCSIVAFVGFIALAYFYN---CN-PLETGEV--KESDHITISFARDILQPTP-GLFGLYVSCIMSATLSTLSSGMNSMAAAIYEDFLKNSLDGKITDTGATRLNKIIVLICGLSSTGLAFLAEVLGGS--LRICISVMGAMSGPMVAIFVLALFFPKSGSKSCLI 452          
BLAST of slc5a-2 vs. Ensembl Fly
Match: CG2187 (gene:FBgn0017448 transcript:FBtr0303376)

HSP 1 Score: 60.4622 bits (145), Expect = 4.443e-9
Identity = 102/482 (21.16%), Postives = 205/482 (42.53%), Query Frame = 2
Query:  113 YFVLVL------GVGLWAS--CRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWC----TDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIV--FPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILP--TGARGXXXXXXXXXXXXXXTSIFNSASTIFTFD-IWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLV 1507
            YFV V+      G+G++     +++ +   Y   G++M  +P+  SL AS +     + +     + G       L  + ++ IL +I +PV+    +    EYL+ RF   +    L     +   F  +   ++  ++   Q   + ++   +++      + +LGG+ AV+WTD +Q  IML+    + +   +  GG   ++ R        GR+              FD G+  +  M F          W     G T+  I+ W      +Q  VQR ++  + + AK  +++         +LI+  F  ++  ++F     C+ P     +   +K       P  V +I+    G  G+ ++ + ++ +SSL++  NS + +  FD I  R+R + +     +  ++ V+VM    I    +VQ+ N +   + ++T   +  +  V+LL +F  RCN K A   ++  +V
Sbjct:   29 YFVFVIMLGASAGIGVYFGFFSKSKNTTEEYLRGGKKMQTLPIAISLVASQLSGIAIMSIPAESYTYGFNYIFVVLAMLVVIPILIYIIVPVFYENNVSNCYEYLEMRFN--KRTRQLVTFFFVTNSFLMLPVYMFIPSLAFAQVTGMNIHLINVMVSSICIFYTMLGGIKAVVWTDVVQGAIMLLSVVAVGVLGTIRSGGMFTVMER----ASDGGRF-------------NFDFGLDPRIRMTF----------W-----GATMGGIFMWTGHIGLNQSCVQRIVSLPSYSHAKKSLIVSGL-----GFLIISFFNTISGIIMFARYYGCD-PMLAGLVSKPDK-----MMPFFVQDIMGHLAGMPGVFISCVFSAALSSLSATLNSLAGVVYFDYIKPRIRHTEARANWAM--KLIVVVMGGYCILGGFMVQNFNSILQTVVTITGINTGAVVGVFLLGMFVPRCNAKTAVTSIIVSVV 463          
BLAST of slc5a-2 vs. Ensembl Fly
Match: CG2187 (gene:FBgn0017448 transcript:FBtr0085861)

HSP 1 Score: 60.4622 bits (145), Expect = 4.443e-9
Identity = 102/482 (21.16%), Postives = 205/482 (42.53%), Query Frame = 2
Query:  113 YFVLVL------GVGLWAS--CRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWC----TDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIV--FPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILP--TGARGXXXXXXXXXXXXXXTSIFNSASTIFTFD-IWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLV 1507
            YFV V+      G+G++     +++ +   Y   G++M  +P+  SL AS +     + +     + G       L  + ++ IL +I +PV+    +    EYL+ RF   +    L     +   F  +   ++  ++   Q   + ++   +++      + +LGG+ AV+WTD +Q  IML+    + +   +  GG   ++ R        GR+              FD G+  +  M F          W     G T+  I+ W      +Q  VQR ++  + + AK  +++         +LI+  F  ++  ++F     C+ P     +   +K       P  V +I+    G  G+ ++ + ++ +SSL++  NS + +  FD I  R+R + +     +  ++ V+VM    I    +VQ+ N +   + ++T   +  +  V+LL +F  RCN K A   ++  +V
Sbjct:   29 YFVFVIMLGASAGIGVYFGFFSKSKNTTEEYLRGGKKMQTLPIAISLVASQLSGIAIMSIPAESYTYGFNYIFVVLAMLVVIPILIYIIVPVFYENNVSNCYEYLEMRFN--KRTRQLVTFFFVTNSFLMLPVYMFIPSLAFAQVTGMNIHLINVMVSSICIFYTMLGGIKAVVWTDVVQGAIMLLSVVAVGVLGTIRSGGMFTVMER----ASDGGRF-------------NFDFGLDPRIRMTF----------W-----GATMGGIFMWTGHIGLNQSCVQRIVSLPSYSHAKKSLIVSGL-----GFLIISFFNTISGIIMFARYYGCD-PMLAGLVSKPDK-----MMPFFVQDIMGHLAGMPGVFISCVFSAALSSLSATLNSLAGVVYFDYIKPRIRHTEARANWAM--KLIVVVMGGYCILGGFMVQNFNSILQTVVTITGINTGAVVGVFLLGMFVPRCNAKTAVTSIIVSVV 463          
BLAST of slc5a-2 vs. Ensembl Fly
Match: CG32669 (gene:FBgn0052669 transcript:FBtr0073412)

HSP 1 Score: 57.3806 bits (137), Expect = 3.857e-8
Identity = 105/466 (22.53%), Postives = 198/466 (42.49%), Query Frame = 2
Query:  179 YFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILP--TGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRL-----RKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKP 1555
            Y LA R M+  PV  SL AS + +   +G++      G    V  L+ +    +  ++ +PV+      ++ EYL+ RFG           +L + ++  I   +YA A+ +E    L    S++I+ +    +  LGG+ AV+ TD  Q+++M      ++I ++V+ G  E ++ R  Q   + GR +N + F              D    H           W   I G   + +  +  +Q  VQR +A K+L+ A++ +  C  +  L      F G+     + D         C  +        D   P  V++ +   TG  GL ++ +  + +S+++SI +S + +   D  + L     +++ +D + +   ++  L   A+ I    +  S   L     S+   +  P+  ++ L ++  + NEKGA    + GL+I L+  F      PKP
Sbjct:   39 YLLADRSMNVAPVAFSLMASFMSAVTILGVSMENYQYGTMFVVINLSYVLSTPVAAYLIIPVFYRLKTASVYEYLELRFGYATRLAASLSFSLQMVLYMGIV--VYAPALALEAVTGLSQVFSIVIVGVVCTFYATLGGMKAVLITDIYQSLLMFAAVFSVIICAWVKAGSLE-VIWRVAQ---ENGR-INLTNFS------------VDPTERH----------TWFTQILGGCATYLAIYGVNQTQVQRLMAVKSLSAARAALWWCLPILCLLSLSTCFSGLCIYWYYRD---------CDPLLEGRVNSRDQVMPLFVVDTMGEYTGLAGLFVSGIFCASLSTISSIISSLAAVTLEDYLKPLVSCCAKRTLTDRQTLWYSKLLSLFFGALCIGMAFMAGSIGGLLQAALSIFGIIGGPLLGLFTLGMYVTKANEKGA----IGGLLISLAFCFWIGFGQPKP 462          
BLAST of slc5a-2 vs. Ensembl Fly
Match: salt (gene:FBgn0039872 transcript:FBtr0339190)

HSP 1 Score: 54.6842 bits (130), Expect = 2.579e-7
Identity = 106/469 (22.60%), Postives = 201/469 (42.86%), Query Frame = 2
Query:   95 IGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXX-XXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILP--TGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGL 1492
            IGV  G+F            + + +   Y   G++M  +PV  SL +S + SG  +    +   S     +F + A+ + + +L +I +PV+    +    EYL+ RF   +    L  I  +L  F  +   ++  ++   Q     ++    ++      + +LGG+ AV+WTD +Q  +MLI    + I      GG    +T   ++  + GR+              F  GI  +  + F+   +   L W G + GL          DQ  VQR ++  +   AK  +L+     +L M    F G+   ++F     C+ P +   +   +K       P  + +I+    G  G+ ++ + ++ +SSL++  NS + +  FD + + R + S+ +     ++ ++VM A  I    IVQ+ N +   + ++T      +  V+ L +F  RCN K A  G+
Sbjct:   43 IGVYFGFF-----------SKAKNTTEEYLQGGKRMPTLPVAISLVSSQL-SGVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFS--KRTRQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVWTDVVQGSVMLISVVLVAILGTSNTGG----ITNVLENAAEGGRF-------------DFSFGIDPRLRLTFISGMASGLLMWTGKL-GL----------DQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGI---IMFAYYYGCD-PIQAGLVSKPDK-----LMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVVYFD-YIKPRINHSEAKANATMKLVIVVMGAYCIVGGFIVQNFNSIIQTMWTITGINMGAVVGVFCLGMFVPRCNAKVAVSGI 459          
BLAST of slc5a-2 vs. Ensembl Fly
Match: salt (gene:FBgn0039872 transcript:FBtr0300915)

HSP 1 Score: 54.6842 bits (130), Expect = 2.765e-7
Identity = 106/469 (22.60%), Postives = 201/469 (42.86%), Query Frame = 2
Query:   95 IGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXX-XXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILP--TGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGL 1492
            IGV  G+F            + + +   Y   G++M  +PV  SL +S + SG  +    +   S     +F + A+ + + +L +I +PV+    +    EYL+ RF   +    L  I  +L  F  +   ++  ++   Q     ++    ++      + +LGG+ AV+WTD +Q  +MLI    + I      GG    +T   ++  + GR+              F  GI  +  + F+   +   L W G + GL          DQ  VQR ++  +   AK  +L+     +L M    F G+   ++F     C+ P +   +   +K       P  + +I+    G  G+ ++ + ++ +SSL++  NS + +  FD + + R + S+ +     ++ ++VM A  I    IVQ+ N +   + ++T      +  V+ L +F  RCN K A  G+
Sbjct:   43 IGVYFGFF-----------SKAKNTTEEYLQGGKRMPTLPVAISLVSSQL-SGVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFS--KRTRQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVWTDVVQGSVMLISVVLVAILGTSNTGG----ITNVLENAAEGGRF-------------DFSFGIDPRLRLTFISGMASGLLMWTGKL-GL----------DQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGI---IMFAYYYGCD-PIQAGLVSKPDK-----LMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVVYFD-YIKPRINHSEAKANATMKLVIVVMGAYCIVGGFIVQNFNSIIQTMWTITGINMGAVVGVFCLGMFVPRCNAKVAVSGI 459          
BLAST of slc5a-2 vs. Ensembl Zebrafish
Match: slc5a9 (solute carrier family 5 member 9 [Source:NCBI gene;Acc:564815])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 332/659 (50.38%), Postives = 462/659 (70.11%), Query Frame = 2
Query:   80 LEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLP-WYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            LE  DI VV+ YFV VL VG+W+S R NRG+VGGYFLAGR M W P+GASL +SN+GSG FIGLAG+GA+ G+A+  FE NA ++L+ LGWIF+PVYIS G+ TMPEYL+KRFGG RIRIY++V++L+LYI TKIS D+++GA+FI+ S+   LY S +ILL   A++ I GGLTAVI+TD +QTVIM+IGA  LM  +F ++G YE L+ +Y ++ P              VPN    C +P  +A H  R     ++PWPG+IFGLT+ + W WCTDQVIVQR+L+AKNL+ AK+G +L  +LK+ PM+ +V PGM SR L+ DEVAC  P+EC++ICG + GCS++AYPKLV+E++P G RGLM+AVM+A+L+SSLTSIFNS+ST+FT DIWQR+R  AS+ ELM+VGRVF+L++VA+ I WIP++Q++N  +LF YIQ++TS+LSPPI  V+++A+FW R NE+GAF GLM GLV+G+ R   E  Y    CGE ++ PS+L  VHYL+F ++L  +T++I    SL TAP+  +H   L +W    +  + E++     P   +    +       ++GS+   P W+++A  W+CG+           LT +E + ++K   SI+ED  WK V N   L L+T  +F WG++A
Sbjct:   23 LEAADIAVVVVYFVFVLAVGIWSSIRANRGTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNAAWVLIALGWIFVPVYISAGVVTMPEYLRKRFGGQRIRIYMSVLSLILYILTKISTDIFSGALFIQVSLGWDLYLSTVILLAVTALYTIAGGLTAVIYTDALQTVIMVIGAFVLMFIAFDKVGWYEGLLVQYEKAAPAL-----------TVPNT--TCHLPRSDAFHIFRDPVTGDIPWPGLIFGLTVLATWVWCTDQVIVQRSLSAKNLSHAKAGSVLGGYLKVFPMFFVVMPGMISRALYPDEVACVDPDECQKICGAKVGCSNIAYPKLVVELMPVGMRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWQRIRPRASEKELMVVGRVFILLLVALSIVWIPVIQTANSGQLFDYIQAITSFLSPPITTVFIMAIFWGRVNEQGAFWGLMVGLVVGMVRMIMEFVYGTPSCGETDLRPSLLKDVHYLYFALILLALTVLIITAVSLCTAPIPEKHLVRLTWWTRHSKEERVELEDPWAKPAGSDLSTTE-------SEGSDEDAPAWWKRAGMWLCGLSQTTKQD----LTEEERQALEKKLTSIEEDHMWKTVCNVNALILLTANVFLWGYFA 657          
BLAST of slc5a-2 vs. Ensembl Zebrafish
Match: slc5a1 (solute carrier family 5 member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1524])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 333/659 (50.53%), Postives = 462/659 (70.11%), Query Frame = 2
Query:   89 GDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKT-GRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKR---EVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             DI V++ YF++VL VG+WA  R NR +VGG+FLAGR M W P+GASLFASNIGSGHF+G+AG+GA++GIAI  FE NA+ +++ILGW+F+P+YI  G+ TMPEYLKKRFGG RIRIYL+V++L LY+FTKISAD++AGAIFI Q++ L +Y +V+ILLL  A++ + GGL AVI+TD +QT+IM++G+  LM  +F ++GGYEN    Y  ++P   G  ++ S            C  P  ++ H  R   + +LPWPG++FGLTI + WYWCTDQVIVQR L+AKNL+  K+G +LC +LK+LPM+L+VFPGM SRVL+ DE+AC  P+ECK +CG E GC+++AYPKLV++++P G RGLML+VMLASL+SSLTSIFNSAST+FT DI+ ++R  A + ELMI GR+F+L+++ I IAWIPIVQ+  S +LF YIQS+TSYL+PPI AV+ LA+F KR NE GAF GL  GL++GL+R  TE AY    C   +  P+++  VHYL+F ++LFG++ I+ ++ SL+T P++ +H   L  W+ R    +R   E D  TE+    N  E D  +      G        +KA NW CG +      + P LT ++  E++       E P W+ VVN   + L+T+ +F+ GF+ 
Sbjct:   47 ADISVIVIYFLVVLAVGVWAMVRTNRATVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGIAGTGAAAGIAIGGFEWNALVVVIILGWLFVPIYIKAGVVTMPEYLKKRFGGQRIRIYLSVLSLCLYVFTKISADMFAGAIFINQALGLNIYLAVVILLLITALYTVTGGLAAVIYTDTLQTIIMVVGSFILMGFAFNKVGGYENFRDSYMTAIPSVIGTNISES------------CYTPRADSFHIFRDPINGDLPWPGLLFGLTIQAGWYWCTDQVIVQRCLSAKNLSHVKAGCILCGYLKLLPMFLMVFPGMISRVLYPDEIACVDPDECKAVCGAEVGCTNIAYPKLVVDLMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYTKIRPKAKEKELMIAGRLFMLLLIGISIAWIPIVQTAQSGQLFDYIQSITSYLAPPIAAVFALAIFCKRVNEPGAFYGLCVGLLVGLARMITEFAYGTGSCVNPSNCPTIICGVHYLYFALILFGLSCILILSISLMTKPIEDKHLYRLC-WSLRNNTEERIDLEADDWTEDQ-DSNSMETDEMRE---EPGC------CKKAYNWFCGFDQ----GNAPKLTKEQEAELKMKLTDTTEKPLWRNVVNANAVILLTVCVFFHGFFG 678          
BLAST of slc5a-2 vs. Ensembl Zebrafish
Match: slc5a2 (solute carrier family 5 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2498])

HSP 1 Score: 520.776 bits (1340), Expect = 1.239e-176
Identity = 329/665 (49.47%), Postives = 449/665 (67.52%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYF---DCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYI-----DVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V+I YF++V+ VG+W++ R NRG+VGGYFLAGR M W PVG SLFASNIGSGHF+GLAG+ A+SGIA+  FE NA+FI+L+LGW+F+PVY++ G+ TMP+YLKKRFGG RI +YL++I+L LYIFTKIS D+++GA+FI+Q++   +Y +VI LL   A++ + GGL A+++TD +QT +++ GA  LM  SF E+GGY  L+ +Y  SLP     LN        PN+Y     C +P ++A H +R  +  +LPWPGVIFG+ I   WYWCTDQVIVQR LAA++LT  K+G +LC +LK+LPM+L+VFPGM SRVL+ D+V C     C ++CG E GCS++AYPKLV+ ++PTG RGLMLAVMLA+L+SSL SIFNS+ST+FT DIW R+R  A D ELM+VGRV++L +V I I WIP+VQ+  S +LF YIQSVTSYL+PPI AV+ LA+F KR NE GAF GLM GLV+GL R   E  +    C + +  P V+  VHYL+F ILLF  T I+ +  S  T P+  +H   L+F        + ++D   E    +   E D K+        + +G    +    K I W CGI D +  +       +  +++      I E+P WK +VN   L ++T+ +++WGFYA
Sbjct:   13 NAADISVIIIYFLVVIAVGIWSTFRTNRGTVGGYFLAGRTMVWWPVGTSLFASNIGSGHFVGLAGTAAASGIAVGGFEWNALFIVLLLGWVFVPVYLTAGVITMPQYLKKRFGGSRISLYLSIISLFLYIFTKISVDMFSGAVFIQQALGWNIYVAVIALLCITALYTVTGGLAALMYTDTVQTFVIIAGAFVLMGFSFYEVGGYSALLEKYNSSLPSQTLSLN--------PNEYNISQHCYMPREDAFHLLRDPTTGDLPWPGVIFGIAIIGSWYWCTDQVIVQRCLAARSLTHVKAGCILCGYLKLLPMFLMVFPGMISRVLYPDDVGCVEKSVCNKVCGTEVGCSNIAYPKLVVSVMPTGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIWTRIRPQARDKELMVVGRVWILCIVGISICWIPVVQAAQSGQLFDYIQSVTSYLAPPIAAVFFLAIFVKRVNESGAFWGLMGGLVMGLCRMVPEFVFGSGSCLKPSNCPKVICGVHYLYFAILLFFCTAILVLFVSYNTPPIKDKHLHRLVFTLRHSTEERVDLDWEEEERGRKARREADEKRRAKNDEDQIERGEQSIM---MKIIGWFCGISDTQAPEPTEEEVTEASKQLPD----ISENPLWKNLVNVNALIMMTVAVYFWGFYA 662          
BLAST of slc5a-2 vs. Ensembl Zebrafish
Match: SLC5A10 (si:dkeyp-9d4.5 [Source:ZFIN;Acc:ZDB-GENE-121214-88])

HSP 1 Score: 498.049 bits (1281), Expect = 3.634e-168
Identity = 296/563 (52.58%), Postives = 405/563 (71.94%), Query Frame = 2
Query:   65 ALVGKLEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREV 1744
            AL       DI V+  YF+L + VG+W+SCR +R ++ GYFLAGR M W P+GASLFAS+ GSG FIGLAG+GA+ GIA+A FE NA + LL L W+F+PVY+S+GI TMPEYL +RFGG RIR+YL+ ++LLL +FTKIS DLY+GA+F++  +   LY S +++L+  A++ I GGL AVI+TD +QT IM+IGA  L IT+F ++GGY NL + Y Q++P              +PN    C +P  +AMH  R     +LPWPG+  GLTI + WYWCTDQVIVQR+L+AK+L+ AK   +  ++LK+LPM  I+ PGM SR L+ D VAC  PEEC ++CG E GCS++A+PKLV+E++P+G RGLM+AVM+A+L+SSLTSIFNS+ST+FT DIW++ R+ AS+ EL++VGR+  +++V I + WIPI+QS+N  +L+ YIQSVTSYL+PP+ A++++A+FWKR NE GAF GLM GLV+GL+R   E A+PP  CG  +  PSVL  +HYLHF I+L  +T I+    SLLT P     T  L +W      ++RE+
Sbjct:   11 ALSQSFSVSDIIVIGAYFLLNVAVGIWSSCRVSRNTLSGYFLAGRDMAWWPIGASLFASSEGSGLFIGLAGTGAAGGIAVAGFEWNATYALLALAWVFVPVYVSSGIVTMPEYLGRRFGGERIRMYLSALSLLLSVFTKISTDLYSGALFVQVCLGWNLYLSTVLMLVVTALYTIAGGLAAVIYTDTLQTFIMIIGAVILTITAFNKIGGYSNLESVYLQAVP-----------SKIIPNT--TCHLPRHDAMHLFRDPVHGDLPWPGMTLGLTIIATWYWCTDQVIVQRSLSAKSLSHAKGASIFASYLKLLPMMFIILPGMISRALYPDTVACVDPEECVKVCGAEVGCSNIAFPKLVIELMPSGLRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWKKYRRGASEKELLLVGRIVTVILVVISVVWIPILQSANSGQLYVYIQSVTSYLAPPVTAIFVMAVFWKRTNEAGAFWGLMVGLVVGLTRMVLEFAFPPPRCGVFDPAPSVLRSMHYLHFAIILCALTAIVVAVISLLTPPPTEEQTRNLTWWTLHNS-TEREI 559          
BLAST of slc5a-2 vs. Ensembl Zebrafish
Match: SLC5A10 (si:dkeyp-9d4.5 [Source:ZFIN;Acc:ZDB-GENE-121214-88])

HSP 1 Score: 478.404 bits (1230), Expect = 3.397e-162
Identity = 283/526 (53.80%), Postives = 385/526 (73.19%), Query Frame = 2
Query:  146 ASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWN 1714
            +SCR +R ++ GYFLAGR M W P+GASLFAS+ GSG FIGLAG+GA+ GIA+A FE NA + LL L W+F+PVY+S+GI TMPEYL +RFGG RIR+YL+ ++LLL +FTKIS DLY+GA+F++  +   LY S +++L+  A++ I GGL AVI+TD +QT IM+IGA  L IT+F ++GGY NL + Y Q++P              +PN    C +P  +AMH  R     +LPWPG+  GLTI + WYWCTDQVIVQR+L+AK+L+ AK   +  ++LK+LPM  I+ PGM SR L+ D VAC  PEEC ++CG E GCS++A+PKLV+E++P+G RGLM+AVM+A+L+SSLTSIFNS+ST+FT DIW++ R+ AS+ EL++VGR+  +++V I + WIPI+QS+N  +L+ YIQSVTSYL+PP+ A++++A+FWKR NE GAF GLM GLV+GL+R   E A+PP  CG  +  PSVL  +HYLHF I+L  +T I+    SLLT P     T  L +W 
Sbjct:    1 SSCRVSRNTLSGYFLAGRDMAWWPIGASLFASSEGSGLFIGLAGTGAAGGIAVAGFEWNATYALLALAWVFVPVYVSSGIVTMPEYLGRRFGGERIRMYLSALSLLLSVFTKISTDLYSGALFVQVCLGWNLYLSTVLMLVVTALYTIAGGLAAVIYTDTLQTFIMIIGAVILTITAFNKIGGYSNLESVYLQAVP-----------SKIIPNT--TCHLPRHDAMHLFRDPVHGDLPWPGMTLGLTIIATWYWCTDQVIVQRSLSAKSLSHAKGASIFASYLKLLPMMFIILPGMISRALYPDTVACVDPEECVKVCGAEVGCSNIAFPKLVIELMPSGLRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWKKYRRGASEKELLLVGRIVTVILVVISVVWIPILQSANSGQLYVYIQSVTSYLAPPVTAIFVMAVFWKRTNEAGAFWGLMVGLVVGLTRMVLEFAFPPPRCGVFDPAPSVLRSMHYLHFAIILCALTAIVVAVISLLTPPPTEEQTRNLTWWT 513          
BLAST of slc5a-2 vs. Ensembl Xenopus
Match: SLC5A10 (solute carrier family 5 (sodium/sugar cotransporter), member 10 [Source:NCBI gene;Acc:101732547])

HSP 1 Score: 514.998 bits (1325), Expect = 1.302e-174
Identity = 324/666 (48.65%), Postives = 446/666 (66.97%), Query Frame = 2
Query:   71 VGKLEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRK-----EYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            V +    DI V+  YF+L + VG+W+SCR NR ++ GYFLAGR M W P+GASLFAS+ GSG FIGLAG+GA+ GIA+A FE NA +ILL L WIF+PVYIS+GI TMPE+L++RFGG RI++YL+ ++LLL +FTKIS DLY+GA+FI+  +   LY S +++L+  A++ I GGL AVI+TD +QTVIM++GA  L IT+F ++GGY+NL   Y Q++P              VPN    C +P  +AMH  R     +LPWPG+ FGLTI + WYWCTDQVIVQR+L+AKNL+ AK+G +L ++LKMLPM  I+ PGM SR L+ D VAC +PE C+ +CG E GCS++AYPKLV+E++P+G RGLM+AVM+A+L+SSLTSIFNS+ST+FT DIW+++RK+A++ EL++VGR+  +V+VAI + WIPI+QS+N  +L+ YIQSVTSYL+PP+ AV+ LA+FW+R NE+GAF GLM GL++GL R   E  YP   CG  +  PSVL  VHYLHF I+L  +T+ + V  SLLT P  +     L +W   +     E + R+V   +++    ND   +               P  R      C   +      +P+              SI+EDP W  V     + LI + IF++ ++A
Sbjct:   13 VQQFNISDIIVIAAYFLLNVAVGIWSSCRVNRNTLSGYFLAGRNMAWWPIGASLFASSEGSGLFIGLAGTGAAGGIAVAGFEWNATYILLALAWIFVPVYISSGIVTMPEFLQRRFGGERIQMYLSGLSLLLSVFTKISTDLYSGALFIQVCLGWNLYLSTVLMLVVTALYTIAGGLAAVIYTDALQTVIMIVGAVILTITAFNKIGGYQNLEVAYAQAVPS-----------QIVPNT--TCHLPRHDAMHLFRDPVSGDLPWPGMTFGLTILAAWYWCTDQVIVQRSLSAKNLSHAKAGSILASYLKMLPMIFIIMPGMISRALYPDSVACVVPEVCQEVCGTEAGCSNIAYPKLVIELMPSGLRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWRKIRKNANEKELLLVGRIVTVVLVAISVVWIPILQSANSGQLYVYIQSVTSYLAPPVTAVFALAVFWRRANEQGAFWGLMVGLIVGLVRMILEFVYPFPRCGIPDERPSVLKDVHYLHFAIILCALTVGVVVGVSLLTEPPLQSQIKNLTWWTISQGRAPAEITLRKVSTRSQSTQGANDAPTNCS-------------PRSRSWSTLFCSTPEATVESPKPL-----------PPRSIKEDPFWARVCCINAIILICVNIFFYAYFA 641          
BLAST of slc5a-2 vs. Ensembl Xenopus
Match: SLC5A11 (solute carrier family 5 (sodium/inositol cotransporter), member 11 [Source:NCBI gene;Acc:100488766])

HSP 1 Score: 516.153 bits (1328), Expect = 1.386e-174
Identity = 335/672 (49.85%), Postives = 453/672 (67.41%), Query Frame = 2
Query:   77 KLEGGDIGVVIGYFVLVLGVGLWASCRN-RGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEV--DAKK----------YIDVTKGSNLPLPWYRKAINWVCGIEDLKNAK-DQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             LE  DI V++ YFV VLGVGLW+ CR  RG+V GYFLAG+ M W PVGASLFASN+GSGHFIGLAGSGA+SGIA+  +E N +F +L L W+FLP+YIS G+ TMPEYL++RFGG RI+I+LA++ L +YIFTKIS D+YAGA+FI+Q++Q  LY +VI LL+  A++ + GGL AVI+TD +QTVIM+IGA  LM  SF+E+GG+E L  +YFQ++P T  +   ST           CGIP ++A H  R    ++LPWPGV+ G+TI S+WYWCTDQVIVQR+L+AKNL+ AK G LL A LK+LP++++V PGM SRVLFTD+VAC  PE CK ICG   GCSD+AYPK+V+E+LPTG RGLM++VM+A+L+SSLTSIFNSASTIFT D+W+ +R  +++ ELMIVGRVFVL +V + I WIP+VQ+S   +LF YIQS++SYL PP+  V++   FWKR NEKGAF G+  GL +GL R   +  Y    C + +  P V+  VHYL+  ++L  +TLI+ V  S+ T P  ++    L  W  R +       + T+N   +N   V  D  +          Y D+   +       +K I W+CG++  K  K DQ   +  E  E+      + E P  K ++NT  +  ++  +F W ++ 
Sbjct:   22 SLETVDIVVLVLYFVFVLGVGLWSICRTKRGTVKGYFLAGKDMAWWPVGASLFASNVGSGHFIGLAGSGAASGIAVTAYEWNGLFCVLALAWLFLPIYISAGVTTMPEYLQRRFGGKRIQIFLAILYLFIYIFTKISVDMYAGALFIQQALQWDLYVAVIGLLVITAIYTVAGGLAAVIYTDTLQTVIMIIGALILMAYSFIEIGGFEALQEKYFQAIPNT--HSGNST-----------CGIPREDAFHIFRDPVTSDLPWPGVLVGMTIPSLWYWCTDQVIVQRSLSAKNLSHAKGGSLLAASLKVLPLFMMVLPGMISRVLFTDQVACADPELCKEICGNPSGCSDIAYPKMVIELLPTGLRGLMMSVMIAALMSSLTSIFNSASTIFTMDLWRHIRPRSTEWELMIVGRVFVLALVVVSILWIPLVQASQGGQLFIYIQSISSYLQPPVAVVFIAGCFWKRTNEKGAFWGMTIGLAVGLIRMVLDFIYVAPQCDQPDTRPGVVKYVHYLYLSMILGLLTLIVVVAVSIWTEPPSKQMISRLT-WFSRFDTEVVGPVETTDNSPAQNGISVMEDISEKPHATSTDAIYNDIIDDNPSSSSCLKKTILWLCGMDSRKGDKHDQAPPSTLEPAEVL-----LYEGPCLKQILNTSLILCMSAGVFLWAYFG 674          
BLAST of slc5a-2 vs. Ensembl Xenopus
Match: SLC5A10 (solute carrier family 5 (sodium/sugar cotransporter), member 10 [Source:NCBI gene;Acc:101732547])

HSP 1 Score: 514.227 bits (1323), Expect = 9.482e-174
Identity = 329/675 (48.74%), Postives = 453/675 (67.11%), Query Frame = 2
Query:   71 VGKLEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAP-----MDRRHTDGLLFWNCRKEYSKREVDKGTE-NPCYENDFEVDAKKYIDVTKG---SNLPLPWYRKAINWV-----CGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            V +    DI V+  YF+L + VG+W+SCR NR ++ GYFLAGR M W P+GASLFAS+ GSG FIGLAG+GA+ GIA+A FE NA +ILL L WIF+PVYIS+GI TMPE+L++RFGG RI++YL+ ++LLL +FTKIS DLY+GA+FI+  +   LY S +++L+  A++ I GGL AVI+TD +QTVIM++GA  L IT+F ++GGY+NL   Y Q++P              VPN    C +P  +AMH  R     +LPWPG+ FGLTI + WYWCTDQVIVQR+L+AKNL+ AK+G +L ++LKMLPM  I+ PGM SR L+ D VAC +PE C+ +CG E GCS++AYPKLV+E++P+G RGLM+AVM+A+L+SSLTSIFNS+ST+FT DIW+++RK+A++ EL++VGR+  +V+VAI + WIPI+QS+N  +L+ YIQSVTSYL+PP+ AV+ LA+FW+R NE+GAF GLM GL++GL R   E  YP   CG  +  PSVL  VHYLHF I+L  +T+ + V  SLLT P     +   H   L  ++            G E +P    + E +   Y +       S   L    +   WV     CG++ L   +  P  T +  + +     SI+EDP W  V     + LI + IF++ ++A
Sbjct:   17 VQQFNISDIIVIAAYFLLNVAVGIWSSCRVNRNTLSGYFLAGRNMAWWPIGASLFASSEGSGLFIGLAGTGAAGGIAVAGFEWNATYILLALAWIFVPVYISSGIVTMPEFLQRRFGGERIQMYLSGLSLLLSVFTKISTDLYSGALFIQVCLGWNLYLSTVLMLVVTALYTIAGGLAAVIYTDALQTVIMIVGAVILTITAFNKIGGYQNLEVAYAQAVPS-----------QIVPNT--TCHLPRHDAMHLFRDPVSGDLPWPGMTFGLTILAAWYWCTDQVIVQRSLSAKNLSHAKAGSILASYLKMLPMIFIIMPGMISRALYPDSVACVVPEVCQEVCGTEAGCSNIAYPKLVIELMPSGLRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWRKIRKNANEKELLLVGRIVTVVLVAISVVWIPILQSANSGQLYVYIQSVTSYLAPPVTAVFALAVFWRRANEQGAFWGLMVGLIVGLVRMILEFVYPFPRCGIPDERPSVLKDVHYLHFAIILCALTVGVVVGVSLLTEPPLQSQVSSCHEQSLRSFHVGAVDCTFGASSGFESDPADPQEAEANGTPYKNAQVSAFPSATTLCRSARCTPWVDLSKFCGLDCLLIGECTPEATVESPKPLPP--RSIKEDPFWARVCCINAIILICVNIFFYAYFA 676          
BLAST of slc5a-2 vs. Ensembl Xenopus
Match: SLC5A9 (solute carrier family 5 member 9 [Source:NCBI gene;Acc:100495397])

HSP 1 Score: 510.375 bits (1313), Expect = 2.612e-172
Identity = 323/664 (48.64%), Postives = 444/664 (66.87%), Query Frame = 2
Query:  128 LGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNE--LFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTEN-----------PCYENDFEVDAKKYIDVTKGSNL-----------PLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            LGVG+W+S R +RG+VGGYFLAGR M W P+GASL +SN+GSG FIGLAGS A+ G+A+  FE NA ++L+ LGWIF+PVYI++G+ TMPEYLKKRFGG RIRIY++V++L+LYIFTKIS D+Y+GA+FI+ S+   +Y S +ILL   A++ I GGLTAVI+TD +QTVIM+ GA  LM  SF ++G Y  L  +Y +++PK        T  N        C +P  +A H  R     +LPWPG+IFGLT+ + W WCTDQVIVQR+LAAKNL+ AK G +L  +LK+LPM+ +V PGM S+ LF DEV C  P EC + CG E  CS++AYPKLV+ +LP G +GLM+AV++A+L+SSLTSIFNSASTIFT D+W R+R++A + ELMIVGRVF+L++V I I WIPI+Q++N   LF Y+QSVTSYLSPPI A+++LA+F KR NE GAF GL+ GL++GL+R   +  Y    CGEE++ PSVL  VHYL+F I LFG+T I+ V  SL T  +  +    + +W       K +++   +            P  E +    +   +DV + S++              W++K   W CGI      K    L+++E + +Q+   SI+E P W+ + +   L L+ I +F WG++ 
Sbjct:   33 LGVGIWSSIRASRGTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGSAAAGGLAVGGFEWNASWVLVALGWIFVPVYIASGVVTMPEYLKKRFGGKRIRIYISVLSLILYIFTKISTDIYSGALFIQVSLGWNIYLSTVILLAVTAIYTIAGGLTAVIYTDTLQTVIMVAGAFVLMFISFEKIGWYPGLEQKYMEAIPKI-------TVANTT------CHLPRADAFHIFRDPLTGDLPWPGLIFGLTVLATWVWCTDQVIVQRSLAAKNLSHAKGGSVLGGYLKILPMFFVVLPGMISKALFPDEVGCVDPAECLKYCGVEVSCSNIAYPKLVITLLPVGLKGLMIAVIMAALMSSLTSIFNSASTIFTLDVWLRIRRNAKEQELMIVGRVFILILVVISILWIPIIQAANSGLLFDYMQSVTSYLSPPITAIFILAIFIKRVNEPGAFWGLIIGLLVGLTRMIMDFVYQAPSCGEEDLRPSVLKDVHYLYFAIFLFGLTAIVCVVISLCTPAIPEQDLARMTWWTRNSPIYKEDLENDLQQEPDPAEIPTIIPVIEKEPAGPSIPAVDVLQNSSVVEDQKEKHEVAKFSWWKKLYFWFCGISIHPEVK----LSSEEQKRLQRKLTSIEEKPLWRYICDINALILLAINVFLWGYFG 679          
BLAST of slc5a-2 vs. Ensembl Xenopus
Match: SLC5A9 (solute carrier family 5 member 9 [Source:NCBI gene;Acc:100495397])

HSP 1 Score: 504.212 bits (1297), Expect = 2.088e-170
Identity = 317/634 (50.00%), Postives = 433/634 (68.30%), Query Frame = 2
Query:  155 RNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGR-VFVLVMVAIGIAWIPIVQSSNE--LFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTK-GSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             +RG+VGGYFLAGR M W P+GASL +SN+GSG FIGLAGS A+ G+A+  FE NA ++L+ LGWIF+PVYI++G+ TMPEYLKKRFGG RIRIY++V++L+LYIFTKIS D+Y+GA+FI+ S+   +Y S +ILL   A++ I GGLTAVI+TD +QTVIM+ GA  LM  SF ++G Y  L  +Y +++PK        T  N        C +P  +A H  R     +LPWPG+IFGLT+ + W WCTDQVIVQR+LAAKNL+ AK G +L  +LK+LPM+ +V PGM S+ LF DEV C  P EC + CG E  CS++AYPKLV+ +LP G +GLM+AV++A+L+SSLTSIFNSASTIFT D+W R+R++A + ELMIVGR VF+L++V I I WIPI+Q++N   LF Y+QSVTSYLSPPI A+++LA+F KR NE GAF GL+ GL++GL+R   +  Y    CGEE++ PSVL  VHYL+F I LFG+T I+ V  SL T  +  +    + +W                +P Y+ D E D ++  D  +  + +P  W++K   W CGI      K    L+++E + +Q+   SI+E P W+ + +   L L+ I +F WG++ 
Sbjct:   33 NDRGTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGSAAAGGLAVGGFEWNASWVLVALGWIFVPVYIASGVVTMPEYLKKRFGGKRIRIYISVLSLILYIFTKISTDIYSGALFIQVSLGWNIYLSTVILLAVTAIYTIAGGLTAVIYTDTLQTVIMVAGAFVLMFISFEKIGWYPGLEQKYMEAIPKI-------TVANTT------CHLPRADAFHIFRDPLTGDLPWPGLIFGLTVLATWVWCTDQVIVQRSLAAKNLSHAKGGSVLGGYLKILPMFFVVLPGMISKALFPDEVGCVDPAECLKYCGVEVSCSNIAYPKLVITLLPVGLKGLMIAVIMAALMSSLTSIFNSASTIFTLDVWLRIRRNAKEQELMIVGRLVFILILVVISILWIPIIQAANSGLLFDYMQSVTSYLSPPITAIFILAIFIKRVNEPGAFWGLIIGLLVGLTRMIMDFVYQAPSCGEEDLRPSVLKDVHYLYFAIFLFGLTAIVCVVISLCTPAIPEQDLARMTWWT-------------RNSPIYKEDLENDLQQEPDPAEIPTIIPFSWWKKLYFWFCGISIHPEVK----LSSEEQKRLQRKLTSIEEKPLWRYICDINALILLAINVFLWGYFG 636          
BLAST of slc5a-2 vs. Ensembl Mouse
Match: Slc5a1 (solute carrier family 5 (sodium/glucose cotransporter), member 1 [Source:MGI Symbol;Acc:MGI:107678])

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 327/659 (49.62%), Postives = 459/659 (69.65%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWAS-CRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKR-EVDKGTENPCYENDFEVDAKKYIDV-TKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V++ YFV+V+ VGLWA    NRG+VGG+FLAGR M W P+GASLFASNIGSGHF+GLAG+GA++GIA+  FE NA+ ++++LGWIF+P+YI  G+ TMPEYL+KRFGG RI+IYL+V++LLLYIFTKISAD+++GAIFI  ++ L +Y ++ ILL   A++ I GGL AVI+TD +QT IML+G+  L   +F E+GGYE  + +Y +++P      NF+  +        +C  P  ++ H  R     ++PWPG+IFGL I ++WYWCTDQVIVQR L+AKN++  K+G  LC +LK+LPM+L+V PGM SR+L+T+++AC +PEEC++ CG   GC+++AYP LV+E++P G RGLML+VM+ASL+SSLTSIFNSAST+FT DI+ ++RK AS+ ELMI GR+F+LV++ I IAW+PIVQS  S +LF YIQS+TSYL PPI AV+LLA+F KR NE+GAF GL+ G +IG+SR  TE AY    C E +  P ++  VHYL+F I+LF I++I  +  S LT P+   H   L  W+ R    +R ++D G      E D   D+K  I++ T+        +R+A +  CG++  K     P +T +E E ++       E P W+ VVN   + L+ + +F   ++A
Sbjct:   25 NAADISVIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAAAGIAMGGFEWNALVLVVVLGWIFVPIYIKAGVVTMPEYLRKRFGGKRIQIYLSVLSLLLYIFTKISADIFSGAIFINLALGLDIYLAIFILLAITALYTITGGLAAVIYTDTLQTAIMLVGSFILTGFAFNEVGGYEAFMDKYMKAIPTKVSNGNFTAKE--------ECYTPRADSFHIFRDPITGDMPWPGLIFGLAILALWYWCTDQVIVQRCLSAKNMSHVKAGCTLCGYLKLLPMFLMVMPGMISRILYTEKIACVLPEECQKYCGTPVGCTNIAYPTLVVELMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYTKIRKKASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFCKRVNEQGAFWGLILGFLIGISRMITEFAYGTGSCMEPSNCPKIICGVHYLYFAIILFVISVITILIISFLTKPIPDVHLYRLC-WSLRNSKEERIDLDAGE-----EEDIPEDSKDTIEIDTEAPQKKKGCFRRAYDLFCGLDQDKG----PKMTKEEEEAMKMKMTDTSEKPLWRTVVNINGIILLAVAVFCHAYFA 665          
BLAST of slc5a-2 vs. Ensembl Mouse
Match: Slc5a9 (solute carrier family 5 (sodium/glucose cotransporter), member 9 [Source:MGI Symbol;Acc:MGI:2140201])

HSP 1 Score: 508.449 bits (1308), Expect = 1.708e-171
Identity = 329/658 (50.00%), Postives = 443/658 (67.33%), Query Frame = 2
Query:  128 LGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFW--NCRKEYSKREVDKGTENPCYENDFEVDAKKYID----------VTKGSNLP----LPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            L VG+W+S R +RG+VGGYFLAGR M W P+GASL +SN+GSG FIGLAG+GA+ G+A+  FE NA F+LL LGWIF+PVYI+ G+ TMP+YLKKRFGG RI++Y++V++L+LYIFTKIS D+++GA+FI+ ++   LY S +ILL+  AV+ I GGLTAVI+TD +QTVIM+ GA  LM   F E+G Y  L   Y Q++P T            VPN    C +P  +A H +R   + ++PWPG+IFGLT+ + W WCTDQVIVQR+LAAKNL+ AK G +L  +LK+LPM+ IV PGM SR L+ DEVAC  P+ C+R+CG   GCS++AYPKLV+ ++P G RGLM+AV++A+L+SSLTSIFNS+ST+F  D+WQR R+ AS+ ELM+VGR+FV+ +V I I WIPI+QSSN  +LF YIQS+TSYL+PPI A++LLA+F KR NE GAF GLM GLV+G+ R   E +Y    CGE +  P+VL   HYL+F +LL G+T II V  S  T P+       L +W  NC     +++      N   +N   +  +  ++           T+G   P      W +   NW CG   L  A  Q +  A++    QKL  SI+E+P W+ V N   + L+ I IF WG++A
Sbjct:   45 LAVGIWSSIRASRGTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATFLLLALGWIFVPVYIAAGVVTMPQYLKKRFGGQRIQVYMSVLSLILYIFTKISTDIFSGALFIQMALGWNLYLSTVILLVVTAVYTIAGGLTAVIYTDALQTVIMVGGALVLMFLGFQEVGWYPGLQQLYRQAIPNT-----------TVPNT--TCHLPRPDAFHMLRDPVNGDIPWPGLIFGLTVLATWCWCTDQVIVQRSLAAKNLSHAKGGSVLGGYLKILPMFFIVMPGMISRALYPDEVACVDPDICQRVCGARVGCSNIAYPKLVMALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFAIDVWQRFRRQASEQELMVVGRLFVVFLVVISILWIPIIQSSNSGQLFDYIQSITSYLAPPITALFLLAIFCKRVNEPGAFWGLMFGLVVGILRMILEFSYSAPACGEMDRRPAVLKDFHYLYFALLLCGLTAIIIVVISFFTEPIPDDKLARLTWWTRNCAVSDLQKKTSVSVNNTEDDNSPGLAGRPVVEGPAGDEEEANTTQGPEQPGALHRSWGKWLWNWFCG---LSGAPQQALSPAEKAVLEQKL-TSIEEEPLWRRVCNINAIILLAINIFLWGYFA 685          
BLAST of slc5a-2 vs. Ensembl Mouse
Match: Slc5a9 (solute carrier family 5 (sodium/glucose cotransporter), member 9 [Source:MGI Symbol;Acc:MGI:2140201])

HSP 1 Score: 508.449 bits (1308), Expect = 1.708e-171
Identity = 329/658 (50.00%), Postives = 443/658 (67.33%), Query Frame = 2
Query:  128 LGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFW--NCRKEYSKREVDKGTENPCYENDFEVDAKKYID----------VTKGSNLP----LPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            L VG+W+S R +RG+VGGYFLAGR M W P+GASL +SN+GSG FIGLAG+GA+ G+A+  FE NA F+LL LGWIF+PVYI+ G+ TMP+YLKKRFGG RI++Y++V++L+LYIFTKIS D+++GA+FI+ ++   LY S +ILL+  AV+ I GGLTAVI+TD +QTVIM+ GA  LM   F E+G Y  L   Y Q++P T            VPN    C +P  +A H +R   + ++PWPG+IFGLT+ + W WCTDQVIVQR+LAAKNL+ AK G +L  +LK+LPM+ IV PGM SR L+ DEVAC  P+ C+R+CG   GCS++AYPKLV+ ++P G RGLM+AV++A+L+SSLTSIFNS+ST+F  D+WQR R+ AS+ ELM+VGR+FV+ +V I I WIPI+QSSN  +LF YIQS+TSYL+PPI A++LLA+F KR NE GAF GLM GLV+G+ R   E +Y    CGE +  P+VL   HYL+F +LL G+T II V  S  T P+       L +W  NC     +++      N   +N   +  +  ++           T+G   P      W +   NW CG   L  A  Q +  A++    QKL  SI+E+P W+ V N   + L+ I IF WG++A
Sbjct:   45 LAVGIWSSIRASRGTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATFLLLALGWIFVPVYIAAGVVTMPQYLKKRFGGQRIQVYMSVLSLILYIFTKISTDIFSGALFIQMALGWNLYLSTVILLVVTAVYTIAGGLTAVIYTDALQTVIMVGGALVLMFLGFQEVGWYPGLQQLYRQAIPNT-----------TVPNT--TCHLPRPDAFHMLRDPVNGDIPWPGLIFGLTVLATWCWCTDQVIVQRSLAAKNLSHAKGGSVLGGYLKILPMFFIVMPGMISRALYPDEVACVDPDICQRVCGARVGCSNIAYPKLVMALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFAIDVWQRFRRQASEQELMVVGRLFVVFLVVISILWIPIIQSSNSGQLFDYIQSITSYLAPPITALFLLAIFCKRVNEPGAFWGLMFGLVVGILRMILEFSYSAPACGEMDRRPAVLKDFHYLYFALLLCGLTAIIIVVISFFTEPIPDDKLARLTWWTRNCAVSDLQKKTSVSVNNTEDDNSPGLAGRPVVEGPAGDEEEANTTQGPEQPGALHRSWGKWLWNWFCG---LSGAPQQALSPAEKAVLEQKL-TSIEEEPLWRRVCNINAIILLAINIFLWGYFA 685          
BLAST of slc5a-2 vs. Ensembl Mouse
Match: Slc5a9 (solute carrier family 5 (sodium/glucose cotransporter), member 9 [Source:MGI Symbol;Acc:MGI:2140201])

HSP 1 Score: 508.449 bits (1308), Expect = 1.708e-171
Identity = 329/658 (50.00%), Postives = 443/658 (67.33%), Query Frame = 2
Query:  128 LGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFW--NCRKEYSKREVDKGTENPCYENDFEVDAKKYID----------VTKGSNLP----LPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            L VG+W+S R +RG+VGGYFLAGR M W P+GASL +SN+GSG FIGLAG+GA+ G+A+  FE NA F+LL LGWIF+PVYI+ G+ TMP+YLKKRFGG RI++Y++V++L+LYIFTKIS D+++GA+FI+ ++   LY S +ILL+  AV+ I GGLTAVI+TD +QTVIM+ GA  LM   F E+G Y  L   Y Q++P T            VPN    C +P  +A H +R   + ++PWPG+IFGLT+ + W WCTDQVIVQR+LAAKNL+ AK G +L  +LK+LPM+ IV PGM SR L+ DEVAC  P+ C+R+CG   GCS++AYPKLV+ ++P G RGLM+AV++A+L+SSLTSIFNS+ST+F  D+WQR R+ AS+ ELM+VGR+FV+ +V I I WIPI+QSSN  +LF YIQS+TSYL+PPI A++LLA+F KR NE GAF GLM GLV+G+ R   E +Y    CGE +  P+VL   HYL+F +LL G+T II V  S  T P+       L +W  NC     +++      N   +N   +  +  ++           T+G   P      W +   NW CG   L  A  Q +  A++    QKL  SI+E+P W+ V N   + L+ I IF WG++A
Sbjct:   45 LAVGIWSSIRASRGTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATFLLLALGWIFVPVYIAAGVVTMPQYLKKRFGGQRIQVYMSVLSLILYIFTKISTDIFSGALFIQMALGWNLYLSTVILLVVTAVYTIAGGLTAVIYTDALQTVIMVGGALVLMFLGFQEVGWYPGLQQLYRQAIPNT-----------TVPNT--TCHLPRPDAFHMLRDPVNGDIPWPGLIFGLTVLATWCWCTDQVIVQRSLAAKNLSHAKGGSVLGGYLKILPMFFIVMPGMISRALYPDEVACVDPDICQRVCGARVGCSNIAYPKLVMALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFAIDVWQRFRRQASEQELMVVGRLFVVFLVVISILWIPIIQSSNSGQLFDYIQSITSYLAPPITALFLLAIFCKRVNEPGAFWGLMFGLVVGILRMILEFSYSAPACGEMDRRPAVLKDFHYLYFALLLCGLTAIIIVVISFFTEPIPDDKLARLTWWTRNCAVSDLQKKTSVSVNNTEDDNSPGLAGRPVVEGPAGDEEEANTTQGPEQPGALHRSWGKWLWNWFCG---LSGAPQQALSPAEKAVLEQKL-TSIEEEPLWRRVCNINAIILLAINIFLWGYFA 685          
BLAST of slc5a-2 vs. Ensembl Mouse
Match: Slc5a2 (solute carrier family 5 (sodium/glucose cotransporter), member 2 [Source:MGI Symbol;Acc:MGI:2181411])

HSP 1 Score: 502.286 bits (1292), Expect = 2.777e-169
Identity = 322/661 (48.71%), Postives = 459/661 (69.44%), Query Frame = 2
Query:   89 GDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNP-VPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVD----KGTENPCYENDFEVDAKKYIDVTKGSNLPLP-WYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             DI V+  YF+LV+GVGLW+  R NRG+VGGYFLAGR M W PVGASLFASNIGSGHF+GLAG+GA+SG+A+A FE NA+F++L+LGW+F+PVY++ G+ TMP+YL+KRFGG RIR+YL+V++L LYIFTKIS D+++GA+FI+Q++   +Y SVI LL    ++ + GGL A+++TD +QT ++L GA  L   +F E+GGY  L  +Y       G   + +  ++P V N    C  P  ++ H +R     +LPWP ++ GLTI S WYWC+DQVIVQR LA KNLT  K+G +LC +LK++PM+L+V PGM SR+L+ DEVAC +PE CKR+CG E GCS++AYP+LV++++P G RGLMLAVMLA+L+SSL SIFNS+ST+FT DI+ RLR  A D EL++VGR++V+ +VA+ +AW+P+VQ++   +LF YIQSV+SYL+PP+ AV++LALF  R NEKGAF GL+ GL++GL+R   E  +    C   +  P++  +VHYL+F I+LF  + I+++  SL TAP+ ++H   L+F     +  + ++D    +G      +N  +  A +  +V      P P   R+ + W CG+   K+    P  T +E+    +    I EDP+W  VVN   L ++T+ +F WGFYA
Sbjct:   22 ADILVIAAYFLLVIGVGLWSMFRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFVPVYLTAGVITMPQYLRKRFGGHRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVILAGAFILTGYAFHEVGGYSGLFDKYL------GAMTSLTVSKDPSVGNISSTCYQPRPDSYHLLRDPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRCLAGKNLTHIKAGCILCGYLKLMPMFLMVMPGMISRILYPDEVACVVPEVCKRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDKELLLVGRLWVVFIVAVSVAWLPVVQAAQGGQLFDYIQSVSSYLAPPVSAVFVLALFVPRVNEKGAFWGLVGGLLMGLARLIPEFFFGSGSCVRPSACPALFCRVHYLYFAIILFICSGILTLGISLCTAPIPQKHLHRLVFSLRHSKEEREDLDADELEGPAPAPVQNGGQECAMEMEEVQS----PAPGLLRRCLLWFCGMS--KSGSGSPPPTTEEVAATTRRLEDISEDPRWARVVNLNALLMMTVAVFLWGFYA 670          
BLAST of slc5a-2 vs. UniProt/SwissProt
Match: sp|A8WHP3|SC5A9_DANRE (Sodium/glucose cotransporter 4 OS=Danio rerio OX=7955 GN=slc5a9 PE=2 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 332/659 (50.38%), Postives = 462/659 (70.11%), Query Frame = 2
Query:   80 LEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLP-WYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            LE  DI VV+ YFV VL VG+W+S R NRG+VGGYFLAGR M W P+GASL +SN+GSG FIGLAG+GA+ G+A+  FE NA ++L+ LGWIF+PVYIS G+ TMPEYL+KRFGG RIRIY++V++L+LYI TKIS D+++GA+FI+ S+   LY S +ILL   A++ I GGLTAVI+TD +QTVIM+IGA  LM  +F ++G YE L+ +Y ++ P              VPN    C +P  +A H  R     ++PWPG+IFGLT+ + W WCTDQVIVQR+L+AKNL+ AK+G +L  +LK+ PM+ +V PGM SR L+ DEVAC  P+EC++ICG + GCS++AYPKLV+E++P G RGLM+AVM+A+L+SSLTSIFNS+ST+FT DIWQR+R  AS+ ELM+VGRVF+L++VA+ I WIP++Q++N  +LF YIQ++TS+LSPPI  V+++A+FW R NE+GAF GLM GLV+G+ R   E  Y    CGE ++ PS+L  VHYL+F ++L  +T++I    SL TAP+  +H   L +W    +  + E++     P   +    +       ++GS+   P W+++A  W+CG+           LT +E + ++K   SI+ED  WK V N   L L+T  +F WG++A
Sbjct:   23 LEAADIAVVVVYFVFVLAVGIWSSIRANRGTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNAAWVLIALGWIFVPVYISAGVVTMPEYLRKRFGGQRIRIYMSVLSLILYILTKISTDIFSGALFIQVSLGWDLYLSTVILLAVTALYTIAGGLTAVIYTDALQTVIMVIGAFVLMFIAFDKVGWYEGLLVQYEKAAPAL-----------TVPNT--TCHLPRSDAFHIFRDPVTGDIPWPGLIFGLTVLATWVWCTDQVIVQRSLSAKNLSHAKAGSVLGGYLKVFPMFFVVMPGMISRALYPDEVACVDPDECQKICGAKVGCSNIAYPKLVVELMPVGMRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWQRIRPRASEKELMVVGRVFILLLVALSIVWIPVIQTANSGQLFDYIQAITSFLSPPITTVFIMAIFWGRVNEQGAFWGLMVGLVVGMVRMIMEFVYGTPSCGETDLRPSLLKDVHYLYFALILLALTVLIITAVSLCTAPIPEKHLVRLTWWTRHSKEERVELEDPWAKPAGSDLSTTE-------SEGSDEDAPAWWKRAGMWLCGLSQTTKQD----LTEEERQALEKKLTSIEEDHMWKTVCNVNALILLTANVFLWGYFA 657          
BLAST of slc5a-2 vs. UniProt/SwissProt
Match: sp|P53790|SC5A1_RAT (Sodium/glucose cotransporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a1 PE=2 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 329/661 (49.77%), Postives = 458/661 (69.29%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWAS-CRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKR-EVDKGTENPCYE---NDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V++ YFV+V+ VGLWA    NRG+VGG+FLAGR M W P+GASLFASNIGSGHF+GLAG+GA++GIA+  FE NA+  +++LGW+F+P+YI  G+ TMPEYL+KRFGG RI+IYL+V++LLLYIFTKISAD+++GAIFI  ++ L +Y ++ ILL   A++ I GGL AVI+TD +QT IML+G+  L   +F E+GGYE  + +Y +++P      N +  +        +C  P  ++ H  R     ++PWPG+IFGL+I ++WYWCTDQVIVQR L+AKN++  K+G  LC +LK+LPM+L+V PGM SR+L+TD++AC +P ECK+ CG   GC+++AYP LV+E++P G RGLML+VM+ASL+SSLTSIFNSAST+FT DI+ ++RK AS+ ELMI GR+F+LV++ I IAW+PIVQS  S +LF YIQS+TSYL PPI AV+LLA+F KR NE GAF GL+ G +IG+SR  TE AY    C E +  P ++  VHYL+F I+LF I+++  +  SLLT P+   H   L  W+ R    +R ++D G E P  E   +  E+DA+      KG       +RKA +  CG++  K     P +T +E E ++       E P W+ VVN   + L+ + +F   ++A
Sbjct:   25 NAADISVIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAAAGIAMGGFEWNALVFVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGKRIQIYLSVLSLLLYIFTKISADIFSGAIFINLALGLDIYLAIFILLAITALYTITGGLAAVIYTDTLQTAIMLVGSFILTGFAFREVGGYEAFMDKYMKAIPTLVSDGNITVKE--------ECYTPRADSFHIFRDPITGDMPWPGLIFGLSILALWYWCTDQVIVQRCLSAKNMSHVKAGCTLCGYLKLLPMFLMVMPGMISRILYTDKIACVLPSECKKYCGTPVGCTNIAYPTLVVELMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYTKIRKGASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFCKRVNEPGAFWGLILGFLIGISRMITEFAYGTGSCMEPSNCPKIICGVHYLYFAIILFAISVVTVLVISLLTKPIPDVHLYRLC-WSLRNSTEERIDLDAGEEEPVEEDPKDTIEIDAEAP-QKEKGC------FRKAYDLFCGLDQDKG----PKMTKEEEEAMKLKMTDTSEKPLWRTVVNINGIILLAVAVFCHAYFA 665          
BLAST of slc5a-2 vs. UniProt/SwissProt
Match: sp|P53791|SC5A1_SHEEP (Sodium/glucose cotransporter 1 OS=Ovis aries OX=9940 GN=SLC5A1 PE=2 SV=1)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 327/660 (49.55%), Postives = 458/660 (69.39%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWAS-CRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKR-EVDKGTEN--PCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V++ YFV+V+ VGLWA    NRG+VGG+FLAGR M W P+GASLFASNIGSGHF+GLAG+GA++GIA   FE NA+ ++++LGW+F+P+YI  G+ TMPEYL+KRFGG RI++YL+V++L+LYIFTKISAD+++GAIFI  ++ L LY ++ ILL   A++ I GGL AVI+TD +QTVIML+G+  L   +F E+GGY   VT+Y  ++P    Y N +  +        +C  P  ++ H  R     +LPWPG+IFGLTI S+WYWCTDQVIVQR L+AKN++  K+G ++C ++K+LPM+L+V PGM SR+LFT++VAC +P EC++ CG + GC+++AYP LV+E++P G RGLML+VMLASL+SSLTSIFNSAST+FT DI+ ++RK AS+ ELMI GR+F+LV++ + IAW+PIVQS  S +LF YIQS+TSYL PPI AV+LLA+F KR NE GAF GL+ G +IG+SR  TE AY    C E +  P+++  VHYL+F I+LF IT+I+ +  SL T P+   H   L  W+ R    +R ++D   E+     E+  E+D       T+ S       R+A +  CG++  K     P +T +E   ++       E   W++VVN   + L+ + +F   ++A
Sbjct:   25 NAADISVIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAAAGIATGGFEWNALILVVLLGWVFVPIYIKAGVVTMPEYLRKRFGGQRIQVYLSVLSLVLYIFTKISADIFSGAIFINLALGLDLYLAIFILLAITALYTITGGLAAVIYTDTLQTVIMLLGSFILTGFAFHEVGGYSAFVTKYMNAIPTVTSYGNTTVKK--------ECYTPRADSFHIFRDPLKGDLPWPGLIFGLTIISLWYWCTDQVIVQRCLSAKNMSHVKAGCIMCGYMKLLPMFLMVMPGMISRILFTEKVACTVPSECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYTKIRKKASEKELMIAGRLFMLVLIGVSIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFCKRVNEPGAFWGLIIGFLIGVSRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFVITIIVILAISLFTKPIADVHLYRLC-WSLRNSKEERIDLDAEDEDIQDAREDALEID-------TEASEEKKGCLRQAYDMFCGLDQQKG----PKMTKEEEAAMKLKMTDTSEKRLWRMVVNINGIILLAVAVFCHAYFA 664          
BLAST of slc5a-2 vs. UniProt/SwissProt
Match: sp|P11170|SC5A1_RABIT (Sodium/glucose cotransporter 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC5A1 PE=1 SV=1)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 330/662 (49.85%), Postives = 463/662 (69.94%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWAS-CRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKR-EVDKGTEN----PCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V++ YF++V+ VGLWA    NRG+VGG+FLAGR M W P+GASLFASNIGSGHF+GLAG+GA+SGIA   FE NA+ ++++LGW+F+P+YI  G+ TMPEYL+KRFGG RI+IYL++++LLLYIFTKISAD+++GAIFI+ ++ L +Y ++IILL+   ++ I GGL AVI+TD +QT IM++G+  L   +F E+GGYE    +Y +++P    Y N S     +P K   C  P ++A H  R +   ++PWPG++FG++I ++WYWCTDQVIVQR L+AKNL+  K+G +LC +LK++PM+LIV  GM SR+L+TD+VAC +P EC+R CG   GC+++A+P LV+E++P G RGLML+VM+ASL+SSLTSIFNSAST+FT DI+ ++RK AS+ ELMI GR+F+L ++ I IAW+PIVQS  S +LF YIQS+TSYL PPI AV+LLA+FWKR NE GAF GL+ G +IG+SR  TE AY    C E +  P+++  VHYL+F I+LF I++I  V  SL T P+   H   L  W+ R    +R ++D G E+    P    D EV  KK     KG      ++R+A +  CG++  K     P +T +E   ++       E P W+ VVN   + L+ + +F + ++A
Sbjct:   25 NAADISVIVIYFLVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIATGGFEWNALIMVVVLGWVFVPIYIRAGVVTMPEYLQKRFGGKRIQIYLSILSLLLYIFTKISADIFSGAIFIQLTLGLDIYVAIIILLVITGLYTITGGLAAVIYTDTLQTAIMMVGSVILTGFAFHEVGGYEAFTEKYMRAIPSQISYGNTS-----IPQK---CYTPREDAFHIFRDAITGDIPWPGLVFGMSILTLWYWCTDQVIVQRCLSAKNLSHVKAGCILCGYLKVMPMFLIVMMGMVSRILYTDKVACVVPSECERYCGTRVGCTNIAFPTLVVELMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYTKIRKKASEKELMIAGRLFMLFLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLVLGFLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFVISIITVVVVSLFTKPIPDVHLYRLC-WSLRNSKEERIDLDAGEEDIQEAPEEATDTEVPKKK-----KG------FFRRAYDLFCGLDQDKG----PKMTKEEEAAMKLKLTDTSEHPLWRTVVNINGVILLAVAVFCYAYFA 662          
BLAST of slc5a-2 vs. UniProt/SwissProt
Match: sp|Q8C3K6|SC5A1_MOUSE (Sodium/glucose cotransporter 1 OS=Mus musculus OX=10090 GN=Slc5a1 PE=1 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 1.896e-178
Identity = 326/662 (49.24%), Postives = 459/662 (69.34%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWAS-CRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLF---WNCRKEYSKR-EVDKGTENPCYENDFEVDAKKYIDV-TKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V++ YFV+V+ VGLWA    NRG+VGG+FLAGR M W P+GASLFASNIGSGHF+GLAG+GA++GIA+  FE NA+ ++++LGWIF+P+YI  G+ TMPEYL+KRFGG RI+IYL+V++LLLYIFTKISAD+++GAIFI  ++ L +Y ++ ILL   A++ I GGL AVI+TD +QT IML+G+  L   +F E+GGYE  + +Y +++P      NF+  +        +C  P  ++ H  R     ++PWPG+IFGL I ++WYWCTDQVIVQR L+AKN++  K+   LC +LK+LPM+L+V PGM SR+L+T+++AC +PEEC++ CG   GC+++AYP LV+E++P G RGLML+VM+ASL+SSLTSIFNSAST+FT DI+ ++RK AS+ ELMI GR+F+LV++ I IAW+PIVQS  S +LF YIQS+TSYL PPI AV+LLA+F KR NE+GAF GL+ G +IG+SR  TE AY    C E +  P ++  VHYL+F I+LF I++I  +  S LT P+   H    L+   W+ R    +R ++D G      E D   D+K  I++ T+        +R+A +  CG++  K     P +T +E E ++       E P W+ VVN   + L+ + +F   ++A
Sbjct:   25 NAADISVIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAAAGIAMGGFEWNALVLVVVLGWIFVPIYIKAGVVTMPEYLRKRFGGKRIQIYLSVLSLLLYIFTKISADIFSGAIFINLALGLDIYLAIFILLAITALYTITGGLAAVIYTDTLQTAIMLVGSFILTGFAFNEVGGYEAFMDKYMKAIPTKVSNGNFTAKE--------ECYTPRADSFHIFRDPITGDMPWPGLIFGLAILALWYWCTDQVIVQRCLSAKNMSHVKADCTLCGYLKLLPMFLMVMPGMISRILYTEKIACVLPEECQKYCGTPVGCTNIAYPTLVVELMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYTKIRKKASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFCKRVNEQGAFWGLILGFLIGISRMITEFAYGTGSCMEPSNCPKIICGVHYLYFAIILFVISVITILIISFLTKPIPDVH----LYRWCWSLRNSKEERIDLDAGE-----EEDIPEDSKDTIEIDTEAPQKKKGCFRRAYDLFCGLDQDKG----PKMTKEEEEAMKMKMTDTSEKPLWRTVVNINGIILLAVAVFCHAYFA 665          
BLAST of slc5a-2 vs. TrEMBL
Match: A0A0H3YF44 (Slc5a-2 OS=Schmidtea mediterranea OX=79327 GN=slc5a-2 PE=2 SV=1)

HSP 1 Score: 1171.38 bits (3029), Expect = 0.000e+0
Identity = 661/661 (100.00%), Postives = 661/661 (100.00%), Query Frame = 2
Query:   62 MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFIGLAGSGASSGIAIAVFELNAIFILLILGWIFLPVYISTGIFTMPEYLKKRFGGVRIRIYLAVIALLLYIFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGLMLAVMLASLVSSLTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYLHFGILLFGITLIISVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNTICLTLITITIFYWGFYA
Sbjct:    1 MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFIGLAGSGASSGIAIAVFELNAIFILLILGWIFLPVYISTGIFTMPEYLKKRFGGVRIRIYLAVIALLLYIFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGLMLAVMLASLVSSLTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYLHFGILLFGITLIISVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNTICLTLITITIFYWGFYA 661          
BLAST of slc5a-2 vs. TrEMBL
Match: V4AV99 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_203052 PE=3 SV=1)

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 391/659 (59.33%), Postives = 500/659 (75.87%), Query Frame = 2
Query:   77 KLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSV-QLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEE--NIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            +L  GDI V++GYFV V+ VG+ +SCRNRGS+ G+FLAGR MHWIP+GASLFASNIGSGHF+GLAGSGA+ GI IAVFELNAIFIL+ILGWIF+PVY + G++TMPEYL+KRFGG RIRIYL+V+ALLLY+FTKISADLY+GAIF+ Q++ +L LY +VIILL  AA+F I GGLTAVIWTDFIQTVIML+G   LMI SFV++GGYENLV  YF++ P T +  N     N     Y DCG P  NAM+F+R++ D +LPWPG+ FGLTISSIWYWC+DQVIVQRALAAKN++ AK+G +L  +LK LP++LIVFPGM SR+LF + V C  P+ C  +C    GC+++AYP LVLEI+P G RGLMLAVM+++L+SSLTSIFNS+STIFT DIW+R+R +A++VELMIVGRV VL++V + IAWIPIVQ+ +ELFHYIQS+TSYL+PP+CAVY+LA+FWKR NE GAF GLM+GLV+GL RF  E +Y P PCGEE  +  P ++ KVHYLHFGI+LFGI +I++   S+LTAP+  ++   L FW+      + ++D+       E   E    K    T      LP ++KA  W+CGIE + N  ++P  T +E + I+  Q SI E   W  V+N   + L+T+ +F WGF+A
Sbjct:    7 RLHWGDILVIVGYFVAVIAVGIISSCRNRGSINGFFLAGRSMHWIPIGASLFASNIGSGHFVGLAGSGAAGGIGIAVFELNAIFILMILGWIFVPVYTAAGVYTMPEYLRKRFGGQRIRIYLSVLALLLYVFTKISADLYSGAIFLTQALPELNLYVAVIILLAVAALFTIGGGLTAVIWTDFIQTVIMLVGGFILMIMSFVKVGGYENLVKEYFEAWPNTTK-ANIGLNNN---YSYTDCGKPPANAMNFIRAADDGSLPWPGIFFGLTISSIWYWCSDQVIVQRALAAKNISNAKAGTILAGYLKFLPLFLIVFPGMISRILFPNTVGCADPDVCYEVCKSRAGCTNIAYPTLVLEIMPAGLRGLMLAVMMSALISSLTSIFNSSSTIFTMDIWRRIRTNATEVELMIVGRVCVLILVGVSIAWIPIVQNISELFHYIQSITSYLAPPVCAVYVLAVFWKRTNELGAFWGLMAGLVVGLIRFGWEFSYDPLPCGEEDKDTRPDIIKKVHYLHFGIILFGIVVIVTWIISVLTAPIPDKYLHRLTFWDRFNTQERVDIDEE------EKANEPQKPKEKIFTDDDYDSLPCHKKAFQWICGIEKM-NEDNEP--TVEEKKIIEMKQTSIYESSFWSRVLNVNAIILMTVAVFLWGFWA 652          
BLAST of slc5a-2 vs. TrEMBL
Match: A0A267DAD7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031467g1 PE=3 SV=1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 397/692 (57.37%), Postives = 494/692 (71.39%), Query Frame = 2
Query:   62 MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGE--ENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWN------------------CRKEYSKREVDKGTENPCYENDFEVDAKKYI----------DVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPV-LTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            M +VG L   DI VV+ +F  V+ VGLW+SCRNRGSVGGYFLAGR MHWIPVGASLFASNIGSGHFIGLAGSGA+ GI IAVFE +A+ +L++LGW+F+PVYIS+G+FTMPEYLKKRFGG RIRIYL+ + L+LYIFTK+SADLYAGA+FIEQS+Q  LY +VIILL  AA+F ILGGLTAVIWTDFIQT+IM+IGA +LMI  F+E+GGYE +V  +   L K     N S            CG+  + +M+ M+   D  LPW G   GL +++IWYWC+DQVIVQRALAAKN T+AK+G LL  +LK+LPMWL+VFPGM SRVLF D V C+ P  CK +C KE GC+D+AYP LVL++L  G RGLM+AVM++SLVSSLTSIFNSASTIFT DIW+R+R  A D+ELMIVGRVFVL MVA+G+AWIPIV+S  ELFHYIQ+VTSYLSPP+CAVY+ A+ WKRCNEKGAF GL+ G V+G+ RF  E +Y    C E  ++ +P V+ K+HYLHFGILLF I+LI+ V  SLLT P+   H   L FW+                  CR E  + ++DK  +N   +N     +KK +          DV   +  P PWY +A  WVCGIED    +D    +  +EL+ ++K   S+ EDPK K VV+     ++T+ +F WGFYA
Sbjct:   41 MTVVGSLGVIDIIVVVLFFSAVIAVGLWSSCRNRGSVGGYFLAGRSMHWIPVGASLFASNIGSGHFIGLAGSGAAGGIGIAVFEFSAMLVLVLLGWVFVPVYISSGVFTMPEYLKKRFGGQRIRIYLSCLTLILYIFTKVSADLYAGAVFIEQSLQFDLYVAVIILLGIAALFTILGGLTAVIWTDFIQTIIMVIGAFWLMIAGFIEVGGYEEMVRLFPIRLAKDILTSNTS------------CGVIPETSMNLMKPIDDDQLPWLGATMGLAVNAIWYWCSDQVIVQRALAAKNFTYAKAGTLLAGYLKLLPMWLLVFPGMISRVLFPDTVGCSDPAICKDVCDKESGCTDLAYPTLVLQLLGDGPRGLMMAVMISSLVSSLTSIFNSASTIFTIDIWKRIRSHAPDMELMIVGRVFVLGMVAVGVAWIPIVKSGAELFHYIQAVTSYLSPPVCAVYMAAVLWKRCNEKGAFWGLIVGFVVGMIRFIVEYSYEKFSCHEAYKSTLPDVIGKMHYLHFGILLFVISLIVIVVVSLLTEPIPDVHLHRLTFWDRYSELERVDMPEDEVRCACRGEAEEADIDKSPDNNGKDNQGFYGSKKSLQKEEQPGTAGDVEFAATAPPPWYVRAGKWVCGIED--EVEDPAAHIDPEELKRLEKEAVSLDEDPKMKRVVDINAFIIVTVCLFVWGFYA 718          
BLAST of slc5a-2 vs. TrEMBL
Match: A0A267FY99 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031467g2 PE=3 SV=1)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 393/682 (57.62%), Postives = 489/682 (71.70%), Query Frame = 2
Query:   92 DIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGE--ENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWN------------------CRKEYSKREVDKGTENPCYENDFEVDAKKYI----------DVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPV-LTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            DI VV+ +F  V+ VGLW+SCRNRGSVGGYFLAGR MHWIPVGASLFASNIGSGHFIGLAGSGA+ GI IAVFE +A+ +L++LGW+F+PVYIS+G+FTMPEYLKKRFGG RIRIYL+ + L+LYIFTK+SADLYAGA+FIEQS+Q  LY +VIILL  AA+F ILGGLTAVIWTDFIQT+IM+IGA +LMI  F+E+GGYE +V  +   L K     N S            CG+  + +M+ M+   D  LPW G   GL +++IWYWC+DQVIVQRALAAKN T+AK+G LL  +LK+LPMWL+VFPGM SRVLF D V C+ P  CK +C KE GC+D+AYP LVL++L  G RGLM+AVM++SLVSSLTSIFNSASTIFT DIW+R+R  A D+ELMIVGRVFVL MVA+G+AWIPIV+S  ELFHYIQ+VTSYLSPP+CAVY+ A+ WKRCNEKGAF GL+ G V+G+ RF  E +Y    C E  ++ +P V+ K+HYLHFGILLF I+LI+ V  SLLT P+   H   L FW+                  CR E  + ++DK  +N   +N     +KK +          DV   +  P PWY +A  WVCGIED    +D    +  +EL+ ++K   S+ EDPK K VV+     ++T+ +F WGFYA
Sbjct:   11 DIIVVVLFFSAVIAVGLWSSCRNRGSVGGYFLAGRSMHWIPVGASLFASNIGSGHFIGLAGSGAAGGIGIAVFEFSAMLVLVLLGWVFVPVYISSGVFTMPEYLKKRFGGQRIRIYLSCLTLILYIFTKVSADLYAGAVFIEQSLQFDLYVAVIILLGIAALFTILGGLTAVIWTDFIQTIIMVIGAFWLMIAGFIEVGGYEEMVRLFPIRLAKDILTSNTS------------CGVIPETSMNLMKPIDDDQLPWLGATMGLAVNAIWYWCSDQVIVQRALAAKNFTYAKAGTLLAGYLKLLPMWLLVFPGMISRVLFPDTVGCSDPAICKDVCDKESGCTDLAYPTLVLQLLGDGPRGLMMAVMISSLVSSLTSIFNSASTIFTIDIWKRIRSHAPDMELMIVGRVFVLGMVAVGVAWIPIVKSGAELFHYIQAVTSYLSPPVCAVYMAAVLWKRCNEKGAFWGLIVGFVVGMIRFIVEYSYEKFSCHEAYKSTLPDVIGKMHYLHFGILLFVISLIVIVVVSLLTEPIPDVHLHRLTFWDRYSELERVDMPEDEVRCACRGEAEEADIDKSPDNNGKDNQGFYGSKKSLQKEEQPGTAGDVEFAATAPPPWYVRAGKWVCGIED--EVEDPAAHIDPEELKRLEKEAVSLDEDPKMKRVVDINAFIIVTVCLFVWGFYA 678          
BLAST of slc5a-2 vs. TrEMBL
Match: A0A267FUL1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031467g3 PE=3 SV=1)

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 396/692 (57.23%), Postives = 492/692 (71.10%), Query Frame = 2
Query:   62 MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGE--ENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWN------------------CRKEYSKREVDKGTENPCYENDFEVDAKKYI----------DVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPV-LTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            M +VG L   DI VV+ +F  V+ VGLW+SCRNRGSVGGYFLAGR MHWIPVGASLFASNIGSGHFIGLAGSGA+ GI IAVFE +A+ +L++LGW+F+PVYIS+G+FTMPEYLKKRFGG RIRIYL+ + L+LYIFTK+SADLYAGA+FIEQS+Q  LY +VIILL  AA+F ILGGLTAVIWTDFIQT+IM+IGA +LMI  F+E+GGYE +V  +   L K     N S            CG+  + +M+ M+   D  LPW G   GL +++IWYWC+DQVIVQRALAAKN T+AK+G LL  +LK+LPMWL+VFPGM SRVLF D V C+ P  CK +C KE GC+D+AYP LVL++L  G RGLM+AVM++SLVSSLTSIFNSASTIFT DIW+R+R  A D+ELMIVGRVFVL MVA+G+AWIPIV+S  ELFHYIQ+VTSYLSPP+CAVY+ A+ WKRCNEKGAF GL+ G V+G+ RF  E +Y    C E  ++ +P V+ K+HYLHFGILLF I+LI+ V  SLLT P+   H   L FW+                  CR E  + + D   +N   +N     +KK +          DV   +  P PWY +A  WVCGIED    +D    +  +EL+ ++K   S+ EDPK K VV+     ++T+ +F WGFYA
Sbjct:   14 MTVVGSLGVIDIIVVVLFFSAVIAVGLWSSCRNRGSVGGYFLAGRSMHWIPVGASLFASNIGSGHFIGLAGSGAAGGIGIAVFEFSAMLVLVLLGWVFVPVYISSGVFTMPEYLKKRFGGQRIRIYLSCLTLILYIFTKVSADLYAGAVFIEQSLQFDLYVAVIILLGIAALFTILGGLTAVIWTDFIQTIIMVIGAFWLMIAGFIEVGGYEEMVRLFPIRLAKDILTSNTS------------CGVIPETSMNLMKPIDDDQLPWLGATMGLAVNAIWYWCSDQVIVQRALAAKNFTYAKAGTLLAGYLKLLPMWLLVFPGMISRVLFPDTVGCSDPAICKDMCDKESGCTDLAYPTLVLQLLGDGPRGLMMAVMISSLVSSLTSIFNSASTIFTIDIWKRIRSHAPDMELMIVGRVFVLGMVAVGVAWIPIVKSGAELFHYIQAVTSYLSPPVCAVYMAAVLWKRCNEKGAFWGLIVGFVVGMIRFIVEYSYEKFSCHEAYKSTLPDVIGKMHYLHFGILLFVISLIVIVVVSLLTEPIPDVHLHRLTFWDRYSELERVDMPEDEVRCACRGEAEEADTDNAPDNNGKDNLGFYGSKKSLQKEEQPGTARDVEFAATAPPPWYVRAGKWVCGIED--EVEDPAAHIDPEELKRLEKEAVSLDEDPKMKRVVDINAFIIVTVCLFVWGFYA 691          
BLAST of slc5a-2 vs. Ensembl Cavefish
Match: slc5a1 (sodium/glucose cotransporter 1-like [Source:NCBI gene;Acc:103043740])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 341/655 (52.06%), Postives = 466/655 (71.15%), Query Frame = 2
Query:   89 GDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             DI V++ YF++VL VG+WA  R NR +VGG+FLAGR M W P+GASLFASNIGSGHF+GLAG+GA+ GIAI  FE NA+ ++LILGW+F+P+YI  G+ TMPEYLKKRFGG RIRIYL+V++L LYIFTKISAD+++GAIFI Q+V L +Y +V++LLL  A++ + GGL AVI+TD +QT+IM++G+  LM  +F ++GGY+     Y +++P              V N    C  P  ++ H  R ++  +LPWPG+IFGLTI + WYWCTDQVIVQR L+ KN++  K+G +LC +LK+LPM+L+VFPGM SR+L+TD VAC +PE C   CG E GC+++AYPKLVL+++P G RGLML+VM+ASL+SSLTSIFNSAST+FT DI+ ++R  AS+ ELMI GRVF++ ++ I IAWIPIVQ+  S +LF YIQSVTSYL+PPI AV+ LA+F KR NEKGAF G++ GL IGLSR  TE  Y    C +E   P ++  +HYL+FG++L+G++LI+ +  SLLT P+D  H   L  W+ R    +R +D G ++    N+ EVD+K  ++V +  + P  W +KA N  CG +     K  P LT +E  E++K      E P W+ VVN   + L+T+ +F+ GF+ 
Sbjct:   35 ADISVIVIYFLVVLAVGIWAMVRTNRSTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAAGGIAIGGFEWNALVVVLILGWLFVPIYIKAGVVTMPEYLKKRFGGQRIRIYLSVLSLFLYIFTKISADMFSGAIFITQAVDLNIYVAVVLLLLITALYTVTGGLAAVIYTDTLQTIIMVVGSFILMGFAFDKVGGYDQFQEAYMKAIPSV------------VGNISSACYTPRADSFHIFRDATTGDLPWPGLIFGLTIQAGWYWCTDQVIVQRCLSGKNMSHVKAGCILCGYLKLLPMFLMVFPGMISRILYTDAVACVVPEVCNEWCGTEVGCTNIAYPKLVLDLMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYAKIRHRASEKELMIAGRVFIVALIGISIAWIPIVQTAQSGQLFDYIQSVTSYLAPPIAAVFTLAIFCKRTNEKGAFYGMLIGLAIGLSRMITEFVYGTGSCAQETKCPYIICGIHYLYFGLILYGVSLILVLGISLLTKPIDDVHLHRLC-WSLRNSTEER-LDLGEDD---WNEEEVDSKA-LEVEELESEPSCW-KKAYNCFCGFDQ----KKAPKLTKEEEAELKKQMMDTSEKPLWRNVVNANAIILLTVCVFFHGFFG 666          
BLAST of slc5a-2 vs. Ensembl Cavefish
Match: slc5a2 (solute carrier family 5 member 2 [Source:NCBI gene;Acc:103030281])

HSP 1 Score: 509.605 bits (1311), Expect = 2.015e-172
Identity = 336/664 (50.60%), Postives = 452/664 (68.07%), Query Frame = 2
Query:   89 GDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKY---FDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKR------EVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             DI V++GYFV+V+GVG+W+  R NRG+VGGYFLAGR M W PVGASLFASNIGSGHF+GLAG+GA+SGIA+  FE NA+FI+L+LGW+F+PVY++ G+ TMP+YLKKRFGG RI +YL+VI+L LYIFTKIS D+++GA+FI+Q++   +Y +VI LL   A++ + GGL A+++TD +QT I++ GA  LM  SF E+GGY  L+ +Y  +LP     L+      P P+ Y     C  P ++A + +R     +LPWPGV+FG+ I   WYWCTDQVIVQR LAA++LT  K+G ++C +LK+LPM+L+VFPGM SRVL+ DEV C +P  CK +CG E GCS++AYPKLV+ ++P G RGLMLAVMLA+L+SSL SIFNS+ST+FT DIW R+R  A D ELMIVGRV+VL +VAI I WIP+VQ+  S +LF YIQSVTSYL+PPI AV+ LA+F KR NE GAF GLM GL++GL R   E  +    C   +  P ++  VHYL+F +LLF  T I+ +  S  T P++ RH   L+F + R     R      EV++G +      + E   K   +    +N       + I W CG+    +    P  T +E+ E  K    I E+P WK  VN   L ++ + +++WGFYA
Sbjct:   14 ADITVILGYFVIVIGVGIWSMFRTNRGTVGGYFLAGRTMVWWPVGASLFASNIGSGHFVGLAGTGAASGIAVGGFEWNALFIVLLLGWLFVPVYLTAGVITMPQYLKKRFGGTRISLYLSVISLFLYIFTKISVDMFSGAVFIQQALGWNIYIAVIALLTITALYTVTGGLAALMYTDTVQTFIIIAGAFVLMGFSFREVGGYSTLLEKYSSALPSPSLRLS------PSPHLYNISSACYTPRQDAFNLLRDPVTGDLPWPGVVFGIAIVGGWYWCTDQVIVQRCLAARSLTHVKAGCIMCGYLKLLPMFLMVFPGMISRVLYPDEVGCVVPSVCKEVCGTEVGCSNIAYPKLVVSVMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIWTRIRPQARDRELMIVGRVWVLCIVAISICWIPVVQAAQSGQLFDYIQSVTSYLAPPIAAVFFLAIFVKRVNEPGAFWGLMGGLLMGLCRMGPEFYFGSGSCLFPSNCPKLICGVHYLYFAVLLFFCTGILVLLVSYWTPPINDRHLHRLVF-SLRHSKEDRVDLDWEEVERGRKA---RREVEEKNKATRNEENETNKDKSAILRLIGWFCGL----SGSQAPEPTEEEVAEASKQLPDISEEPVWKHFVNANALVMMAVAVYFWGFYA 663          
BLAST of slc5a-2 vs. Ensembl Cavefish
Match: slc5a1 (solute carrier family 5 member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1524])

HSP 1 Score: 495.738 bits (1275), Expect = 2.025e-167
Identity = 318/655 (48.55%), Postives = 443/655 (67.63%), Query Frame = 2
Query:   89 GDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             DI V++ YF++VL VG+WA  R NR ++GG+FLAGR M W P+GASLFASNIGS HF+GLAG+GA++GIAI  FE NA+ +++ILGW+F+P+YI +G+ TMPEYLKKRFGG RIRIYL++++L+LY+FTKISAD+Y+GAIFI Q+V + +Y +V++LL+  A++ + GGL AVI+TD +QT+IM++G+  L+  +F ++GGY+     Y  S+P              V N   +C  P  ++ H  R ++  +LPWPG+IFGLTI + WYWCTDQVIVQR L+AKN++  K+G +LC +LK+LPM+++VFPGM SR+L+ D+VAC +PE C  +CG E GC+++AYPKLV+EILP G RGLML+VMLASL+SSLTSIFN+                 S+ ELMI GRVF++V++ + IAWIP+VQS+   +LF Y QSVTSYL+PPI AV++LA+F KR NE+G F G++ GL +GLSR   E AY    C +    P ++  +HYL+FGI+LFGI+ I+ +  SLLT P+D +H   L  W+ R    +R VD        E D   D  K  +           +RK  N  CG +     K  P LT +E  E++K      E P W+ VVN   + L+ + +F+ GF+ 
Sbjct:   22 ADISVIVLYFLVVLAVGVWAMVRTNRSTIGGFFLAGRNMVWWPIGASLFASNIGSVHFVGLAGTGAAAGIAIGGFEWNALVMMIILGWVFVPIYIKSGVVTMPEYLKKRFGGQRIRIYLSLLSLILYVFTKISADIYSGAIFINQAVDVNIYLAVVLLLVITALYTVTGGLAAVIYTDTLQTIIMVLGSFVLVGFAFDKVGGYDKFHDAYMNSIPMV------------VGNVSSECYTPRADSFHIFRDATTGDLPWPGLIFGLTIQAAWYWCTDQVIVQRCLSAKNMSHVKAGCILCGYLKLLPMFIMVFPGMISRILYPDDVACVVPEICNDLCGTEVGCTNIAYPKLVMEILPNGLRGLMLSVMLASLMSSLTSIFNT-----------------SEKELMIAGRVFIVVLIGVSIAWIPMVQSAQGGQLFDYTQSVTSYLAPPIAAVFILAIFCKRTNEQGVFYGMLFGLAVGLSRMIAEFAYGSGSCAQVPDCPYIICGIHYLYFGIILFGISCIVILGISLLTKPIDEKHLHRLC-WSLRNSTEER-VD-------IEED---DWNKEEEEEIKPEPEPSCWRKVYNGFCGFDQ----KKAPKLTKEEEAEMKKQLTDTSEKPLWRNVVNANAIILLAVCVFFHGFFG 631          
BLAST of slc5a-2 vs. Ensembl Cavefish
Match: si:dkeyp-9d4.5 (solute carrier family 5 member 10 [Source:NCBI gene;Acc:111197011])

HSP 1 Score: 488.804 bits (1257), Expect = 2.398e-165
Identity = 276/516 (53.49%), Postives = 381/516 (73.84%), Query Frame = 2
Query:   65 ALVGKLEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHY 1603
            AL       DI V+  YF+L + VG+W+SCR +R ++ GYFLAGR M W P+GASLFAS+ GSG FIGLAG+GA+ GIA+A FE NA ++LL L WIF+PVY+S+GI TMPEYL +RFGG RIR+YL+ ++L+L +FTKIS DLY+GA+F++  +   LY S +++L+  A++ I GGL AVI+TD +QT IM+IGA  L IT+F ++GGY NL   Y Q++P              +PN    C +P  +AMH  R   D +LPWPG+  GLTI + WYWCTDQVIVQR+L+AKNL+ AK   +  ++LKMLPM  I+ PGM SR L+ D V C  P+EC ++CG E GCS++A+PKLV+E++P+G RGLM+AVM+A+L+SSLTSIFNS+ST+FT DIW++ R+ AS+ EL++VGR+  +++V I + WIPI+QS+N  +L+ YIQSVTSYL+PP+ A++++A+FW+R NE GAF GLM GL +G++R   E A+PP  CG  +  P++L +VHY
Sbjct:   11 ALSQSFSVSDIIVIGAYFLLNVAVGIWSSCRVSRNTLSGYFLAGRDMAWWPIGASLFASSEGSGLFIGLAGTGAAGGIAVAGFEWNATYVLLALAWIFVPVYVSSGIVTMPEYLGRRFGGERIRMYLSALSLMLSVFTKISTDLYSGALFVQVCLGWNLYLSTVLMLVVTALYTIAGGLAAVIYTDTLQTFIMIIGAVILTITAFNKIGGYSNLEHVYLQAVPS-----------KIIPNT--TCHLPRHDAMHLFRDPVDGDLPWPGMTLGLTILATWYWCTDQVIVQRSLSAKNLSHAKGASIFASYLKMLPMIFIILPGMISRALYPDSVGCVDPDECMKVCGAEVGCSNIAFPKLVIELMPSGLRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWKKYRRGASEKELLLVGRIVTVILVVISVVWIPILQSANSGQLYVYIQSVTSYLAPPVTAIFVMAVFWRRTNEAGAFWGLMVGLAVGVTRMVFEFAFPPPRCGVFDPAPAILRRVHY 513          
BLAST of slc5a-2 vs. Ensembl Cavefish
Match: si:dkeyp-9d4.5 (solute carrier family 5 member 10 [Source:NCBI gene;Acc:111197011])

HSP 1 Score: 486.493 bits (1251), Expect = 8.282e-164
Identity = 276/516 (53.49%), Postives = 381/516 (73.84%), Query Frame = 2
Query:   65 ALVGKLEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHY 1603
            AL       DI V+  YF+L + VG+W+SCR +R ++ GYFLAGR M W P+GASLFAS+ GSG FIGLAG+GA+ GIA+A FE NA ++LL L WIF+PVY+S+GI TMPEYL +RFGG RIR+YL+ ++L+L +FTKIS DLY+GA+F++  +   LY S +++L+  A++ I GGL AVI+TD +QT IM+IGA  L IT+F ++GGY NL   Y Q++P              +PN    C +P  +AMH  R   D +LPWPG+  GLTI + WYWCTDQVIVQR+L+AKNL+ AK   +  ++LKMLPM  I+ PGM SR L+ D V C  P+EC ++CG E GCS++A+PKLV+E++P+G RGLM+AVM+A+L+SSLTSIFNS+ST+FT DIW++ R+ AS+ EL++VGR+  +++V I + WIPI+QS+N  +L+ YIQSVTSYL+PP+ A++++A+FW+R NE GAF GLM GL +G++R   E A+PP  CG  +  P++L +VHY
Sbjct:   11 ALSQSFSVSDIIVIGAYFLLNVAVGIWSSCRVSRNTLSGYFLAGRDMAWWPIGASLFASSEGSGLFIGLAGTGAAGGIAVAGFEWNATYVLLALAWIFVPVYVSSGIVTMPEYLGRRFGGERIRMYLSALSLMLSVFTKISTDLYSGALFVQVCLGWNLYLSTVLMLVVTALYTIAGGLAAVIYTDTLQTFIMIIGAVILTITAFNKIGGYSNLEHVYLQAVP-----------SKIIPNT--TCHLPRHDAMHLFRDPVDGDLPWPGMTLGLTILATWYWCTDQVIVQRSLSAKNLSHAKGASIFASYLKMLPMIFIILPGMISRALYPDSVGCVDPDECMKVCGAEVGCSNIAFPKLVIELMPSGLRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWKKYRRGASEKELLLVGRIVTVILVVISVVWIPILQSANSGQLYVYIQSVTSYLAPPVTAIFVMAVFWRRTNEAGAFWGLMVGLAVGVTRMVFEFAFPPPRCGVFDPAPAILRRVHY 513          
BLAST of slc5a-2 vs. Ensembl Sea Lamprey
Match: slc5a1 (solute carrier family 5 member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1524])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 327/661 (49.47%), Postives = 453/661 (68.53%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQ--SSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLP----WYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V++ YFV VLGVGLWA  + NR +VGG+FLAGR M W P+GASLFASNIGSGHF+GLAGSGA++GIA   FE NA+FI+++LGW+F+P+YI+ G+ TMPEYLKKRFGG RI+ YL+ ++L+LY+ TKISAD+++G IFI Q++ L +Y +VI LL+   ++ + GGLTAVI+TD +QTVIML+G+  LM+ +F  +GGY+ +  +Y  ++P         T   P  N   +C  P  ++++ +R     +LPWPG++FGLTI + WYWCTDQVIVQR L+AK+++  K G ++C +LK+LPM+L+V PGM SR+L+TD VAC  PE+CK  C  + GC+++AYP LV+ ++P G RGLML+VMLASL+SSLTSIFNSAST+FT DI+ ++R SA++ ELM+ GRVF+LV++ I IAWIPI++   S +LF YIQS+TSYL PPI AV+LLA+F KR NE+GAF GL+ G +IG+SR  TE AY    C  +   P+++  VHYL+F I+LF IT ++ V  SL T P+D +H   L+ W+ R    KRE     E        +   +         N   P      RKA  W CG++    +  Q  LT +++E  +KL   I E P W+   N   + ++ I +F+WGFYA
Sbjct:   25 NAADIAVIVCYFVFVLGVGLWAMYKSNRSTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGSGAAAGIAQGGFEWNALFIVVLLGWLFVPIYITAGVVTMPEYLKKRFGGNRIQYYLSGLSLILYVLTKISADMFSGGIFIRQAIGLNIYLAVICLLIITGLYTVTGGLTAVIYTDTVQTVIMLVGSLILMVFAFNAVGGYDAMYEKYMLAIP---------TPPPPEMNISEECYTPRPDSLNLLRDPITGDLPWPGLLFGLTIIATWYWCTDQVIVQRCLSAKDMSHVKGGCIMCGYLKLLPMYLMVMPGMISRILYTDVVACVEPEKCKEYCDTDVGCTNIAYPLLVINLMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTLDIYNKIRTSATERELMLAGRVFILVLIGISIAWIPIIEGAQSGQLFDYIQSITSYLGPPIAAVFLLAIFVKRVNEEGAFWGLILGFLIGMSRLITEFAYGTGSCKNKTNCPTIICGVHYLYFAIILFTITCVLVVVISLFTKPIDDKHLHRLV-WSLRHSKEKREDLDAEEKEINARKMKEKLEAKKAEELEENKTPPGCVGCLRKAGMWFCGLD----SAPQEELTKEQMEAQEKLLTDISEKPLWRNFNNVNAIIIMAIAVFFWGFYA 671          
BLAST of slc5a-2 vs. Ensembl Sea Lamprey
Match: slc5a9 (solute carrier family 5 member 9 [Source:NCBI gene;Acc:564815])

HSP 1 Score: 466.463 bits (1199), Expect = 7.641e-158
Identity = 287/548 (52.37%), Postives = 386/548 (70.44%), Query Frame = 2
Query:  137 GLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELN-------------------------AXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLF--TDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRH 1690
            G+WASCR NR +VGGYFLAGR M W+P+GASL +SN+GSG FIGLAGSGA+ GIAI  FE N                         A ++L+ LGW+F+PVYI+ G+ TMP YL++RFGG +  +YL+ ++L LY+FTKIS D++AGAIFI+ S+   +Y S ++L+   A++ I GGL AVI+TD +QTVIM++GA  LM    V+L GYE +   Y  ++P              VPN    C  P  +A+H +R     +LPWPG+IFGLT+ + W WCTDQVIVQR+L+A++L+ AK+G +L  +LK+LPM+ IV+PGM SR +F   DEVAC +P+EC+R+CG + GCS++AYPKLV+E++PTG RGLM+AVM+A+L+SSLTSIFNS+ TIFT D+W+R R  AS++ELM+VGR+FVL++V I I W+P+VQ +N   LF YIQSVTS+L+PPI A++LLA+FW R NE GAF  LM GL IG+SR   E ++PP  CGE +  P VL  VHYL+F +LL G+T +I V  SL T     +H
Sbjct:   20 GMWASCRTNRSTVGGYFLAGRTMTWLPIGASLMSSNVGSGLFIGLAGSGAAGGIAIGGFEWNVYLSRETSQWVLHLDADSTIELRFWASWVLVALGWVFVPVYITAGVLTMPGYLRRRFGG-QRSLYLSGLSLALYVFTKISTDIFAGAIFIKVSLGWDIYLSTVVLIAVTAIYTIAGGLAAVIYTDALQTVIMVVGAMILMGIGLVKLDGYEGMARSYMAAVPNV-----------TVPNT--TCHQPRADALHLLRDPVQGDLPWPGLIFGLTVLATWNWCTDQVIVQRSLSARSLSHAKAGSVLAGFLKVLPMFFIVWPGMMSRAMFPALDEVACVVPDECQRVCGSKVGCSNIAYPKLVVELMPTGLRGLMMAVMVAALMSSLTSIFNSSGTIFTIDVWKRFRPRASEMELMVVGRLFVLLLVIISILWLPVVQVANSGRLFDYIQSVTSFLAPPITAIFLLAIFWPRMNEPGAFWALMCGLAIGVSRMALEFSFPPPACGEADRRPPVLRDVHYLYFALLLCGLTALIGVIISLATPAPHPQH 553          
BLAST of slc5a-2 vs. Ensembl Sea Lamprey
Match: slc5a3a (solute carrier family 5 member 3a [Source:ZFIN;Acc:ZDB-GENE-090312-3])

HSP 1 Score: 396.741 bits (1018), Expect = 4.051e-131
Identity = 255/509 (50.10%), Postives = 349/509 (68.57%), Query Frame = 2
Query:   62 MALVGKLEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTG--IFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPK-TGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLR--KSASDVELMIVGRVF--VLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGE 1564
            +A+  +LE  DI +V  YFVLV  VGLWA  R NR SV GYFLAGR M W+PVGASLF SNIGS HFIGLAGSGA+SG+A+A +ELNA+ +L +L W+F PVY++TG  + TMP YL +RFGG R+R+YL V++LLLY+ TK+S DLYAGA+FI+QS+   LY S++ L+   A+  + GGL AVI+TD +Q  +M+ GA  LM+   V++GG +N+ + Y +++P  T     ++    P+         P  N++  +R   D+  PWPG + G T +SIWYWCTDQVIVQR LAA++ + AK   LL   LK+LPM+ IV PGM +R+L  DE+AC  PE C  +CG   GCS+VAYP+LVL ++PTG RGLM+AV++A+L+S L SIFNSAS+IFT DI++  R     S  ELMIVGR++  V++ V++    + +     ++F YIQ +  YL+PP+ A++LL +FWKRCNEKGAF G + G  +G +R      YPP  C +
Sbjct:   18 VAMAERLESVDIAIVGLYFVLVFAVGLWAMRRSNRASVSGYFLAGRAMSWLPVGASLFVSNIGSEHFIGLAGSGAASGLAVAAWELNALLLLQLLSWVFYPVYLATGFGVCTMPGYLARRFGGRRLRVYLVVLSLLLYVLTKVSVDLYAGAVFIQQSLGWDLYVSIVSLIGATALLTMAGGLAAVIYTDTLQAALMVGGALTLMVLGLVKVGGLQNVWSGYMEAVPNVTAIRAAYNLSAGPLCEAAI--ARPHANSLKVLRGPFDSETPWPGFLLGQTPASIWYWCTDQVIVQRMLAARDHSNAKGATLLAGALKILPMFAIVVPGMIARILMPDELACVSPEHCTAVCGNPAGCSNVAYPRLVLAVMPTGLRGLMMAVIVAALMSDLDSIFNSASSIFTLDIYRHARGVTRVSSRELMIVGRLWVVVMMAVSVAWVPVVVSMQGGQMFLYIQEMAGYLTPPVAAIFLLGVFWKRCNEKGAFCGGLVGSTLGFARLLLAFIYPPPDCTQ 524          
BLAST of slc5a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003316.1 (pep scaffold:Pmarinus_7.0:GL476336:129493:160966:1 gene:ENSPMAG00000003020.1 transcript:ENSPMAT00000003316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.91 bits (912), Expect = 2.768e-116
Identity = 208/418 (49.76%), Postives = 291/418 (69.62%), Query Frame = 2
Query:  488 DLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNE-KGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLT--APMDRRHTDGLLFWNCRKE 1726
            D+YAGAIFI+ ++   LY S+I+LL   A++ I GGL AVI+TD  Q VIML+G+  LMI SF+++GG+E L  RY +++P      N +            CG P  +A H  R ++  + PWPGV+ G+ I S WY+CTDQV+VQR+++AKNLT AK G +L A+ K+LP++L++ PGM SRVLFT+EVAC   E C+  CG   GC+++AYPKLV+E++P G +G+MLA M+A+L+SSLTS+FNS+STIFT D+W RLR  AS+ ELMIVGRVFVLV+V + IAWIP++Q+S   +LF YIQSVT Y +PPI  VYLL++FW+  NE +GAF GLM+G + G+ R   +  Y    CG+ +  P VL++VH+LHF +LLF +   + V  SL+T  +   +R   GL +W+  K+
Sbjct:    1 DMYAGAIFIQLTLGWDLYTSIILLLGVTAIYTITGGLKAVIYTDTFQLVIMLVGSFVLMILSFMKVGGFEELQLRYSRAMPNVTLAGNTT------------CGTPRSDAFHIFRDATHGDYPWPGVVLGIPILSAWYFCTDQVLVQRSISAKNLTHAKGGSVLAAYCKILPLFLLILPGMISRVLFTEEVACATRETCQEACGNPAGCTNIAYPKLVVELMPPGLKGVMLAAMMAALMSSLTSVFNSSSTIFTMDLWARLRPRASEQELMIVGRVFVLVLVGLSIAWIPVLQASQSGQLFDYIQSVTGYFAPPILMVYLLSIFWEGFNEQQGAFWGLMAGFLTGVIRMGLDFGYGTPACGDPDPRPPVLARVHFLHFTVLLFVLVGAVMVAVSLVTRRSVGTKRDLAGLTWWSRWKD 406          
BLAST of slc5a-2 vs. Ensembl Sea Lamprey
Match: slc5a5 (solute carrier family 5 member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-585])

HSP 1 Score: 76.2554 bits (186), Expect = 4.307e-15
Identity = 85/343 (24.78%), Postives = 151/343 (44.02%), Query Frame = 2
Query:  134 VGLWASCRNRG--SVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVF-PGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEIL 1153
            +G++ + R  G  + G +F+ GR +  +PVG SL AS + +   +G+ G     G       L     + I  ++FLPV+   GI +  +YL+ RF  V          +   ++T +   +YA A+ + Q   L ++ SV+        +  +GG+ AV+WTD  Q ++ML G   ++I   +E+GG    ++R        G  +NF  F +P P + +           F   ++   L W  +           +  +Q  VQR LA ++ T A+  +    ++ +L +W+IV   GM   V+F       + ++C  +        D   P  VL+I 
Sbjct:   20 IGIFYALRGGGQRTTGDFFMGGRHLSALPVGLSLSASFMSAVQVLGVPGEAYRYGAKFLQMCLGQSVNVFITAYVFLPVFYRLGITSTYQYLEMRFNKVVRLCGTTQYIVATVLYTGVV--IYAPALILNQVTGLSIWFSVLSSGAICTFYTTIGGMKAVVWTDAFQVMVMLAGFWAVLIQGTMEVGGISTAISRV-----NNGSRINFGDF-DPDPRRRYT----------FWTLTTGATLLWLSM-----------YGVNQAQVQRYLACRSETQARRAL----FVNLLGLWVIVCSAGMCGLVMFA------LYKDCDPLQAGLVTAPDQLMPYFVLDIF 323          
BLAST of slc5a-2 vs. Ensembl Nematostella
Match: EDO43582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY63])

HSP 1 Score: 459.914 bits (1182), Expect = 2.653e-153
Identity = 286/665 (43.01%), Postives = 426/665 (64.06%), Query Frame = 2
Query:   80 LEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTG-IFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKG--------------SNLPLP----------WYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVN 1990
            LEG D+  ++ YF++V+ + ++A  + NR +V GYFLAGR M W+PVGAS+FASNIGS H IGLAGSGA++G  +  FE+NA+ ++     +   V+ S G + T+PEY+ +RFGG RIR++L+V++LLLYIFTKIS +LY+GA+FI  ++   LY ++I+LL  A +  I GGL AVI+TD + T +M +G+  +M   F E+GGYE L ++Y  ++     + N S            CG P +++   +R    +++PWPG I G TI SIWYWC DQVIVQR L++K+L+ A+   L   W+K+LP++ ++ PGM SRVL  + VAC+ PE+C  +CG E GCS++A+P+LVL+I+P+G RGLM+AVM+A+L+S LTSIFNSAST+FT D++ R R  AS  ELMIVGRV V VM  +GI WIP++Q+    +LF YIQ+VT+YLSPPI ++Y+LALFWKR  E GAF G+M G V+G  R   +  Y    CG+ +  P++ + VHY++F I+ F I+ +  V  SL T P    +T  L +W      ++ +    +++P  E D E+ A +++ +++G               N   P            R+ ++WVCG E + +  D    TA E ++  +L  S+++DP+ K+ +N
Sbjct:   10 LEGLDVVFIMLYFIVVMAICIYAMTKTNRATVSGYFLAGRLMTWLPVGASVFASNIGSEHLIGLAGSGAAAGFGVGSFEINAMIMIDAWLAVRSSVHRSRGRVCTLPEYIHRRFGGQRIRVWLSVLSLLLYIFTKISVNLYSGALFINLALGWNLYAAIILLLGLACLCTITGGLAAVIYTDTLCTFLMTLGSLTVMSLGFAEVGGYEGLKSKYMVAVSNHTLHSNTS------------CGWPRQDSFKLLRDPVYSDIPWPGFIIGETIVSIWYWCADQVIVQRTLSSKSLSHAQGACLFAGWIKVLPLFTMLIPGMISRVLSPERVACSTPEQCMAVCGSEVGCSNIAFPELVLKIMPSGLRGLMMAVMMAALMSDLTSIFNSASTLFTIDVYGRFRSKASVRELMIVGRVMVAVMTGVGILWIPVIQNVQGGQLFVYIQAVTAYLSPPIASIYVLALFWKRTTEMGAFWGMMIGFVVGALRMILDFRYQSPRCGDADERPAITANVHYMYFAIVAFAISTVSIVIISLFTKPHPGANTARLTWW------TRHDASASSDHPEEERDDEI-AMEHVTLSRGKQASCDSMTGSRDLENASCPEGTSEGSKQSRLRRFVSWVCGYEQVVSL-DTARRTAVEHQQRMRLITSLEQDPRAKIFLN 654          
BLAST of slc5a-2 vs. Ensembl Nematostella
Match: EDO44833 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUY5])

HSP 1 Score: 423.32 bits (1087), Expect = 1.673e-140
Identity = 260/539 (48.24%), Postives = 373/539 (69.20%), Query Frame = 2
Query:  158 NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKR---EVDKGTE 1759
             R +V GYFLAGR M W+PVGASLFASNIGS HFIGLAGSGA++GI +  FE NA+ +L +LGW+FLPVYI+ G+ T+PEY+ +R+GG RIR++L+++++LLYIFTKIS +L++GA+FI+ ++   LY +++++L    +  I GGL AVI+TD + T +M +G+  +M   F ++GGY  L  +Y +++     Y N +            CG P  ++   +R   ++++PWPG + G T++SIWYWC DQVIVQRALAAK+L+ A+   L   ++K+LP++ +V PGM SRVL  D VAC+  E C  +CG E GCS++AYP+LVL+I+PTG RGLM+AVM+A+L+S LTSIFNSAST+FT D++ R+R  AS  ELMIVGRV V VM  IGI WIP+VQ+    +LF YIQ+V++Y SPPI  +Y++++ W +  EKGAF G++ G V+G  R   +  Y    CGE +  P++ + +HY++F ++LF IT I  V  SLLT P +  +T  L +W  + E+S     E D+  E
Sbjct:   39 TRSTVSGYFLAGRFMTWLPVGASLFASNIGSEHFIGLAGSGAAAGIGVGAFEFNALILLQLLGWVFLPVYIAGGVCTLPEYINRRYGGQRIRVWLSILSILLYIFTKISVNLFSGALFIKLALGWNLYLAILLMLFLTCLCTITGGLAAVIYTDTLCTFLMGVGSLTVMGMGFSKIGGYSGLQEKYMKAVANETLYSNNT------------CGWPRHDSFTMLRDPVNSDIPWPGFLLGQTVASIWYWCADQVIVQRALAAKSLSHAQGACLFAGYIKILPLFTLVMPGMISRVLSPDRVACSTRESCMAVCGSEVGCSNIAYPELVLKIMPTGLRGLMMAVMMAALMSDLTSIFNSASTLFTIDVYGRIRSKASVRELMIVGRVMVAVMTGIGILWIPVVQNVQGGQLFIYIQAVSAYFSPPIACLYVVSILWTKATEKGAFWGMVIGFVVGAIRMVLDFVYLAPLCGEADTRPAITANLHYMYFALVLFWITAIAIVVISLLTKPHEGANTARLTWWTLKDEFSTTDHLETDRDDE 565          
BLAST of slc5a-2 vs. Ensembl Nematostella
Match: EDO46199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP5])

HSP 1 Score: 337.421 bits (864), Expect = 5.285e-107
Identity = 258/583 (44.25%), Postives = 364/583 (62.44%), Query Frame = 2
Query:   77 KLEGGDIGVVIGYFVLVLGVGLWASC-RNRG--SVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPG----VIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCR----------KEYSKREVD----KGTEN 1762
            +L+  D  ++  YF L + VGL+    R RG  +  GYFLAGR M W  VG SLFASNIGS HFIGLAGSGA+SGI +A +E  A   +L+LGW+F+P+Y+ + +FTMPEYL KRF    IR YL  IALL Y+FTKIS  L+AG++F+ ++V L +Y S  ++L   A++ +LGGL AVI+TD +Q  +M+IGA  L I  F ++GG+  L  ++ +++ K  R  N S   N        C        +  R   D + PW G    V F   +  +WYWCTDQVIVQRAL AKN   A++G +   +LK  PM+L+V PGM SRVLF D +AC     C+R CG + GC++ AYPKLVL +LPTG  GLM+AVM+++L+SSL+S+FNS++TIF  DIW R+R  A + E +IVGRV V+V+VA+ I W+PI+Q  N LF Y+Q++ +Y SPP+  V+ L + W   +E GA  GL+ GLV+G+ +F     + P  CG+ +  P  + K+H+L++G++++  +  + V  SL T P+ R    GL +              +E   R+VD    KG EN
Sbjct:    8 RLQAADWAIIGVYFALCMAVGLYTKFKRQRGLETSEGYFLAGRSMMWWAVGPSLFASNIGSEHFIGLAGSGAASGIGVACYEWQACLCILLLGWVFVPIYLKSRVFTMPEYLNKRFQSRSIRTYLTAIALLSYVFTKISVVLFAGSVFLYEAVGLNIYLSATVMLAITAIYTLLGGLMAVIFTDVLQCTVMMIGAIVLCILGFDKVGGHSGLWEKFPKAVGKPWRPPNTSLPLNLTNATIESCFKVTPYWGNMFRPLDDPDYPWLGSWTTVFF---VIGVWYWCTDQVIVQRALGAKNNVHARAGAVFAGFLKATPMFLMVMPGMISRVLFPDSIACADSVSCERHCGNKWGCTNNAYPKLVLNVLPTGLVGLMMAVMMSALMSSLSSVFNSSATIFVVDIWLRIRPKAGERERVIVGRVTVVVVVALSIVWLPIIQ-GNRLFEYLQTIQAYFSPPLAMVFTLCILWPGLSEVGALSGLIIGLVMGVVKFIVGNLFDPPECGKVDERPEFV-KLHFLYYGLIIYVASGAVMVIVSLFTKPVPREELGGLTWPTINDPPISHDALGEEGLTRDVDREPEKGEEN 585          
BLAST of slc5a-2 vs. Ensembl Nematostella
Match: EDO46200 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP6])

HSP 1 Score: 314.694 bits (805), Expect = 2.240e-99
Identity = 227/498 (45.58%), Postives = 332/498 (66.67%), Query Frame = 2
Query:  215 VGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSS--NELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGL 1702
            VG SLFASN+GS HFIGLAGSGA++GIA+  +E  A+++LL+LG++F+P+Y+ + +FTMPEYL KRF    +R YL + AL+ Y+FTK S D+YAG++F+ +++   +Y S  ++L   A++ +LGGL AVI+TD +Q  IM+IGA  L I SF+++GG++ L ++ F ++  T   LN +   + V      C    +   +  R   D + PW G+   L I  +WYWCTDQVIVQR+L AKN   AK+G +    LK+LP++++V PGM SRVLF D +AC     C + CG E GC++ AYPKLVL +LPTG  GLM+AVM+A+L+SSL+S FNS++TIFT D+W   R  A + E +IVGRV VL++V + + W+PI+Q +  ++LF YIQ++ SYL+PPI   + L + W R  E GA  GL+ GL++GL +F     Y P  CG  +  P  + K H++ +G+++FG+T ++ V  SL T P+ R    GL
Sbjct:    1 VGPSLFASNMGSEHFIGLAGSGAATGIAVVSYEWQAVWVLLLLGYVFVPIYLKSRVFTMPEYLNKRFQSRSVRTYLTIAALISYVFTKTSVDIYAGSVFLYEAIGWNIYVSAAVILAITAIYTMLGGLMAVIFTDVLQCAIMIIGAIVLAILSFMKVGGHDGLWSK-FGTIAATTSALNLT--NSSVALGAQSCYKLTQYWGNMFRPLDDPDYPWLGLWTTLPIMGVWYWCTDQVIVQRSLGAKNNVHAKAGSIFAGLLKILPLFIMVMPGMISRVLFPDSIACPDSRSCMKHCGNEWGCTNNAYPKLVLNVLPTGLVGLMMAVMMAALMSSLSSAFNSSATIFTVDVWLVCRPKAKEREKLIVGRVVVLILVGVSLVWLPIIQGALGSQLFVYIQTIQSYLAPPITMTFGLGILWPRLTEAGALCGLLVGLMMGLLKFIFGNIYTPPSCGVPDDRPGFV-KFHFMWYGLVIFGVTGVVEVLVSLFTTPVPREELGGL 494          
BLAST of slc5a-2 vs. Ensembl Nematostella
Match: EDO40313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7I5])

HSP 1 Score: 80.1073 bits (196), Expect = 7.657e-16
Identity = 122/481 (25.36%), Postives = 202/481 (42.00%), Query Frame = 2
Query:  131 GVGLWASCRNRG---SVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFG-GVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIV-FPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILP--TGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNEL-FHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPP 1549
             +G+W  C   G   S   Y LA R+M   PV  SL  S + +   +G+     + G    V  ++   I   +  IF+P++    I    EYL++RF  GVRI      I         +   LYA ++ +E    +PL  S++   +    +  LGGL AVIWTD  Q+++M+ G   +++    E+GG+  +       + K    LNF  F NP P                       N  W   I G   +++  W   Q  VQR L+  N   A++ +    WL +  + LIV    +   V+F     C++ E+      K+   +D   P  V+  L    G  G+  A + A  +S+ +S  N+ + +   DI ++     +D +   + +   +   AI      +V+    L      S+      P+  ++LL +F +R N KGA++G+ +G  I L  F     YPP
Sbjct:   23 AIGIWYGCGPGGKQTSTKEYLLADRKMKVWPVAISLLVSYLSAITLLGVPSEIYTYGAQYYVLIISYFIICAFVAIIFVPMFRRVNITCANEYLERRFSVGVRIVGCAFFILEYTLYLCVV---LYAPSLALEAVAGIPLTASILTTGIVCTFYTSLGGLKAVIWTDVFQSLVMVAGLVVVVVIGSQEVGGFGEV-----WEINKNFDRLNFFDF-NPDPKV--------------------RNTFWTLTIGG-AFTAMPVWTVSQTAVQRFLSVPNTQAARNVV----WLNIPGLILIVTLCCLDGLVIFAVYSGCDLRED------KKISSNDQILPYFVINKLGYLKGLPGMFTACLYAGALSTGSSALNAMALVVLEDIVKKRVPDLNDGDQAKICKFVAVAFGAIVTGGAFVVKFVGTLVLQLAYSIFGICGGPLLGIFLLGMFIRRANSKGAYVGVFAGAAITLWVFIGAQVYPP 463          
BLAST of slc5a-2 vs. Ensembl Medaka
Match: slc5a1 (sodium/glucose cotransporter 1 [Source:NCBI gene;Acc:101175417])

HSP 1 Score: 530.02 bits (1364), Expect = 1.957e-180
Identity = 331/656 (50.46%), Postives = 458/656 (69.82%), Query Frame = 2
Query:   89 GDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPK-TGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             DI V++ YFV+VL VG+WA  R NR +VGG+FLAGR M W P+GASLFASNIGSGHF+G+AG+ A++GIA   FE NA+ +++ILGW+F+P+YI  G+ TMPEYLKKRFGG RIRIYL++++L+LY+FTKISAD+++GAIFI Q++ L +Y +VI LLL  A++ + GGL AVI+TD +QT+IM++G+  LM  +F E+GGYEN    Y Q++P  TG             N   +C  P  ++ H  R +   +LPWPG++FGLTI + WYWCTDQVIVQR L+AK+L+  K G +LC +LK+LPM+L+VFPGM SR+L+ D VAC  P+ECK  C    GCS++AYPKLV++++P G RGLML+VMLASL+SSLTSIFNSAST+FT DI+ ++R  A + ELMI GRVF+L ++ + IAWIPIVQ+  S +LF YIQS+TSYL+PP+ AV++LA+F+KR NE GAF GL+ GL IGLSR   E  Y    C   +  P+++  VHYL+FGI+LF ++ II +  SL+T P++ +H   L F    +  ++  VD   ++    +D   D +   D  K S+      +KA+   CG+ED K     P L+A+E  E+++      E P WK VVN   + L+ + +F+ GF+A
Sbjct:   30 ADISVIVIYFVVVLAVGVWAMVRTNRSTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGIAGTAAAAGIATGGFEWNALIVVVILGWLFVPIYIKAGVVTMPEYLKKRFGGSRIRIYLSILSLILYVFTKISADMFSGAIFINQALGLNIYVAVIALLLITAIYTVTGGLAAVIYTDTLQTIIMVVGSFILMGFAFNEVGGYENFERLYMQAVPSITG-------------NISAECYKPRPDSFHIFRDAITGDLPWPGLVFGLTIQATWYWCTDQVIVQRCLSAKSLSHVKGGCILCGYLKLLPMFLMVFPGMISRILYPDVVACVDPDECKSFCDSGVGCSNIAYPKLVVDLMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYTKIRPRAKERELMIAGRVFILGLIGVSIAWIPIVQTAQSGQLFDYIQSITSYLAPPVAAVFMLAIFYKRVNEPGAFYGLIIGLPIGLSRMIAEFVYGTGSCASPSDCPTIICGVHYLYFGIILFVLSCIIIIGISLMTKPIEDKHLYRLCF--SLRNRTEERVDLEQDDWVGGDD---DNESIDD--KDSHKEPGACKKALMCFCGLEDNK----APKLSAEEEAELKRKLTDTTEVPLWKNVVNANAVILLCVAVFFHGFFA 661          
BLAST of slc5a-2 vs. Ensembl Medaka
Match: slc5a1 (sodium/glucose cotransporter 1-like [Source:NCBI gene;Acc:101175176])

HSP 1 Score: 520.005 bits (1338), Expect = 1.873e-176
Identity = 332/655 (50.69%), Postives = 451/655 (68.85%), Query Frame = 2
Query:   89 GDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
             DI V++ YF++VL VG+WA  R NR +VGG+FLAGR M W P+GASLFASNIGSGHF+GLAGSGA++GIA   FE N + ++++LGWIF+P+YI  G+ TMPEYLKKRFGG RIRIYL+V++L+LYIFTKIS D+++GAIFI Q++ L +Y +VI LLL  AV+ + GGL AVI+TD +QT IMLIG+  LM  +F E+GGY      Y Q++P      NFS           +C  P  ++ H  R     +LPWPG++FGLTI +IWY+C DQVIVQR L+AKNL+  K G +LC +LK+LPM+L+VFPGM SR+L+ D VAC  PEEC+  CG   GCS++AYPKLV++++P G RGLML+VMLASL+SSLTSIFNSAST+FT D++ ++R  A + ELMI GR+F L ++ + IAWIP+VQ+  S +LF Y QS+TSYL+PPI AV++LA+F KR NE GAF GLM GL IGLSR  TE  Y    C   +  P+++  VHYL+FGI+LF ++ II +  SL+T P++ +H   L  W+ R    +R VD   ++     D  ++ K+             + +KA+   CG+E+     + P L+ +E  E++K      E P W+ VVNT  + L+++ +F  GFYA
Sbjct:   30 ADISVIVIYFLVVLAVGIWAMVRTNRSTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGSGAAAGIATGGFEWNVLIVIVLLGWIFVPIYIKAGVVTMPEYLKKRFGGSRIRIYLSVLSLILYIFTKISTDMFSGAIFINQALGLNIYVAVIALLLITAVYTVTGGLAAVIYTDTLQTFIMLIGSFILMGFAFNEVGGYARFEELYMQAVPTIKG--NFSA----------ECFEPRPDSFHLFRDPVTGDLPWPGMVFGLTIQAIWYFCNDQVIVQRCLSAKNLSHVKGGCVLCGYLKLLPMFLMVFPGMISRILYPDVVACVDPEECQSYCGSSVGCSNIAYPKLVVDLMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDMYTKIRPRAKERELMIAGRLFTLGLIGVSIAWIPVVQTAQSGQLFDYAQSITSYLAPPIAAVFILAIFCKRVNEPGAFYGLMIGLPIGLSRMITEFVYGTGSCANPSDCPTIICGVHYLYFGIILFVLSCIIIIGISLMTKPIEDKHLHRLC-WSLRNSTEER-VDLEKDDWVGREDNSINEKE-------PKKEQGFCKKALLCFCGLEE----SEAPKLSPEEEAELKKQLTDTTEAPLWRKVVNTNAIILLSVAMFCHGFYA 659          
BLAST of slc5a-2 vs. Ensembl Medaka
Match: slc5a2 (solute carrier family 5 member 2 [Source:NCBI gene;Acc:101155288])

HSP 1 Score: 514.998 bits (1325), Expect = 1.317e-174
Identity = 324/660 (49.09%), Postives = 454/660 (68.79%), Query Frame = 2
Query:   83 EGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVD---KGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
               DI V++GYFV+VLGVG W+  R NRG+VGGYFLAGR M W PVGASLFASNIGSGHF+GLAG+GA+SGIA+  FE NA+F +L+LGW+F+PVY++ G+ TMPEYLKKRFGG RI +YL+V++LLLYIFTKIS D+++GA+FI+Q++   +Y SVI LL+  AV+ + GGL A+++TD +QT +++ GA  L   SF E+GGY  L+ +Y  ++P      N+++      N    C  P ++A   +R+ +  +LPWPGV+FG+++S IWYWC+DQVIVQR LAA++LT  K+G +LC +LK+LPM+L+VFPGM SR+L+ DEV C +PE+CKRIC  E GCS++AYPKLV+ ++P+G RGLMLAVMLA+L+SSL SIFNS+ST+FT DIW R+R  A + EL+IVGRV+VL +VAI I WIP+VQ+  S +LF YIQSV+SYLSPPI A++LLA+F KR NE GAF GL+ GL +GL R   E  +    C   +  P +L  +HYLHF I+LF  T ++ +  S+ + P+  RH   L+F     +  + ++D   +       E + + +A   I+  K         +  IN +  +  L N         +   + Q++ + I EDP WK  V+   L ++ + +F WG++A
Sbjct:   12 NAADISVIVGYFVMVLGVGFWSMFRTNRGTVGGYFLAGRSMSWWPVGASLFASNIGSGHFVGLAGTGAASGIAVGGFEWNALFTVLLLGWLFVPVYLTAGVITMPEYLKKRFGGTRISLYLSVVSLLLYIFTKISVDMFSGAVFIQQALGWNIYLSVIALLIITAVYTVTGGLAALMYTDTVQTFVIIAGAFALTGFSFAEIGGYSALLAKYGSAVPH-----NYTSLDPQRYNISSQCYTPRQDAFTLLRNPTTGDLPWPGVLFGISVSGIWYWCSDQVIVQRCLAARSLTHVKAGCILCGYLKLLPMFLMVFPGMISRILYPDEVGCVVPEDCKRICETEVGCSNIAYPKLVVSVMPSGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIWTRIRPQAFERELIIVGRVWVLCIVAISICWIPVVQAAQSGQLFDYIQSVSSYLSPPIAAIFLLAVFVKRVNETGAFWGLIGGLAMGLCRMLPEFWFGTGSCVFPSDCPFLLCGIHYLHFAIILFLCTSVLVLIVSICSEPIHDRHLYRLVFSLRHSKEDREDLDWEQQEHGRRAKETERQNNAAAVIEERK---------KSVINRM--VASLCNMGGNSEEPEELENQEQQMPD-ISEDPVWKYTVDANALIMMAVAVFMWGYFA 654          
BLAST of slc5a-2 vs. Ensembl Medaka
Match: slc5a9 (sodium/glucose cotransporter 4 [Source:NCBI gene;Acc:101159252])

HSP 1 Score: 501.516 bits (1290), Expect = 2.524e-169
Identity = 323/660 (48.94%), Postives = 446/660 (67.58%), Query Frame = 2
Query:   74 GKLEGGDIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            G ++  DI VV+ YF++V+  G+WAS R NR +VGGYFLAGR M W P+GASL +SN+GSG FIGLAG+GA+ GIA+  FE NA ++L+ LGWIF+PVYIS G+ TMPEYL KRFGG RIRIY++V++LLLYIFTKIS D+++GA+FI+ S    LY S  +LLL  AV+++ GGL AVI+TD +QTVIM+ GA  LM  +F ++G YE LV +Y  S+P     LN S            C  P  +A H +R     +LPWPG++FGLT+ + W WC DQVIVQR+L+AK+L+ AK+G +L  +LK+LPM+ IV PGM SR LF DEV C  P  C+ +CG   GCS++AYPKLV+E++P G RGLMLAV+LA+L+SSLTSIFNS+ST+FT D++ + R +AS+ ELMIVGR+F+LV++ I + WIP++Q++N  +LF YIQSVTS+L+PPI AV+++A+FW R NE GAF GLM+GLV+GL R   E  +PP  CG+ +  P+V++ VHYL+F ++L   T ++    SL TAP+   H   L +W+      + +++    +P        D   +      S+    W   A+ W+CG+   KN + +P  T    E     QN +QE   W+ V N   L L+   +F WG++A
Sbjct:   24 GSVDAADIAVVVVYFIVVMVTGIWASVRANRTTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGIAVGGFEWNAAWVLVALGWIFIPVYISAGVVTMPEYLAKRFGGRRIRIYMSVLSLLLYIFTKISTDMFSGALFIQVSFGWNLYLSTGVLLLVTAVYSVAGGLAAVIYTDALQTVIMVGGAFTLMFIAFSKVGWYEGLVAQYMSSVPSV-TVLNTS------------CHFPRADAFHMLRDPVSGDLPWPGLVFGLTVLATWVWCADQVIVQRSLSAKSLSHAKAGSVLGGYLKLLPMFFIVMPGMISRALFPDEVGCVDPAVCQNVCGASVGCSNIAYPKLVIELMPVGVRGLMLAVILAALMSSLTSIFNSSSTLFTLDLYHKARPNASEKELMIVGRIFILVLMCISLVWIPVIQTANSGQLFDYIQSVTSFLAPPITAVFVMAIFWPRVNEHGAFWGLMAGLVVGLIRMVLEFCFPPPACGQTDGRPAVVADVHYLYFALILLAFTGLVIAAVSLATAPISEEHLHRLTWWSRFSTEPRVDLENPQTSP--------DPGSWTSSGADSSTRSKWKAVAL-WLCGLSG-KNPESEPPRT----ENCD--QNFLQEKSVWRNVCNFNALLLLAANVFLWGYFA 654          
BLAST of slc5a-2 vs. Ensembl Medaka
Match: slc5a11 (solute carrier family 5 member 11 [Source:NCBI gene;Acc:101160661])

HSP 1 Score: 479.559 bits (1233), Expect = 1.305e-160
Identity = 326/661 (49.32%), Postives = 443/661 (67.02%), Query Frame = 2
Query:   92 DIGVVIGYFVLVLGVGLWASCRN-RGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSN--ELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSK-----REV--DKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            DI V++ YF+LVL VG W+  R  R +V GYFLAG+ M W PVGASLFASNIGSGHFIGLAGSGA++GI    +E N + ++L+LGW+FLP+YIS+G+ TMPEYL++RFGG R  + LAV++L +YIFTKIS D+YAGA+FI+ ++Q  +Y ++++LL+  A++ + GGL AVI+TD  QT IML GA  LM  SFVE+GG+  L+  Y Q++P          F+  VPN    CGIP ++A H  R   +++LPWPGVI G++I S+WYWC+DQVIVQR+LAAKNL+ AK G LL ++LK+LP + ++ PGM SR+L+TDEVAC  P+ C +ICG   GCSD+AY KLV+E+LP+G RGLM+AVM+A+L+SSLTSIFNS+STIFT D+W+  R  AS+ ELMIVGRVFVLV+V + + WIP+VQ+S   +LF YIQS+++YL PPI  ++L+  FWKR NEKGAF GL+ GL +G  R   +  YP  PC EE+  P VL  VHYL+F ILL  ITL + V  SL T    R      L W  R +  K      EV      + P   N+   + +     +  S          + W+CG+E  +   ++PV T   LE   K   S++E P  + ++N   +   ++T F  G++A
Sbjct:   29 DIVVLVIYFILVLAVGFWSMWRTKRSTVDGYFLAGKSMTWWPVGASLFASNIGSGHFIGLAGSGAAAGIGAIAYEWNGMLMVLLLGWLFLPIYISSGVTTMPEYLQRRFGGKRTHLSLAVLSLFIYIFTKISVDMYAGALFIQLALQWNIYLAIVLLLVITALYTVAGGLAAVIYTDAAQTAIMLAGALTLMGFSFVEVGGWGALMEGYSQAVP---------LFR--VPNS--TCGIPREDAFHIFRDPVNSDLPWPGVIIGMSIPSMWYWCSDQVIVQRSLAAKNLSHAKGGSLLASYLKILPFFAVMLPGMISRILYTDEVACADPDLCNQICGNSVGCSDIAYAKLVMELLPSGLRGLMMAVMIAALMSSLTSIFNSSSTIFTLDLWKSFRSEASEWELMIVGRVFVLVLVVVSVLWIPVVQASQGGQLFIYIQSISTYLQPPISIIFLMGCFWKRANEKGAFWGLVIGLAVGCLRMLLDFIYPTPPCYEEDTRPGVLKYVHYLYFSILLSVITLSVVVVVSLATEE-PRPEQISRLTWFTRFDAVKPKEKLEEVISQSNAKEPERSNEHTAEHRPSSASSMSSTSSQSRGMAVLYWLCGMERRRQGDNKPV-TPPALE---KNICSLEEKPTLQYIMNVNLIICFSVTAFIIGYWA 671          
BLAST of slc5a-2 vs. Planmine SMEST
Match: SMESG000013622.1 (SMESG000013622.1)

HSP 1 Score: 1162.13 bits (3005), Expect = 0.000e+0
Identity = 657/661 (99.39%), Postives = 659/661 (99.70%), Query Frame = 2
Query:   62 MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNXXXXXXXXXXXFYWGFYA 2044
            MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFIGLAGSGASSGIAIAVFELNAIFILLILGWIFLPVYISTGIFTMPEYLKKRFGGVRIRIYLAVIALLLYIFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFS FQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGLMLAVMLASLVSSLTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYLHFGILLFGITLIISVTSSL+TAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKK IDVTKGS+LPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNTICLTLITITIFYWGFYA
Sbjct:    1 MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFIGLAGSGASSGIAIAVFELNAIFILLILGWIFLPVYISTGIFTMPEYLKKRFGGVRIRIYLAVIALLLYIFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSIFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGLMLAVMLASLVSSLTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYLHFGILLFGITLIISVTSSLITAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKDIDVTKGSDLPLPWYRKAINWVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNTICLTLITITIFYWGFYA 661          
BLAST of slc5a-2 vs. Planmine SMEST
Match: SMESG000051963.1 (SMESG000051963.1)

HSP 1 Score: 339.732 bits (870), Expect = 9.621e-110
Identity = 219/467 (46.90%), Postives = 313/467 (67.02%), Query Frame = 2
Query:   92 DIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAF 1483
            DI V++ YFV ++  G  + CR NR ++ GYFLAG+ M W+PVGASLFASNIGS HFIGLAGSGA+ GI +  FELNA  +L +LGW+FLPV+I++G +T+PEY+ KRFGG R++ YLAV++L++YIFTKIS +LY+ ++FI ++++L ++ SV +LL    +  + GGL AV++TD  Q +IM+IG+  L + SF ++GG   L  +Y Q++ +    +N +     + +    C +P K A    R   D ++PW G I G T +SIWYWCTDQ++VQR L+AKNL+ AK G +    LK+LP++++V PGM SR+LF                                     G RGLML+VMLA+LVS LTSIFNSAST+FT DI++ +R  A++ ELMI+GR+FVL+M+ + I W+P++Q+    +LF YIQ+++ YLSPPI A Y++A+FW R NEK  F
Sbjct:    9 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIAR----VNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILF------------------------------------PGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLIMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKVIF 435          
BLAST of slc5a-2 vs. Planmine SMEST
Match: SMESG000051963.1 (SMESG000051963.1)

HSP 1 Score: 205.297 bits (521), Expect = 3.787e-58
Identity = 132/276 (47.83%), Postives = 191/276 (69.20%), Query Frame = 2
Query:   92 DIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQ 916
            DI V++ YFV ++  G  + CR NR ++ GYFLAG+ M W+PVGASLFASNIGS HFIGLAGSGA+ GI +  FELNA  +L +LGW+FLPV+I++G +T+PEY+ KRFGG R++ YLAV++L++YIFTKIS +LY+ ++FI ++++L ++ SV +LL    +  + GGL AV++TD  Q +IM+IG+  L + SF ++GG   L  +Y Q++ +    +N +     + +    C +P K A    R   D ++PW G I G T +SIWYWCTDQ
Sbjct:    9 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIAR----VNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQ 280          

HSP 2 Score: 50.447 bits (119), Expect = 4.273e-6
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 2
Query: 1445 ALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDV 1813
            A  W  C ++GA   L+ GL+IG  R   +  +   PC + +  P    K H+++F +  F    ++ +  SLLT P+ +   +   +WN  K+ S    D     P  E    V  KK ID+
Sbjct:  271 ASIWYWCTDQGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVV-PKKEIDL 392          
BLAST of slc5a-2 vs. Planmine SMEST
Match: SMESG000051963.1 (SMESG000051963.1)

HSP 1 Score: 204.142 bits (518), Expect = 1.087e-57
Identity = 132/276 (47.83%), Postives = 191/276 (69.20%), Query Frame = 2
Query:   92 DIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQ 916
            DI V++ YFV ++  G  + CR NR ++ GYFLAG+ M W+PVGASLFASNIGS HFIGLAGSGA+ GI +  FELNA  +L +LGW+FLPV+I++G +T+PEY+ KRFGG R++ YLAV++L++YIFTKIS +LY+ ++FI ++++L ++ SV +LL    +  + GGL AV++TD  Q +IM+IG+  L + SF ++GG   L  +Y Q++ +    +N +     + +    C +P K A    R   D ++PW G I G T +SIWYWCTDQ
Sbjct:    9 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIAR----VNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQ 280          

HSP 2 Score: 110.923 bits (276), Expect = 2.139e-25
Identity = 64/110 (58.18%), Postives = 88/110 (80.00%), Query Frame = 2
Query: 1160 GARGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAF 1483
            G RGLML+VMLA+LVS LTSIFNSAST+FT DI++ +R  A++ ELMI+GR+FVL+M+ + I W+P++Q+    +LF YIQ+++ YLSPPI A Y++A+FW R NEK  F
Sbjct:  393 GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLIMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKVIF 502          

HSP 3 Score: 51.6026 bits (122), Expect = 1.852e-6
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 2
Query: 1445 ALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYXXXXXXXXXXXXXXSVTSSLLTAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKYIDV 1813
            A  W  C ++GA   L+ GL+IG  R   +  +   PC + +  P    K H+++F +  F    ++ +  SLLT P+ +   +   +WN  K+ S    D     P  E    V  KK ID+
Sbjct:  271 ASIWYWCTDQGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVP-KKEIDL 392          
BLAST of slc5a-2 vs. Planmine SMEST
Match: SMESG000047775.1 (SMESG000047775.1)

HSP 1 Score: 78.5666 bits (192), Expect = 7.867e-15
Identity = 122/460 (26.52%), Postives = 204/460 (44.35%), Query Frame = 2
Query:  155 RNRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFXXXXXXXXXXXXXXXVFELNAXXXXXXXXXXXXPVYISTGIFTMPEYLKKRFGGVXXXXXXXXXXXXXXXFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGA--RGXXXXXXXXXXXXXXTSIFNSASTIFTFDIWQRLRKSASDV-----ELMIVGRVFVLVMVAIGIAWIPIVQ-SSNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVI 1510
            RN+  +  YFLA R+M  IPV AS+  S + +   +G       SGI  AV   +      +  +++LP +    I +  EYL+ RFG +       V  + +  +  IS  LYA A+   Q   L L+ S++   +    +  LGG+ AVIWTD +Q VIML G    M+T  +        V+  ++   K GR +N   F NP P               F R S      +  + FG T   +  + T+Q  VQR L+ +    A   +++   L    +WL++  G+   V F+    C+ P     I    KG  D  +P  V+ +L   +   GL L+ + A+ +S+++S  NS S++   DI     ++  D+        +  ++  L + AI I +  +   +S+ +     S+      PI +V+ + L     N KGA  GL+  +++
Sbjct:   36 RNKTVIKEYFLANRKMGLIPVTASILVSFMSAISILGTVSEVYVSGIEYAVIGFSYFIAFPLAAYVYLPTFYRLKIVSAHEYLELRFGRLIRICVSIVFIIQMIFY--ISVVLYAPALAFSQVSGLSLWISILSTGIVCTFYTALGGMRAVIWTDLMQFVIMLCG----MLTVVIVGVIRVGGVSAVWEISKKNGR-INLFNF-NPDP---------------FSRHS------FWSLFFGGTGMCMSIYATNQAQVQRYLSCRTEKIAIGSLMINTPLTFGFLWLLIGAGL---VTFSSLATCD-PLTSGEI---NKG--DQIFPYFVIRLLHQYSPLPGLFLSTIFAAGLSTISSGINSLSSVIMEDILSVCPRNDVDIANRVNRTALYAKIIALTLGAITITFAFLFSLASSTVLQIALSLFGMAGGPILSVFTMGLIIPCVNAKGAICGLIGSILV 457          
The following BLAST results are available for this feature:
BLAST of slc5a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC5A16.768e-17349.54solute carrier family 5 member 1 [Source:HGNC Symb... [more]
SLC5A41.793e-16845.97solute carrier family 5 member 4 [Source:HGNC Symb... [more]
SLC5A93.498e-16749.70solute carrier family 5 member 9 [Source:HGNC Symb... [more]
SLC5A25.484e-16648.19solute carrier family 5 member 2 [Source:HGNC Symb... [more]
SLC5A116.217e-16348.74solute carrier family 5 member 11 [Source:HGNC Sym... [more]
back to top
BLAST of slc5a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZK822.52.358e-623.91pep chromosome:WBcel235:IV:11938574:11940604:1 gen... [more]
ZK822.52.994e-623.91pep chromosome:WBcel235:IV:11937418:11940604:1 gen... [more]
ZK822.52.994e-623.91pep chromosome:WBcel235:IV:11937384:11940604:1 gen... [more]
back to top
BLAST of slc5a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG21874.443e-921.16gene:FBgn0017448 transcript:FBtr0303376[more]
CG21874.443e-921.16gene:FBgn0017448 transcript:FBtr0085861[more]
CG326693.857e-822.53gene:FBgn0052669 transcript:FBtr0073412[more]
salt2.579e-722.60gene:FBgn0039872 transcript:FBtr0339190[more]
salt2.765e-722.60gene:FBgn0039872 transcript:FBtr0300915[more]
back to top
BLAST of slc5a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a90.000e+050.38solute carrier family 5 member 9 [Source:NCBI gene... [more]
slc5a10.000e+050.53solute carrier family 5 member 1 [Source:ZFIN;Acc:... [more]
slc5a21.239e-17649.47solute carrier family 5 member 2 [Source:ZFIN;Acc:... [more]
SLC5A103.634e-16852.58si:dkeyp-9d4.5 [Source:ZFIN;Acc:ZDB-GENE-121214-88... [more]
SLC5A103.397e-16253.80si:dkeyp-9d4.5 [Source:ZFIN;Acc:ZDB-GENE-121214-88... [more]
back to top
BLAST of slc5a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC5A101.302e-17448.65solute carrier family 5 (sodium/sugar cotransporte... [more]
SLC5A111.386e-17449.85solute carrier family 5 (sodium/inositol cotranspo... [more]
SLC5A109.482e-17448.74solute carrier family 5 (sodium/sugar cotransporte... [more]
SLC5A92.612e-17248.64solute carrier family 5 member 9 [Source:NCBI gene... [more]
SLC5A92.088e-17050.00solute carrier family 5 member 9 [Source:NCBI gene... [more]
back to top
BLAST of slc5a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc5a10.000e+049.62solute carrier family 5 (sodium/glucose cotranspor... [more]
Slc5a91.708e-17150.00solute carrier family 5 (sodium/glucose cotranspor... [more]
Slc5a91.708e-17150.00solute carrier family 5 (sodium/glucose cotranspor... [more]
Slc5a91.708e-17150.00solute carrier family 5 (sodium/glucose cotranspor... [more]
Slc5a22.777e-16948.71solute carrier family 5 (sodium/glucose cotranspor... [more]
back to top
BLAST of slc5a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8WHP3|SC5A9_DANRE0.000e+050.38Sodium/glucose cotransporter 4 OS=Danio rerio OX=7... [more]
sp|P53790|SC5A1_RAT0.000e+049.77Sodium/glucose cotransporter 1 OS=Rattus norvegicu... [more]
sp|P53791|SC5A1_SHEEP0.000e+049.55Sodium/glucose cotransporter 1 OS=Ovis aries OX=99... [more]
sp|P11170|SC5A1_RABIT0.000e+049.85Sodium/glucose cotransporter 1 OS=Oryctolagus cuni... [more]
sp|Q8C3K6|SC5A1_MOUSE1.896e-17849.24Sodium/glucose cotransporter 1 OS=Mus musculus OX=... [more]
back to top
BLAST of slc5a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF440.000e+0100.00Slc5a-2 OS=Schmidtea mediterranea OX=79327 GN=slc5... [more]
V4AV990.000e+059.33Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A267DAD70.000e+057.37Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FY990.000e+057.62Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FUL10.000e+057.23Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of slc5a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a10.000e+052.06sodium/glucose cotransporter 1-like [Source:NCBI g... [more]
slc5a22.015e-17250.60solute carrier family 5 member 2 [Source:NCBI gene... [more]
slc5a12.025e-16748.55solute carrier family 5 member 1 [Source:ZFIN;Acc:... [more]
si:dkeyp-9d4.52.398e-16553.49solute carrier family 5 member 10 [Source:NCBI gen... [more]
si:dkeyp-9d4.58.282e-16453.49solute carrier family 5 member 10 [Source:NCBI gen... [more]
back to top
BLAST of slc5a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a10.000e+049.47solute carrier family 5 member 1 [Source:ZFIN;Acc:... [more]
slc5a97.641e-15852.37solute carrier family 5 member 9 [Source:NCBI gene... [more]
slc5a3a4.051e-13150.10solute carrier family 5 member 3a [Source:ZFIN;Acc... [more]
ENSPMAT00000003316.12.768e-11649.76pep scaffold:Pmarinus_7.0:GL476336:129493:160966:1... [more]
slc5a54.307e-1524.78solute carrier family 5 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc5a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc5a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO435822.653e-15343.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448331.673e-14048.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461995.285e-10744.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462002.240e-9945.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403137.657e-1625.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc5a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a11.957e-18050.46sodium/glucose cotransporter 1 [Source:NCBI gene;A... [more]
slc5a11.873e-17650.69sodium/glucose cotransporter 1-like [Source:NCBI g... [more]
slc5a21.317e-17449.09solute carrier family 5 member 2 [Source:NCBI gene... [more]
slc5a92.524e-16948.94sodium/glucose cotransporter 4 [Source:NCBI gene;A... [more]
slc5a111.305e-16049.32solute carrier family 5 member 11 [Source:NCBI gen... [more]
back to top
BLAST of slc5a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013622.10.000e+099.39SMESG000013622.1[more]
SMESG000051963.19.621e-11046.90SMESG000051963.1[more]
SMESG000051963.13.787e-5847.83SMESG000051963.1[more]
SMESG000051963.11.087e-5747.83SMESG000051963.1[more]
SMESG000047775.17.867e-1526.52SMESG000047775.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013493
GenBankAKN21417.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013493 ID=SMED30013493|Name=slc5a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2123bp
TATTCAATTTGTCAAATAATCTTAGCACATTCTTATTTGTCTTATAATAT
CAAGTTTGTTAATGGCATTAGTTGGTAAACTCGAAGGGGGTGACATTGGA
GTTGTGATTGGGTATTTTGTACTGGTTTTGGGTGTTGGACTATGGGCTTC
ATGCAGGAATCGAGGCAGCGTTGGCGGGTACTTTTTAGCAGGCCGACAAA
TGCATTGGATACCTGTCGGCGCATCATTATTTGCAAGTAACATTGGATCG
GGTCACTTTATTGGTCTAGCCGGCTCCGGAGCTTCTTCTGGAATAGCCAT
AGCGGTTTTTGAATTGAATGCAATATTTATTCTTCTCATCTTGGGATGGA
TATTTTTACCTGTCTATATATCTACAGGAATATTCACAATGCCAGAATAT
TTAAAGAAGCGTTTTGGGGGTGTAAGAATCAGAATCTACTTGGCAGTTAT
TGCTTTGCTTCTTTATATATTTACAAAGATATCAGCGGATTTGTATGCAG
GAGCTATTTTTATTGAACAGAGTGTACAATTGCCTCTTTATCCATCAGTC
ATTATTTTACTGCTATTTGCTGCCGTTTTTAATATTTTGGGGGGCCTGAC
AGCTGTAATCTGGACGGATTTTATTCAAACTGTCATTATGCTTATTGGTG
CGTCATATCTCATGATAACAAGTTTTGTAGAGCTTGGCGGATATGAGAAT
TTGGTTACTCGATACTTTCAATCTCTTCCAAAGACTGGAAGATATTTAAA
TTTTTCCACTTTTCAAAATCCTGTTCCGAATAAATACTTTGATTGTGGGA
TACCCGATAAAAATGCCATGCATTTTATGAGATCTAGTTCTGATACAAAT
CTCCCTTGGCCCGGAGTGATCTTTGGACTGACCATAAGTAGTATTTGGTA
TTGGTGTACTGATCAGGTTATTGTTCAACGGGCTCTGGCGGCAAAAAATT
TGACGTTCGCAAAAAGTGGCATTTTATTATGCGCTTGGTTAAAAATGCTT
CCAATGTGGTTGATTGTTTTTCCAGGCATGGCCTCAAGGGTTCTTTTTAC
AGATGAAGTTGCTTGTAACATTCCCGAAGAATGTAAAAGAATTTGTGGGA
AAGAGAAAGGCTGTTCCGATGTGGCTTACCCTAAACTGGTTCTAGAAATC
TTGCCAACTGGGGCCCGAGGATTAATGTTAGCAGTCATGTTGGCCAGTTT
GGTATCCAGCTTGACAAGTATATTTAATTCAGCATCTACAATTTTCACAT
TCGATATTTGGCAAAGATTGCGTAAATCTGCTTCAGATGTTGAACTCATG
ATTGTTGGACGAGTATTTGTTCTCGTAATGGTAGCCATAGGTATAGCGTG
GATACCAATTGTCCAGTCCAGTAATGAACTGTTTCATTACATTCAATCAG
TTACCAGCTATCTGTCACCACCAATTTGTGCCGTATATTTACTGGCATTA
TTTTGGAAACGCTGTAATGAAAAGGGTGCTTTTATTGGGCTTATGTCTGG
ATTAGTAATTGGATTATCTAGATTCTTCACCGAAGTTGCATATCCTCCTA
AACCTTGTGGAGAGGAGAACATAATTCCTTCGGTTTTATCGAAAGTTCAT
TATTTACACTTTGGAATACTTTTATTTGGAATAACATTAATAATATCAGT
TACATCGAGTCTTCTTACTGCGCCAATGGATAGGCGACATACTGATGGCC
TTTTATTTTGGAATTGCAGGAAAGAATATTCAAAACGTGAAGTTGATAAA
GGAACCGAAAACCCATGCTATGAAAATGATTTTGAGGTTGATGCGAAAAA
ATACATTGATGTTACAAAAGGTAGTAATTTACCTTTGCCTTGGTATAGGA
AAGCAATAAACTGGGTTTGTGGTATTGAAGATCTTAAAAACGCAAAGGAT
CAACCGGTTTTGACAGCACAAGAACTTGAAGAAATCCAAAAATTACAAAA
TAGCATACAGGAAGATCCAAAATGGAAATTAGTTGTGAATACTATTTGCT
TAACTTTAATAACAATCACAATTTTTTACTGGGGTTTTTATGCCTGATCG
TCAATTAGAATGTCCAAATGTCTTTGAAATTTATTCATAAATAATACATT
TGAATTTCCCTTTTAAAAAAAAA
back to top

protein sequence of SMED30013493-orf-1

>SMED30013493-orf-1 ID=SMED30013493-orf-1|Name=SMED30013493-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=662bp
MALVGKLEGGDIGVVIGYFVLVLGVGLWASCRNRGSVGGYFLAGRQMHWI
PVGASLFASNIGSGHFIGLAGSGASSGIAIAVFELNAIFILLILGWIFLP
VYISTGIFTMPEYLKKRFGGVRIRIYLAVIALLLYIFTKISADLYAGAIF
IEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYL
MITSFVELGGYENLVTRYFQSLPKTGRYLNFSTFQNPVPNKYFDCGIPDK
NAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFA
KSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKG
CSDVAYPKLVLEILPTGARGLMLAVMLASLVSSLTSIFNSASTIFTFDIW
QRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQSSNELFHYIQSVTSY
LSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCG
EENIIPSVLSKVHYLHFGILLFGITLIISVTSSLLTAPMDRRHTDGLLFW
NCRKEYSKREVDKGTENPCYENDFEVDAKKYIDVTKGSNLPLPWYRKAIN
WVCGIEDLKNAKDQPVLTAQELEEIQKLQNSIQEDPKWKLVVNTICLTLI
TITIFYWGFYA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000087proximal tubule
Vocabulary: INTERPRO
TermDefinition
IPR038377Na/Glc_symporter_sf
IPR001734Na/solute_symporter
IPR023171Na/H_antiporter_dom
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001734Sodium/solute symporterPFAMPF00474SSFcoord: 40..480
e-value: 2.2E-133
score: 445.1
IPR001734Sodium/solute symporterTIGRFAMTIGR00813TIGR00813coord: 40..480
e-value: 4.3E-142
score: 471.9
IPR001734Sodium/solute symporterPROSITEPS50283NA_SOLUT_SYMP_3coord: 8..494
score: 77.181
IPR038377Sodium/glucose symporter superfamilyGENE3DG3DSA:1.20.1730.10coord: 30..550
e-value: 9.2E-158
score: 527.9
NoneNo IPR availablePANTHERPTHR11819SODIUM/SOLUTE SYMPORTERcoord: 7..660
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..31
score: 5.0
NoneNo IPR availableTMHMMTMhelixcoord: 414..433
NoneNo IPR availableTMHMMTMhelixcoord: 443..465
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 371..393
NoneNo IPR availableTMHMMTMhelixcoord: 162..184
NoneNo IPR availableTMHMMTMhelixcoord: 472..494
NoneNo IPR availableTMHMMTMhelixcoord: 640..659
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 10..29
NoneNo IPR availableTMHMMTMhelixcoord: 191..210
NoneNo IPR availableTMHMMTMhelixcoord: 514..536
NoneNo IPR availableTMHMMTMhelixcoord: 86..108
NoneNo IPR availableTMHMMTMhelixcoord: 125..147
NoneNo IPR availableTMHMMTMhelixcoord: 264..281