Dihydropyrimidinase

Overview
NameDihydropyrimidinase
Smed IDSMED30013480
Length (bp)1993
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dihydropyrimidinase (SMED30013480) t-SNE clustered cells

Violin plots show distribution of expression levels for Dihydropyrimidinase (SMED30013480) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dihydropyrimidinase (SMED30013480) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dihydropyrimidinase (SMED30013480) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013480

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30013480SMESG000060188.1 SmedASXL_018986SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000060188.1 Contig54744uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000060188.1 Contig54744newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000060188.1 Contig51187uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000060188.1 Contig51187newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000060188.1 Contig5832uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000060188.1 Contig5832newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000081370.1 Contig5832uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000081370.1 Contig5832newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000076680.1 SMESG000061231.1 SMESG000060188.1 SMESG000057434.1 SMESG000056845.1 SMESG000050587.1 SMESG000041246.1 SMESG000025027.1 SMESG000018611.1 SMESG000017693.1 SMESG000009491.1 Contig36210uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013480SMESG000076680.1 SMESG000061231.1 SMESG000060188.1 SMESG000057434.1 SMESG000056845.1 SMESG000050587.1 SMESG000041246.1 SMESG000025027.1 SMESG000018611.1 SMESG000017693.1 SMESG000009491.1 Contig36210newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30013480SMESG000060188.1 OX_Smed_1.0.04669ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30013480SMESG000060188.1 dd_Smed_v6_2040_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013480SMESG000060188.1 dd_Smed_v4_2040_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dihydropyrimidinase vs. Ensembl Human
Match: DPYSL3 (dihydropyrimidinase like 3 [Source:HGNC Symbol;Acc:HGNC:3015])

HSP 1 Score: 302.753 bits (774), Expect = 7.810e-94
Identity = 175/505 (34.65%), Postives = 280/505 (55.45%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            T  +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G+ + +++F GTKAA+ GGTT +++ +    + SL E YE  ++    +  C+ A+ + +   N+++K E   L++ K V   +V ++  D      ++ + ELY+      +   +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  KV +KS+ D ++   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG IS+GSD+D+++W  D+V    + ++  A + N+FE +     P  VI  G ++L+ +GN   ++G+G+ +  S    + Y  K++   +   ++   + R  YDGPV D
Sbjct:   13 TSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKD----LYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAAD-LISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLE-DGNLHVTQGAGRFIPCS--PFSDYVYKRIKARRKMADLH-AVPRGMYDGPVFD 505          
BLAST of Dihydropyrimidinase vs. Ensembl Human
Match: DPYSL3 (dihydropyrimidinase like 3 [Source:HGNC Symbol;Acc:HGNC:3015])

HSP 1 Score: 302.753 bits (774), Expect = 1.400e-92
Identity = 176/516 (34.11%), Postives = 285/516 (55.23%), Query Frame = 2
Query:  116 KLLIKVLFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            K +++ L   +   +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G+ + +++F GTKAA+ GGTT +++ +    + SL E YE  ++    +  C+ A+ + +   N+++K E   L++ K V   +V ++  D      ++ + ELY+      +   +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  KV +KS+ D ++   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG IS+GSD+D+++W  D+V    + ++  A + N+FE +     P  VI  G ++L+ +GN   ++G+G+ +  S    + Y  K++   +   ++   + R  YDGPV D
Sbjct:  116 KEVLQNLGPKDKSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKD----LYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAAD-LISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLE-DGNLHVTQGAGRFIPCS--PFSDYVYKRIKARRKMADLH-AVPRGMYDGPVFD 619          
BLAST of Dihydropyrimidinase vs. Ensembl Human
Match: DPYSL5 (dihydropyrimidinase like 5 [Source:HGNC Symbol;Acc:HGNC:20637])

HSP 1 Score: 294.664 bits (753), Expect = 8.070e-91
Identity = 184/575 (32.00%), Postives = 294/575 (51.13%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVI------RTSVKTAQPPGGSAQASW 1825
            +  +    ++LIK G V+N DCT++ADV IENG I  + + +     A+ IDATG  V+PGG+D  T+F          ++++ GTKAA+ GGTT ++  +   K+ SL + YE  + +   ++ C+ A+ + +      +K+E   L++ K V       T         + D ELY  L  C+D   +  VHAEN ++VA   KE L  G+TGPEG  +SRPE++E EA  RV+TIA    CPI+   V + S+ D ++   +     ++  T+          Y   +W  AA++VT+P L+++  T    T L+  +A+  +N VAS H  F  K KA G+ DF  I  G +GVQ RM ++W++ V  G+M+   FV   S+  AKL N+YP KG I  G+DAD++VW  ++     + +  + GD N++E++ CH  P   I  G VV ++ G F  ++G+G+     L +      K+L+  + + +V + + R PY G V       K+E     +      V + GG  +  + +       I      R S +   PPGG +   W
Sbjct:    1 MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKD---LYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGD-VIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTS---TYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYEN-GVFMCAEGTGKFC--PLRSFPDTVYKKLVQREKTLKV-RGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW 564          
BLAST of Dihydropyrimidinase vs. Ensembl Human
Match: DPYSL5 (dihydropyrimidinase like 5 [Source:HGNC Symbol;Acc:HGNC:20637])

HSP 1 Score: 294.664 bits (753), Expect = 8.070e-91
Identity = 184/575 (32.00%), Postives = 294/575 (51.13%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVI------RTSVKTAQPPGGSAQASW 1825
            +  +    ++LIK G V+N DCT++ADV IENG I  + + +     A+ IDATG  V+PGG+D  T+F          ++++ GTKAA+ GGTT ++  +   K+ SL + YE  + +   ++ C+ A+ + +      +K+E   L++ K V       T         + D ELY  L  C+D   +  VHAEN ++VA   KE L  G+TGPEG  +SRPE++E EA  RV+TIA    CPI+   V + S+ D ++   +     ++  T+          Y   +W  AA++VT+P L+++  T    T L+  +A+  +N VAS H  F  K KA G+ DF  I  G +GVQ RM ++W++ V  G+M+   FV   S+  AKL N+YP KG I  G+DAD++VW  ++     + +  + GD N++E++ CH  P   I  G VV ++ G F  ++G+G+     L +      K+L+  + + +V + + R PY G V       K+E     +      V + GG  +  + +       I      R S +   PPGG +   W
Sbjct:    1 MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKD---LYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGD-VIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTS---TYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYEN-GVFMCAEGTGKFC--PLRSFPDTVYKKLVQREKTLKV-RGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW 564          
BLAST of Dihydropyrimidinase vs. Ensembl Human
Match: DPYSL5 (dihydropyrimidinase like 5 [Source:HGNC Symbol;Acc:HGNC:20637])

HSP 1 Score: 294.664 bits (753), Expect = 8.070e-91
Identity = 184/575 (32.00%), Postives = 294/575 (51.13%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVI------RTSVKTAQPPGGSAQASW 1825
            +  +    ++LIK G V+N DCT++ADV IENG I  + + +     A+ IDATG  V+PGG+D  T+F          ++++ GTKAA+ GGTT ++  +   K+ SL + YE  + +   ++ C+ A+ + +      +K+E   L++ K V       T         + D ELY  L  C+D   +  VHAEN ++VA   KE L  G+TGPEG  +SRPE++E EA  RV+TIA    CPI+   V + S+ D ++   +     ++  T+          Y   +W  AA++VT+P L+++  T    T L+  +A+  +N VAS H  F  K KA G+ DF  I  G +GVQ RM ++W++ V  G+M+   FV   S+  AKL N+YP KG I  G+DAD++VW  ++     + +  + GD N++E++ CH  P   I  G VV ++ G F  ++G+G+     L +      K+L+  + + +V + + R PY G V       K+E     +      V + GG  +  + +       I      R S +   PPGG +   W
Sbjct:    1 MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKD---LYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGD-VIAAAKMQGKVVLAETTTAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTS---TYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYEN-GVFMCAEGTGKFC--PLRSFPDTVYKKLVQREKTLKV-RGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW 564          
BLAST of Dihydropyrimidinase vs. Ensembl Celegans
Match: dhp-2 (Dihydropyrimidinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q18677])

HSP 1 Score: 268.47 bits (685), Expect = 7.802e-82
Identity = 172/557 (30.88%), Postives = 286/557 (51.35%), Query Frame = 2
Query:  161 LLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLA-ECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            LLIK GT++N D  + +DVL+ +G+IV IA +I+ +   E +DAT   V+PGG+D  T+      G ++ +++  GT+AA+ GGTT +++ +   K ESL   Y+  +     ++VC+  + + +      I  E   +  ++  +   +      G   V+  DEE Y  +  C     L  VHAEN  ++A   + LL+ G+TGPEGH  SRPE++E EA FR  T+A    CP++   V +K +   I   ++K +  ++ G  + A L  +   Y + +W  AA +V  P L  + +T    + L++ +A+ +++  A+ +  FD + K+ G++DF  I  G NGV+ RM ++WDK V +G ++P  FV   ST  AK+ N YP KG I++GSDADI++W  ++       ++  A D N+FE +  H  P+  I  G  V  + G     +GSGQ +  + ++   +    + N K + E   KI R PY     +PSA        L +   N ++                   V++  V+ A PPGG++
Sbjct:    3 LLIKNGTIVNDDAIFKSDVLVLDGRIVEIAPSIQPTPGLEVVDATDRLVIPGGIDPHTHMQLPFMGEIAKDDFHRGTEAAVAGGTTMIIDFVIPTKGESLLVAYDRWRGWADPKVVCDYGLSMAITSWGPEIAKEMEIVTGAEYGINSFKFFLAYAGVFMVR--DEEFYQGMIQCAKLRALARVHAENGSVIAERCEHLLSSGITGPEGHTQSRPEELEAEATFRACTMASQANCPLYVVHVMSKGAAAAIAHHRKKGA--VVFGEPIAAGLATDGSHYYNEDWLHAARYVMSPPLSRDPSTP---SALMKLLAAGELHLTATDNCTFDCQQKSLGKDDFTKIPNGVNGVEDRMSVVWDKGVHAGIIDPMRFVAVTSTMAAKIFNCYPQKGRIAVGSDADIVIWNANATRTISKDTHHHAIDFNIFEGMQVHGVPEITISRGRTVWAN-GQLKTVQGSGQFIPLAPDSQIVF--SAVDNRKKAME-PVKIDRIPY-----EPSA--------LQTPDANANI-------------------VVKAPVRAAIPPGGAS 516          
BLAST of Dihydropyrimidinase vs. Ensembl Celegans
Match: dhp-1 (Dihydropyrimidinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21773])

HSP 1 Score: 239.965 bits (611), Expect = 2.192e-71
Identity = 152/471 (32.27%), Postives = 241/471 (51.17%), Query Frame = 2
Query:  161 LLIKCGTVINHDCTYDADVLIENGKIVNIAKNIED-SLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVN--CLEIMKDESLKEKYEMEKDIISKEIVCN----LAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS-------HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV 1528
            L+IK GTV+N D  + ADVL+ NG IV ++ NI      E IDAT   V+PGG+D  T+      G V+ +++  GT+AA+ GGTT +++  C +    ESL   Y   +     ++ C+    +AI +  PE  E +    +      S    +           + + D+EL+  +  C     L  VH EN  ++   E +LLA GVTGPEGH  SRPE++E EA  R   +A    CP++   V  K +   I     ++  +I+ G  + A L  +   Y + +W  AA +V  P L  + TT      L++ +A+ +++   + +  +D + K+ G+ +F  I  G NGV+ RM ++W+K V SG ++P  +V+  S+T AK+ NIYP KG I++GSDADI+++  ++         H N    D N+FE + CH   +  I  G +V  H G      GSG+ +
Sbjct:    5 LVIKNGTVVNEDGMFKADVLVRNGIIVEVSPNITALPDTEVIDATDRLVIPGGIDPHTHMQMPYMGEVTKDDFLKGTEAAVAGGTTMIIDFCCPDHRNGESLIAGYNRWRSWADPKVCCDYGLSVAITMWRPETAEQMAIITSPEFGVNSFKFYMAYENT------LMVRDDELFRGMQECAKLRALARVHCENGSVIKEKEIDLLAKGVTGPEGHTQSRPEEIEAEATNRACVLAAQANCPVYIVHVMTKGAASAIS--HHRAQGSIVFGEPIAAGLALDGSHYYNEDWLHAARYVMSPPLSRDPTTP---ELLMKLLAAGELHLTGTDNCTYDCRQKSLGKGNFTKIPNGINGVEDRMSVVWEKGVHSGIIDPMRYVSITSSTAAKIFNIYPRKGRIAVGSDADIVIFNPNATRTISKDTHHHNL---DFNIFEGINCHGVAEVTISRGRIVWAH-GKLQTVPGSGKFI 460          
BLAST of Dihydropyrimidinase vs. Ensembl Celegans
Match: dhp-1 (Dihydropyrimidinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21773])

HSP 1 Score: 239.965 bits (611), Expect = 2.192e-71
Identity = 152/471 (32.27%), Postives = 241/471 (51.17%), Query Frame = 2
Query:  161 LLIKCGTVINHDCTYDADVLIENGKIVNIAKNIED-SLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVN--CLEIMKDESLKEKYEMEKDIISKEIVCN----LAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS-------HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV 1528
            L+IK GTV+N D  + ADVL+ NG IV ++ NI      E IDAT   V+PGG+D  T+      G V+ +++  GT+AA+ GGTT +++  C +    ESL   Y   +     ++ C+    +AI +  PE  E +    +      S    +           + + D+EL+  +  C     L  VH EN  ++   E +LLA GVTGPEGH  SRPE++E EA  R   +A    CP++   V  K +   I     ++  +I+ G  + A L  +   Y + +W  AA +V  P L  + TT      L++ +A+ +++   + +  +D + K+ G+ +F  I  G NGV+ RM ++W+K V SG ++P  +V+  S+T AK+ NIYP KG I++GSDADI+++  ++         H N    D N+FE + CH   +  I  G +V  H G      GSG+ +
Sbjct:    5 LVIKNGTVVNEDGMFKADVLVRNGIIVEVSPNITALPDTEVIDATDRLVIPGGIDPHTHMQMPYMGEVTKDDFLKGTEAAVAGGTTMIIDFCCPDHRNGESLIAGYNRWRSWADPKVCCDYGLSVAITMWRPETAEQMAIITSPEFGVNSFKFYMAYENT------LMVRDDELFRGMQECAKLRALARVHCENGSVIKEKEIDLLAKGVTGPEGHTQSRPEEIEAEATNRACVLAAQANCPVYIVHVMTKGAASAIS--HHRAQGSIVFGEPIAAGLALDGSHYYNEDWLHAARYVMSPPLSRDPTTP---ELLMKLLAAGELHLTGTDNCTYDCRQKSLGKGNFTKIPNGINGVEDRMSVVWEKGVHSGIIDPMRYVSITSSTAAKIFNIYPRKGRIAVGSDADIVIFNPNATRTISKDTHHHNL---DFNIFEGINCHGVAEVTISRGRIVWAH-GKLQTVPGSGKFI 460          
BLAST of Dihydropyrimidinase vs. Ensembl Celegans
Match: dhp-1 (Dihydropyrimidinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21773])

HSP 1 Score: 239.965 bits (611), Expect = 2.192e-71
Identity = 152/471 (32.27%), Postives = 241/471 (51.17%), Query Frame = 2
Query:  161 LLIKCGTVINHDCTYDADVLIENGKIVNIAKNIED-SLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVN--CLEIMKDESLKEKYEMEKDIISKEIVCN----LAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS-------HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV 1528
            L+IK GTV+N D  + ADVL+ NG IV ++ NI      E IDAT   V+PGG+D  T+      G V+ +++  GT+AA+ GGTT +++  C +    ESL   Y   +     ++ C+    +AI +  PE  E +    +      S    +           + + D+EL+  +  C     L  VH EN  ++   E +LLA GVTGPEGH  SRPE++E EA  R   +A    CP++   V  K +   I     ++  +I+ G  + A L  +   Y + +W  AA +V  P L  + TT      L++ +A+ +++   + +  +D + K+ G+ +F  I  G NGV+ RM ++W+K V SG ++P  +V+  S+T AK+ NIYP KG I++GSDADI+++  ++         H N    D N+FE + CH   +  I  G +V  H G      GSG+ +
Sbjct:    5 LVIKNGTVVNEDGMFKADVLVRNGIIVEVSPNITALPDTEVIDATDRLVIPGGIDPHTHMQMPYMGEVTKDDFLKGTEAAVAGGTTMIIDFCCPDHRNGESLIAGYNRWRSWADPKVCCDYGLSVAITMWRPETAEQMAIITSPEFGVNSFKFYMAYENT------LMVRDDELFRGMQECAKLRALARVHCENGSVIKEKEIDLLAKGVTGPEGHTQSRPEEIEAEATNRACVLAAQANCPVYIVHVMTKGAASAIS--HHRAQGSIVFGEPIAAGLALDGSHYYNEDWLHAARYVMSPPLSRDPTTP---ELLMKLLAAGELHLTGTDNCTYDCRQKSLGKGNFTKIPNGINGVEDRMSVVWEKGVHSGIIDPMRYVSITSSTAAKIFNIYPRKGRIAVGSDADIVIFNPNATRTISKDTHHHNL---DFNIFEGINCHGVAEVTISRGRIVWAH-GKLQTVPGSGKFI 460          
BLAST of Dihydropyrimidinase vs. Ensembl Celegans
Match: unc-33 (pep chromosome:WBcel235:IV:3518147:3525572:1 gene:WBGene00006769.1 transcript:Y37E11C.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-33)

HSP 1 Score: 176.022 bits (445), Expect = 1.169e-46
Identity = 119/404 (29.46%), Postives = 204/404 (50.50%), Query Frame = 2
Query:  161 LLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKE-IVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW 1366
            LL+K   ++N D  + AD+LIE+G I N+A N+E    AE +DA G   LP G+D  T          S ++  +G K+AI GGT T+V  +     ES+    +  K+ + K  I C++A+ + + +  E    E +EL++++ +   V           V + D++L +     +    L  V  EN  +VA+LEK++L  GVTGPEG   SRPE +E + V  V  +  +  CPI   +V +  SL  I +  R S        +  A+  +       + + A++ +T   L+           ++  ++++ +    S H   +   + + + DF     G+ G + RM ++W++AV+SGR++   FV   ST  AK+ N+YP KG I++G+DAD+++W
Sbjct:  160 LLVKNAQIVNDDAIFVADILIEDGIIQNVAPNLEAPEGAEVLDAAGKLALPAGIDVYTQVTDS-----SVDDLSTGCKSAIAGGTGTIVEVVRPRGAESVVSAVKRVKNQLEKSGISCHVALSVAITDFCE---QEMSELVKNEGINSFV--------LDGVSLTDDKLLELFEHVKRLGALIRVVPENKSIVAMLEKKMLKLGVTGPEGFPQSRPESLEADRVSGVCVLGNLASCPISIVQVSSADSLAAI-EKARASGALAHAEIASAAVTADGSALFSQDLRFASAHLTDVPLRRGAPDR-----MIGALSTQPLVVCTSGHRPVNSATRVAAK-DFAIAQKGSTGAEERMAVVWERAVRSGRIDAMRFVAVTSTNAAKMFNMYPKKGRIAVGADADLVIW 540          
BLAST of Dihydropyrimidinase vs. Ensembl Fly
Match: CRMP (gene:FBgn0023023 transcript:FBtr0114453)

HSP 1 Score: 258.07 bits (658), Expect = 4.439e-77
Identity = 153/474 (32.28%), Postives = 261/474 (55.06%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSL---AECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTT-EFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV 1528
            + +   Q ++ IK G ++NHD ++ ADV IE+G I  +  + E ++      IDA+G  ++PGG+D  T+     GG V+ ++++ GTKAA+ GGTT +++ +   K ES+ E Y+  +     ++ C+  + + +   ++++  E   L +   V    +     KG +  +++D +L D     R  + +  VHAEN  ++A   + LLA+G+ GPEGH LSRPE+VE EAV R   +A    CP++   V +KS+  ++   + +     I G +L A L  +A   +   +   A+ V  P L+ +KTT EF    L++ +A+  +    S +  F+ +HKA G+ DF  I  G NGV+ RM ++W+K V +G ++P  FV   ST  AK+ NIYP KG I++GSDADI++W  ++       ++  A D N+FE +  H   ++V+V G +  +  GN   ++G G+ +
Sbjct:   13 IHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSF-KTFMAYKGLY--QLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEF----LMKLLANDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAE-RGNVRVAEGFGRFI 478          
BLAST of Dihydropyrimidinase vs. Ensembl Fly
Match: CRMP (gene:FBgn0023023 transcript:FBtr0089686)

HSP 1 Score: 248.054 bits (632), Expect = 2.491e-73
Identity = 147/472 (31.14%), Postives = 258/472 (54.66%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSL---AECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV 1528
            + +   Q ++ IK G ++NHD ++ ADV IE+G I  +  + E ++      IDA+G  ++PGG+D  T+     GG V+ ++++ GTKAA+ GGTT +++ +   K ES+ E Y+  +     ++ C+  + + +   ++++  E   L +   V    +     KG +  +++D +L D     R  + +  VHAEN  ++A   + LLA+G+ GPEGH LSRPE+VE EAV R   +A  +K P+    + +KSS + +   +R  S   + G +L + +  +        ++ A  +T P ++ +  T  Q   L++++A   +    S +  F+ +HKA G+ DF  I  G NGV+ RM ++W+K V +G ++P  FV   ST  AK+ NIYP KG I++GSDADI++W  ++       ++  A D N+FE +  H   ++V+V G +  +  GN   ++G G+ +
Sbjct:   13 IHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSF-KTFMAYKGLY--QLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQMKTPLFVSGLTSKSSAELVGRARR--SGYCVFGETLASSLGRSMSAVPKGDRIYA--ITSPPIRESAETPRQ---LMKSLAYDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKGVHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVRGRICAE-RGNVRVAEGFGRFI 473          
BLAST of Dihydropyrimidinase vs. Ensembl Fly
Match: CRMP (gene:FBgn0023023 transcript:FBtr0089685)

HSP 1 Score: 158.688 bits (400), Expect = 4.400e-43
Identity = 98/321 (30.53%), Postives = 171/321 (53.27%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSL---AECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSL-VALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELL 1084
            + +   Q ++ IK G ++NHD ++ ADV IE+G I  +  + E ++      IDA+G  ++PGG+D  T+     GG V+ ++++ GTKAA+ GGTT +++ +   K ES+ E Y+  +     ++ C+  + + +   ++++  E   L +   V    +     KG +  +++D +L D     R  + +  VHAEN  ++A   + LLA+G+ GPEGH LSRPE+VE EAV R   +A    CP++   V +KS+  ++   + +     I G +L  AL  +A   +   +   A+ V  P L+ +KTT     +LL
Sbjct:   13 IHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIGILCKELGVNSF-KTFMAYKGLY--QLNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHRYRGRYIMGETLAAALGTDATCCQHLGFDAEAAHVLSPPLRPDKTTPEFLMKLL 330          
BLAST of Dihydropyrimidinase vs. Ensembl Zebrafish
Match: crmp1 (collapsin response mediator protein 1 [Source:ZFIN;Acc:ZDB-GENE-050720-1])

HSP 1 Score: 309.686 bits (792), Expect = 1.092e-96
Identity = 179/511 (35.03%), Postives = 281/511 (54.99%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNK 1663
            T ++LLIK G V+N D +  ADV +E+G I  + +N I     + I+A GC V+PGG+D  T       G    ++++ GTKAA+ GGTT +++ +     + L E +E  ++   K+  C+ ++ + +P  +E +K E  +L+Q K +    ++    KG +  ++ D +LY+A  + ++   +  VHAEN  ++A  + ++L  G+ GPEGH LSRPE++E EAVFR +TI   V CP++  KV +KS+ + +   ++K S  ++ G  + A L  +   Y   NW  AA++VT P L  + TT      LL   A   +  V S H  +    KA G+++F  I  GTNGV+ RM  +WDKAV  G+M+   FV   ST  AK+ N+YP KG I++GSDADI++W  D +    + S   A + N+FE + C  GP +V+  G VV + EG     +G+G+ +S         F  Q I Y+      + ++R  YDGPV D  A  K
Sbjct:   16 TSERLLIKGGRVVNDDQSLYADVYVEDGIIKQVGENLIVPGGVKVIEANGCMVIPGGIDVNTCLHKPYLGTPPVDDFYQGTKAALAGGTTMIIDHVTPQPGDGLLEAFEKWQEAADKKSCCDYSLHVDIPHWHEGVKEELEQLVQEKGINSF-QVYMAYKGLY--QMPDSQLYEAFSFLKELGAVVLVHAENGDLIAQEQSKILGMGIIGPEGHPLSRPEELEAEAVFRAITIGNRVNCPVYITKVMSKSAAETVAIARKKGS--VVFGEPITASLATDGSHYWSKNWAKAAAYVTSPPLSPDPTTPEHLHSLL---ACGDLQVVGSGHCAYSTSQKAIGKDNFTLIPEGTNGVEERMGFVWDKAVAMGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPDKIKTITAKSQQSALEYNIFEGMDCRGGPLHVVSQGRVVFE-EGKLQVQQGTGRFIS---RKPFPDFAYQRIKYRNKIMNMQGVSRGMYDGPVYDVPATPK 514          
BLAST of Dihydropyrimidinase vs. Ensembl Zebrafish
Match: dpysl3 (dihydropyrimidinase like 3 [Source:NCBI gene;Acc:553166])

HSP 1 Score: 298.516 bits (763), Expect = 1.934e-92
Identity = 187/572 (32.69%), Postives = 301/572 (52.62%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV--SPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID---------PSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            T ++LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+      G  + +++  GTKAA+ GGTT +V+ +      SL E ++       ++  C+ ++ + +   N+++K E   L++ K V    V ++  D      ++ + ELY+   +  ++  +  VHAEN +++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  +V +KS+ D I+   RK  N +       +L  +   Y   NW  AASFVT P L  + TT      LL   AS  ++ V S+H  F +  KA G++DF  I  G NG + RM I+WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+V    + ++  A + NVFE +     P  V+  G +VL+ +GN  A+ G+G+ +  SP  +     F  + +  +    + K + R  YDGPV +         PSA  +     +    ++   +   GP E      P G+R++        PPGG +
Sbjct:   13 TSERLLIKGGRIVNDDQSFYADIYMEDGVIKQIGDNLIVPGGVKTIEANGKMVIPGGIDIHTHLQMPFRGTTTADDFTQGTKAALAGGTTMIVDHVIPEPGCSLLEAFDRWSKWADEKACCDYSLHVDITHWNDSVKQEVETLIKEKGVNSFQVYMAFKD----LYQMSNTELYEVFTFLGEHGGIAQVHAENGEIIAEEQARMLEMGITGPEGHVLSRPEELEAEAVFRAVTIASQTNCPLYVTRVMSKSAAD-IISQARKKGNVVFGEPITASLGTDGTHYWSKNWAKAASFVTSPPLSPDPTTPDYLNTLL---ASGDLSVVGSAHCTFSVAQKAIGKDDFTQIPEGVNGAEERMSIIWDKAVVTGKMDENMFVAVTSTNAAKILNLYPRKGRIAVGSDSDLVIWDTDAVRTITAKTHHSAAEYNVFEGMELRGAPMLVVCQGKIVLE-DGNLHATSGTGRFIPCSPFPD-----FAYKRVKARKQLAILKAVPRGMYDGPVSEFSPMSRGGTPSASTRTSPTKVPVRNLHQSGFTLSGPEE--APIRPAGRRIV-------VPPGGRS 561          
BLAST of Dihydropyrimidinase vs. Ensembl Zebrafish
Match: dpysl5a (dihydropyrimidinase like 5a [Source:ZFIN;Acc:ZDB-GENE-030131-3136])

HSP 1 Score: 291.197 bits (744), Expect = 1.106e-89
Identity = 188/573 (32.81%), Postives = 294/573 (51.31%), Query Frame = 2
Query:  143 SETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICG-TSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS----HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVI------RTSVKTAQPPGGSAQASW 1825
            S    ++LIK G V+N D T +ADV IENG I  + K +     A+ IDATG  VLPGG+D   +         + ++++SGTKAA+ GGTT V+  +   K+ESL + YE  +     +  C+ A+ + +       +++   L++ K V    ++    K  + ++  D EL+ AL  C+D   +  VHAEN ++VA   +E L  G++GPEG  +SRPE++E EAV R +TIA    CPI+   V + S+ D +     K    ++ G T+    V N  +Y   +W  AA+FVT+P L+++  T      LL  + +  +N V S H  F  K KA G++DF  I  G  GVQ RM ++W++ V  G+M+   FV   S+  AK+ N+YP KG I  G+DAD++VW  +S       + ++ GD+N++E++ CH  P   I  G VV ++ G FT ++GSG+     L T   Y  K+++  +    + K + R PY G V       K++       M      + GG  +  + +       I      R S +   PPGG +   W
Sbjct:    4 SSATVRILIKGGKVVNDDFTQEADVYIENGIIQQVGKELMIPGGAKVIDATGKLVLPGGIDTSVHLNESFMNGTTADDFYSGTKAALAGGTTMVIGHVLPEKNESLLDAYEKARSHADAKACCDYALHMGVTWWGPKARAQMETLVRDKGVNSF-QMYMAYKDMYMLR--DSELFQALQNCKDIGAVARVHAENGELVAEGAREALDLGISGPEGIEISRPEELEAEAVHRAITIANRAHCPIYLVNVSSMSAGDVLA--SAKMQGKVVHGETTTAHAVLNGMQYYHQDWAHAAAFVTVPPLRLDPNTP---NYLLSLLGNDTLNVVTSDHRPFTTKQKAMGKDDFTKIPHGVPGVQDRMSVMWERGVVGGKMDENRFVAVTSSNAAKIYNLYPRKGRIIPGADADVVVWDPESTRTISVTTQWQGGDVNLYENLRCHGVPLVTISRGRVVYEN-GIFTCAEGSGKFY--PLRTFPDYLYKKMVQREKCQAL-KGVERTPYTGDVAAVQNSGKKDLGPADGDMNPRPCTRHGGVRDLHESSFSLSGAQIDDNVPKRASARILAPPGGRSSGIW 564          
BLAST of Dihydropyrimidinase vs. Ensembl Zebrafish
Match: dpysl5a (dihydropyrimidinase like 5a [Source:ZFIN;Acc:ZDB-GENE-030131-3136])

HSP 1 Score: 291.197 bits (744), Expect = 1.106e-89
Identity = 188/573 (32.81%), Postives = 294/573 (51.31%), Query Frame = 2
Query:  143 SETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICG-TSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS----HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVI------RTSVKTAQPPGGSAQASW 1825
            S    ++LIK G V+N D T +ADV IENG I  + K +     A+ IDATG  VLPGG+D   +         + ++++SGTKAA+ GGTT V+  +   K+ESL + YE  +     +  C+ A+ + +       +++   L++ K V    ++    K  + ++  D EL+ AL  C+D   +  VHAEN ++VA   +E L  G++GPEG  +SRPE++E EAV R +TIA    CPI+   V + S+ D +     K    ++ G T+    V N  +Y   +W  AA+FVT+P L+++  T      LL  + +  +N V S H  F  K KA G++DF  I  G  GVQ RM ++W++ V  G+M+   FV   S+  AK+ N+YP KG I  G+DAD++VW  +S       + ++ GD+N++E++ CH  P   I  G VV ++ G FT ++GSG+     L T   Y  K+++  +    + K + R PY G V       K++       M      + GG  +  + +       I      R S +   PPGG +   W
Sbjct:    4 SSATVRILIKGGKVVNDDFTQEADVYIENGIIQQVGKELMIPGGAKVIDATGKLVLPGGIDTSVHLNESFMNGTTADDFYSGTKAALAGGTTMVIGHVLPEKNESLLDAYEKARSHADAKACCDYALHMGVTWWGPKARAQMETLVRDKGVNSF-QMYMAYKDMYMLR--DSELFQALQNCKDIGAVARVHAENGELVAEGAREALDLGISGPEGIEISRPEELEAEAVHRAITIANRAHCPIYLVNVSSMSAGDVLA--SAKMQGKVVHGETTTAHAVLNGMQYYHQDWAHAAAFVTVPPLRLDPNTP---NYLLSLLGNDTLNVVTSDHRPFTTKQKAMGKDDFTKIPHGVPGVQDRMSVMWERGVVGGKMDENRFVAVTSSNAAKIYNLYPRKGRIIPGADADVVVWDPESTRTISVTTQWQGGDVNLYENLRCHGVPLVTISRGRVVYEN-GIFTCAEGSGKFY--PLRTFPDYLYKKMVQREKCQAL-KGVERTPYTGDVAAVQNSGKKDLGPADGDMNPRPCTRHGGVRDLHESSFSLSGAQIDDNVPKRASARILAPPGGRSSGIW 564          
BLAST of Dihydropyrimidinase vs. Ensembl Zebrafish
Match: dpysl5a (dihydropyrimidinase like 5a [Source:ZFIN;Acc:ZDB-GENE-030131-3136])

HSP 1 Score: 282.722 bits (722), Expect = 2.336e-86
Identity = 189/585 (32.31%), Postives = 295/585 (50.43%), Query Frame = 2
Query:  143 SETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVA--------IL----EKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS----HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVI------RTSVKTAQPPGGSAQASW 1825
            S    ++LIK G V+N D T +ADV IENG I  + K +     A+ IDATG  VLPGG+D   +         + ++++SGTKAA+ GGTT V+  +   K+ESL + YE  +     +  C+ A+ + +       +++   L++ K V    ++    K  + ++  D EL+ AL  C+D   +  VHAEN ++VA        I      +E L  G++GPEG  +SRPE++E EAV R +TIA    CPI+   V + S+ D +     K    ++ G +  A  V N  +Y   +W  AA+FVT+P L+++  T      LL  + +  +N V S H  F  K KA G++DF  I  G  GVQ RM ++W++ V  G+M+   FV   S+  AK+ N+YP KG I  G+DAD++VW  +S       + ++ GD+N++E++ CH  P   I  G VV ++ G FT ++GSG+     L T   Y  K+++  +    + K + R PY G V       K++       M      + GG  +  + +       I      R S +   PPGG +   W
Sbjct:    4 SSATVRILIKGGKVVNDDFTQEADVYIENGIIQQVGKELMIPGGAKVIDATGKLVLPGGIDTSVHLNESFMNGTTADDFYSGTKAALAGGTTMVIGHVLPEKNESLLDAYEKARSHADAKACCDYALHMGVTWWGPKARAQMETLVRDKGVNSF-QMYMAYKDMYMLR--DSELFQALQNCKDIGAVARVHAENGELVAESSLSHVFIFTHKGAREALDLGISGPEGIEISRPEELEAEAVHRAITIANRAHCPIYLVNVSSMSAGDVLA--SAKMQGKVVHGETTTAHAVLNGMQYYHQDWAHAAAFVTVPPLRLDPNTP---NYLLSLLGNDTLNVVTSDHRPFTTKQKAMGKDDFTKIPHGVPGVQDRMSVMWERGVVGGKMDENRFVAVTSSNAAKIYNLYPRKGRIIPGADADVVVWDPESTRTISVTTQWQGGDVNLYENLRCHGVPLVTISRGRVVYEN-GIFTCAEGSGKFY--PLRTFPDYLYKKMVQREKCQAL-KGVERTPYTGDVAAVQNSGKKDLGPADGDMNPRPCTRHGGVRDLHESSFSLSGAQIDDNVPKRASARILAPPGGRSSGIW 576          
BLAST of Dihydropyrimidinase vs. Ensembl Xenopus
Match: dpysl4 (dihydropyrimidinase like 4 [Source:NCBI gene;Acc:548482])

HSP 1 Score: 300.056 bits (767), Expect = 5.161e-93
Identity = 188/572 (32.87%), Postives = 298/572 (52.10%), Query Frame = 2
Query:  158 KLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVH-NAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW-----KGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHM-------------VNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            +LLIK G ++N D ++ AD+ IE+G I  I +N I     + IDA G  V+PGG+D  T       G+ S +++F GTKAA+ GGTT +++ +      +L + Y+  ++    ++ C+ ++ + +   +E++K E   L++ K V   +          C    D E+Y+     RD   +  VHAEN  ++   +K +L  G+TGPEGH LS PE+VE EA +R +TIA+   CP++  KV ++ + D I   +RK    ++ G +L A +  +   Y   NW  AA++VT P +  + +T    T LL   +   ++   S+H  F    KA G+++F  I  GTNG++ RM I+WDK V SG+M+  +FV   ST  AKL N+YP KG I+ GSDAD+++W     K  S    N    ++N+FE + CH  P+ VI  G +VL+ +GN   S+GSG+ V    +T   Y  K++       E+ + + R  YDGPV D +   K       S +             +++  +   G  ED  + +P      RT+ K   PPGG +
Sbjct:    7 RLLIKGGKIVNDDQSFLADIYIEDGLIKQIGENLIVPGGVKTIDAHGLLVIPGGIDVHTRLQMPVMGMTSADDFFQGTKAALAGGTTMIIDHVFPDSGMNLVQAYDQWREWADGKVCCDYSLHIDITYWHESLKEELEALVKDKGVNSFLVFMAYKDQYQCT---DAEMYEIFSIIRDLGAIAQVHAENGDIIQEEQKRMLECGITGPEGHVLSHPEEVEAEAAYRAITIAKQANCPLYITKVMSRGAADVIAQAKRK--GIVVYGETLTASIGTDGTHYWSKNWAKAAAYVTSPPISPDPSTPDHLTSLL---SCGDLHVTGSAHCTFTTAQKAVGKDNFILIPEGTNGIEERMTIIWDKCVTSGKMDENAFVAVTSTNAAKLFNLYPRKGRIATGSDADLVIWNPKTAKIISAKTHNMNV-ELNIFEGMECHGAPEVVISQGRIVLE-DGNLHVSQGSGRFV--PRKTFPDYVYKRIKARNRLAEI-RGVPRGLYDGPVHDVTITTKSAASTPASRIACPGKIQMGPVRNLHHSGFSLSGSQED--DHVPR-----RTTQKIVAPPGGRS 558          
BLAST of Dihydropyrimidinase vs. Ensembl Xenopus
Match: dpysl4 (dihydropyrimidinase like 4 [Source:NCBI gene;Acc:548482])

HSP 1 Score: 300.442 bits (768), Expect = 5.388e-93
Identity = 188/572 (32.87%), Postives = 298/572 (52.10%), Query Frame = 2
Query:  158 KLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVH-NAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW-----KGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHM-------------VNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            +LLIK G ++N D ++ AD+ IE+G I  I +N I     + IDA G  V+PGG+D  T       G+ S +++F GTKAA+ GGTT +++ +      +L + Y+  ++    ++ C+ ++ + +   +E++K E   L++ K V   +          C    D E+Y+     RD   +  VHAEN  ++   +K +L  G+TGPEGH LS PE+VE EA +R +TIA+   CP++  KV ++ + D I   +RK    ++ G +L A +  +   Y   NW  AA++VT P +  + +T    T LL   +   ++   S+H  F    KA G+++F  I  GTNG++ RM I+WDK V SG+M+  +FV   ST  AKL N+YP KG I+ GSDAD+++W     K  S    N    ++N+FE + CH  P+ VI  G +VL+ +GN   S+GSG+ V    +T   Y  K++       E+ + + R  YDGPV D +   K       S +             +++  +   G  ED  + +P      RT+ K   PPGG +
Sbjct:   13 RLLIKGGKIVNDDQSFLADIYIEDGLIKQIGENLIVPGGVKTIDAHGLLVIPGGIDVHTRLQMPVMGMTSADDFFQGTKAALAGGTTMIIDHVFPDSGMNLVQAYDQWREWADGKVCCDYSLHIDITYWHESLKEELEALVKDKGVNSFLVFMAYKDQYQCT---DAEMYEIFSIIRDLGAIAQVHAENGDIIQEEQKRMLECGITGPEGHVLSHPEEVEAEAAYRAITIAKQANCPLYITKVMSRGAADVIAQAKRK--GIVVYGETLTASIGTDGTHYWSKNWAKAAAYVTSPPISPDPSTPDHLTSLL---SCGDLHVTGSAHCTFTTAQKAVGKDNFILIPEGTNGIEERMTIIWDKCVTSGKMDENAFVAVTSTNAAKLFNLYPRKGRIATGSDADLVIWNPKTAKIISAKTHNMNV-ELNIFEGMECHGAPEVVISQGRIVLE-DGNLHVSQGSGRFV--PRKTFPDYVYKRIKARNRLAEI-RGVPRGLYDGPVHDVTITTKSAASTPASRIACPGKIQMGPVRNLHHSGFSLSGSQED--DHVPR-----RTTQKIVAPPGGRS 564          
BLAST of Dihydropyrimidinase vs. Ensembl Xenopus
Match: dpysl4 (dihydropyrimidinase like 4 [Source:NCBI gene;Acc:548482])

HSP 1 Score: 300.827 bits (769), Expect = 5.719e-93
Identity = 189/575 (32.87%), Postives = 299/575 (52.00%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVH-NAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW-----KGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHM-------------VNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            T  +LLIK G ++N D ++ AD+ IE+G I  I +N I     + IDA G  V+PGG+D  T       G+ S +++F GTKAA+ GGTT +++ +      +L + Y+  ++    ++ C+ ++ + +   +E++K E   L++ K V   +          C    D E+Y+     RD   +  VHAEN  ++   +K +L  G+TGPEGH LS PE+VE EA +R +TIA+   CP++  KV ++ + D I   +RK    ++ G +L A +  +   Y   NW  AA++VT P +  + +T    T LL   +   ++   S+H  F    KA G+++F  I  GTNG++ RM I+WDK V SG+M+  +FV   ST  AKL N+YP KG I+ GSDAD+++W     K  S    N    ++N+FE + CH  P+ VI  G +VL+ +GN   S+GSG+ V    +T   Y  K++       E+ + + R  YDGPV D +   K       S +             +++  +   G  ED  + +P      RT+ K   PPGG +
Sbjct:   30 TYDRLLIKGGKIVNDDQSFLADIYIEDGLIKQIGENLIVPGGVKTIDAHGLLVIPGGIDVHTRLQMPVMGMTSADDFFQGTKAALAGGTTMIIDHVFPDSGMNLVQAYDQWREWADGKVCCDYSLHIDITYWHESLKEELEALVKDKGVNSFLVFMAYKDQYQCT---DAEMYEIFSIIRDLGAIAQVHAENGDIIQEEQKRMLECGITGPEGHVLSHPEEVEAEAAYRAITIAKQANCPLYITKVMSRGAADVIAQAKRK--GIVVYGETLTASIGTDGTHYWSKNWAKAAAYVTSPPISPDPSTPDHLTSLL---SCGDLHVTGSAHCTFTTAQKAVGKDNFILIPEGTNGIEERMTIIWDKCVTSGKMDENAFVAVTSTNAAKLFNLYPRKGRIATGSDADLVIWNPKTAKIISAKTHNMNV-ELNIFEGMECHGAPEVVISQGRIVLE-DGNLHVSQGSGRFV--PRKTFPDYVYKRIKARNRLAEI-RGVPRGLYDGPVHDVTITTKSAASTPASRIACPGKIQMGPVRNLHHSGFSLSGSQED--DHVPR-----RTTQKIVAPPGGRS 584          
BLAST of Dihydropyrimidinase vs. Ensembl Xenopus
Match: dpysl4 (dihydropyrimidinase like 4 [Source:NCBI gene;Acc:548482])

HSP 1 Score: 296.975 bits (759), Expect = 1.141e-91
Identity = 188/572 (32.87%), Postives = 298/572 (52.10%), Query Frame = 2
Query:  158 KLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVH-NAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW-----KGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHM-------------VNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            +LLIK G ++N D ++ AD+ IE+G I  I +N I     + IDA G  V+PGG+D  T       G+ S +++F GTKAA+ GGTT +++ +      +L + Y+  ++    ++ C+ ++ + +   +E++K E   L++ K V   +          C    D E+Y+     RD   +  VHAEN  ++   +K +L  G+TGPEGH LS PE+VE EA +R +TIA+   CP++  KV ++ + D I   +RK    ++ G +L A +  +   Y   NW  AA++VT P +  + +T    T LL   +   ++   S+H  F    KA G+++F  I  GTNG++ RM I+WDK V SG+M+  +FV   ST  AKL N+YP KG I+ GSDAD+++W     K  S    N    ++N+FE + CH  P+ VI  G +VL+ +GN   S+GSG+ V    +T   Y  K++       E+ + + R  YDGPV D +   K       S +             +++  +   G  ED  + +P      RT+ K   PPGG +
Sbjct:   14 RLLIKGGKIVNDDQSFLADIYIEDGLIKQIGENLIVPGGVKTIDAHGLLVIPGGIDVHTRLQMPVMGMTSADDFFQGTKAALAGGTTMIIDHVFPDSGMNLVQAYDQWREWADGKVCCDYSLHIDITYWHESLKEELEALVKDKGVNSFLVFMAYKDQYQCT---DAEMYEIFSIIRDLGAIAQVHAENGDIIQ-EQKRMLECGITGPEGHVLSHPEEVEAEAAYRAITIAKQANCPLYITKVMSRGAADVIAQAKRK--GIVVYGETLTASIGTDGTHYWSKNWAKAAAYVTSPPISPDPSTPDHLTSLL---SCGDLHVTGSAHCTFTTAQKAVGKDNFILIPEGTNGIEERMTIIWDKCVTSGKMDENAFVAVTSTNAAKLFNLYPRKGRIATGSDADLVIWNPKTAKIISAKTHNMNV-ELNIFEGMECHGAPEVVISQGRIVLE-DGNLHVSQGSGRFV--PRKTFPDYVYKRIKARNRLAEI-RGVPRGLYDGPVHDVTITTKSAASTPASRIACPGKIQMGPVRNLHHSGFSLSGSQED--DHVPR-----RTTQKIVAPPGGRS 564          
BLAST of Dihydropyrimidinase vs. Ensembl Xenopus
Match: rfc1 (replication factor C subunit 1 [Source:Xenbase;Acc:XB-GENE-964734])

HSP 1 Score: 296.975 bits (759), Expect = 1.241e-91
Identity = 177/519 (34.10%), Postives = 283/519 (54.53%), Query Frame = 2
Query:  128 KVLFMSETQK------KLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            +V F SE  K      +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+      G+ + +++F GTKAA+ GGTT +V+ +    + SL E +E  ++    +  C+ ++ + +   N+++K E   L++ K V   +V ++  D      ++ + ELY+   +      +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  KV +KSS+D I   Q +    ++ G  + A L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNG++ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+V    + S+  A + N+FE +     P  VI  G ++++ +G    ++G+G+ +  S      Y  K++       E+   + R  YDGPV D
Sbjct:    1 QVYFESEGNKHLPSSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHLQMPYRGMTTVDDFFQGTKAALAGGTTMIVDHVIPEPEASLTEAFEKWREWADGKTCCDYSLHVDITHWNDSVKQEVEALVKQKGVNSFMVYMAYKD----LYQMSNTELYEVFTFLGGLGAIAQVHAENGDIIAQEQNRMLELGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSSVDLIS--QARKKGYVVFGEPITASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQVTGSAHATFSTAQKAIGKDNFTLIPEGTNGIEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDAVKIVSAKSHHSAAEYNIFEGMELRGAPLVVICQGKIMME-DGTLHVTQGTGRFIPCS--PFPDYVYKRIKARTKMAELH-AVPRGMYDGPVYD 506          
BLAST of Dihydropyrimidinase vs. Ensembl Mouse
Match: Dpysl3 (dihydropyrimidinase-like 3 [Source:MGI Symbol;Acc:MGI:1349762])

HSP 1 Score: 298.13 bits (762), Expect = 3.005e-92
Identity = 174/505 (34.46%), Postives = 279/505 (55.25%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDS---VSHSNFEA-GDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            T  +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G+ + +++F GTKAA+ GGTT +++ +    + SL E YE  ++    +  C+ A+ + +   N+++K E   L + K V   +V ++  D      ++ + ELY+      +   +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +T+A    CP++  KV +KS+ D ++   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+   VS  N ++  + N+FE +     P  VI  G ++L+ +GN   ++G+G+ +  S    + Y  K++   +   ++   + R  YDGPV D
Sbjct:   13 TSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNSFMVYMAYKD----LYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQARMLEMGITGPEGHVLSRPEELEAEAVFRAITVASQTNCPLYVTKVMSKSAAD-LISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLE-DGNLHVTQGAGRFIPCS--PFSDYVYKRIKARRKMADLH-AVPRGMYDGPVFD 505          
BLAST of Dihydropyrimidinase vs. Ensembl Mouse
Match: Dpysl3 (dihydropyrimidinase-like 3 [Source:MGI Symbol;Acc:MGI:1349762])

HSP 1 Score: 296.975 bits (759), Expect = 8.196e-92
Identity = 173/502 (34.46%), Postives = 278/502 (55.38%), Query Frame = 2
Query:  158 KLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDS---VSHSNFEA-GDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G+ + +++F GTKAA+ GGTT +++ +    + SL E YE  ++    +  C+ A+ + +   N+++K E   L + K V   +V ++  D      ++ + ELY+      +   +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +T+A    CP++  KV +KS+ D ++   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+   VS  N ++  + N+FE +     P  VI  G ++L+ +GN   ++G+G+ +  S    + Y  K++   +   ++   + R  YDGPV D
Sbjct:   14 RLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNSFMVYMAYKD----LYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQARMLEMGITGPEGHVLSRPEELEAEAVFRAITVASQTNCPLYVTKVMSKSAAD-LISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLE-DGNLHVTQGAGRFIPCS--PFSDYVYKRIKARRKMADLH-AVPRGMYDGPVFD 503          
BLAST of Dihydropyrimidinase vs. Ensembl Mouse
Match: Crmp1 (collapsin response mediator protein 1 [Source:MGI Symbol;Acc:MGI:107793])

HSP 1 Score: 295.434 bits (755), Expect = 3.230e-91
Identity = 190/584 (32.53%), Postives = 295/584 (50.51%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLS--HEVEKKIAREPYDGPVID-----------PSADNKEEKH----VLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSAQASWWG 1831
            T  +LLI+ G +IN D ++ ADV +E+G I  I +N I     + I+A G  V+PGG+D  T       G+ S +++F GTKAA+ GGTT +++ +      SL   +E   +    +  C+ ++ + +    + ++ E   L+Q K V    V ++  D      ++ D +LY+A  + +    +  VHAEN  ++A  +K +L  G+TGPEGH LSRPE++E EAVFR + IA  + CP++  KV +KS+ D I+   RK    +       +L  +   Y   NW  AA+FVT P L  + TT    T LL   A   +    S H  +    KA G+++F  I  G NG++ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSDAD+++W  D +    + S+    + N+FE + CH  P  VI  G +V + +GN + SKG G+ + P        +Q+  I  K+   H V + +    YDGPV +           PSA +   KH    +   H  N   +   G   D       G R++        PPGG +  +  G
Sbjct:   13 TSDRLLIRGGRIINDDQSFYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKD----LYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAIAIAGRINCPVYITKVMSKSAAD-IIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLL---ACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKMKTITAKSHKSTVEYNIFEGMECHGSPLVVISQGKIVFE-DGNISVSKGMGRFI-PRKPFPEHLYQRVRIRSKVFGLHSVSRGM----YDGPVYEVPATPKHAAPAPSAKSSPSKHQPPPIRNLHQSN---FSLSGAQIDDNNPRRTGHRIV-------APPGGRSNITSLG 572          
BLAST of Dihydropyrimidinase vs. Ensembl Mouse
Match: Dpysl3 (dihydropyrimidinase-like 3 [Source:MGI Symbol;Acc:MGI:1349762])

HSP 1 Score: 297.745 bits (761), Expect = 6.030e-91
Identity = 175/516 (33.91%), Postives = 284/516 (55.04%), Query Frame = 2
Query:  116 KLLIKVLFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDS---VSHSNFEA-GDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            K +++ L   +   +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G+ + +++F GTKAA+ GGTT +++ +    + SL E YE  ++    +  C+ A+ + +   N+++K E   L + K V   +V ++  D      ++ + ELY+      +   +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +T+A    CP++  KV +KS+ D ++   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+   VS  N ++  + N+FE +     P  VI  G ++L+ +GN   ++G+G+ +  S    + Y  K++   +   ++   + R  YDGPV D
Sbjct:  115 KEVLQNLGPKDKSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNSFMVYMAYKD----LYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQARMLEMGITGPEGHVLSRPEELEAEAVFRAITVASQTNCPLYVTKVMSKSAAD-LISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLE-DGNLHVTQGAGRFIPCS--PFSDYVYKRIKARRKMADLH-AVPRGMYDGPVFD 618          
BLAST of Dihydropyrimidinase vs. Ensembl Mouse
Match: Dpysl5 (dihydropyrimidinase-like 5 [Source:MGI Symbol;Acc:MGI:1929772])

HSP 1 Score: 291.967 bits (746), Expect = 4.819e-90
Identity = 183/575 (31.83%), Postives = 293/575 (50.96%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVI------RTSVKTAQPPGGSAQASW 1825
            +  +    ++LIK G V+N DCT++ADV IE+G I  + + +     A+ IDATG  V+PGG+D  T+F          ++++ GTKAA+ GGTT ++  +   K+ SL E YE  + +   ++ C+ A+ + +      +K+E   L++ K V       T         + D ELY     CRD   +P VHAEN ++VA   KE L  G+TGPEG  +S PE++E EA  RV+TIA    CPI+   V + S+ D ++   +     ++  T+          Y   +W  AA++VT+P L+++  T    T L+  +A+  +N VAS H  F  K KA G+ DF  I  G +GVQ RM ++W++ V  G+M+   FV   S+  AK+ N+YP KG I  G+DAD++VW  ++     + +  + GD N++E++ CH  P   I  G VV ++ G F  ++G+G+     L +      K+L+  + + +V + + R PY G V       K+E     +      V + GG  +  + +       I      R S +   PPGG +   W
Sbjct:    1 MLANSASVRILIKGGKVVNDDCTHEADVYIESGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVEAYEKCRALADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKD---LYMLRDSELYQVFHACRDIGAIPRVHAENGELVAEGAKEALDLGITGPEGIEISHPEELEAEATHRVITIANRTHCPIYLVNVSSISAGD-VIAAAKMQGKVVLAETTNAHATLTGLHYYHQDWSHAAAYVTVPPLRLDTNTS---TYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVVWERGVVGGKMDENRFVAVTSSNAAKILNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISRGRVVYEN-GVFMCAEGTGKFC--PLRSFPDIVYKKLVQREKTLKV-RGVDRTPYLGDVAIVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW 564          
BLAST of Dihydropyrimidinase vs. UniProt/SwissProt
Match: sp|Q14195|DPYL3_HUMAN (Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 3.751e-93
Identity = 175/505 (34.65%), Postives = 280/505 (55.45%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            T  +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G+ + +++F GTKAA+ GGTT +++ +    + SL E YE  ++    +  C+ A+ + +   N+++K E   L++ K V   +V ++  D      ++ + ELY+      +   +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  KV +KS+ D ++   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG IS+GSD+D+++W  D+V    + ++  A + N+FE +     P  VI  G ++L+ +GN   ++G+G+ +  S    + Y  K++   +   ++   + R  YDGPV D
Sbjct:   13 TSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKD----LYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAAD-LISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLE-DGNLHVTQGAGRFIPCS--PFSDYVYKRIKARRKMADLH-AVPRGMYDGPVFD 505          
BLAST of Dihydropyrimidinase vs. UniProt/SwissProt
Match: sp|Q52PJ5|DPYL3_DANRE (Dihydropyrimidinase-related protein 3 OS=Danio rerio OX=7955 GN=dpysl3 PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.460e-91
Identity = 187/572 (32.69%), Postives = 301/572 (52.62%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV--SPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID---------PSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            T ++LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+      G  + +++  GTKAA+ GGTT +V+ +      SL E ++       ++  C+ ++ + +   N+++K E   L++ K V    V ++  D      ++ + ELY+   +  ++  +  VHAEN +++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  +V +KS+ D I+   RK  N +       +L  +   Y   NW  AASFVT P L  + TT      LL   AS  ++ V S+H  F +  KA G++DF  I  G NG + RM I+WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+V    + ++  A + NVFE +     P  V+  G +VL+ +GN  A+ G+G+ +  SP  +     F  + +  +    + K + R  YDGPV +         PSA  +     +    ++   +   GP E      P G+R++        PPGG +
Sbjct:   13 TSERLLIKGGRIVNDDQSFYADIYMEDGVIKQIGDNLIVPGGVKTIEANGKMVIPGGIDIHTHLQMPFRGTTTADDFTQGTKAALAGGTTMIVDHVIPEPGCSLLEAFDRWSKWADEKACCDYSLHVDITHWNDSVKQEVETLIKEKGVNSFQVYMAFKD----LYQMSNTELYEVFTFLGEHGGIAQVHAENGEIIAEEQARMLEMGITGPEGHVLSRPEELEAEAVFRAVTIASQTNCPLYVTRVMSKSAAD-IISQARKKGNVVFGEPITASLGTDGTHYWSKNWAKAASFVTSPPLSPDPTTPDYLNTLL---ASGDLSVVGSAHCTFSVAQKAIGKDDFTQIPEGVNGAEERMSIIWDKAVVTGKMDENMFVAVTSTNAAKILNLYPRKGRIAVGSDSDLVIWDTDAVRTITAKTHHSAAEYNVFEGMELRGAPMLVVCQGKIVLE-DGNLHATSGTGRFIPCSPFPD-----FAYKRVKARKQLAILKAVPRGMYDGPVSEFSPMSRGGTPSASTRTSPTKVPVRNLHQSGFTLSGPEE--APIRPAGRRIV-------VPPGGRS 561          
BLAST of Dihydropyrimidinase vs. UniProt/SwissProt
Match: sp|Q62952|DPYL3_RAT (Dihydropyrimidinase-related protein 3 OS=Rattus norvegicus OX=10116 GN=Dpysl3 PE=1 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 1.852e-91
Identity = 174/505 (34.46%), Postives = 279/505 (55.25%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDS---VSHSNFEA-GDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            T  +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G+ + +++F GTKAA+ GGTT +++ +    + SL E YE  ++    +  C+ A+ + +   N+++K E   L + K V   +V ++  D      ++ + ELY+      +   +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +T+A    CP++  KV +KS+ D ++   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+   VS  N ++  + N+FE +     P  VI  G ++L+ +GN   ++G+G+ +  S    + Y  K++   +   ++   + R  YDGPV D
Sbjct:   13 TSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVMPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLSKEKGVNSFMVYMAYKD----LYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQARMLEMGITGPEGHVLSRPEELEAEAVFRAITVASQTNCPLYVTKVMSKSAAD-LISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDAVKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLE-DGNLHVTQGAGRFIPCS--PFSDYVYKRIKARRKMADLH-AVPRGMYDGPVFD 505          
BLAST of Dihydropyrimidinase vs. UniProt/SwissProt
Match: sp|Q62188|DPYL3_MOUSE (Dihydropyrimidinase-related protein 3 OS=Mus musculus OX=10090 GN=Dpysl3 PE=1 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 2.102e-91
Identity = 174/505 (34.46%), Postives = 279/505 (55.25%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDS---VSHSNFEA-GDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            T  +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G+ + +++F GTKAA+ GGTT +++ +    + SL E YE  ++    +  C+ A+ + +   N+++K E   L + K V   +V ++  D      ++ + ELY+      +   +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +T+A    CP++  KV +KS+ D ++   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+   VS  N ++  + N+FE +     P  VI  G ++L+ +GN   ++G+G+ +  S    + Y  K++   +   ++   + R  YDGPV D
Sbjct:   13 TSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQSLSKEKGVNSFMVYMAYKD----LYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQARMLEMGITGPEGHVLSRPEELEAEAVFRAITVASQTNCPLYVTKVMSKSAAD-LISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDALKIVSAKNHQSVAEYNIFEGMELRGAPLVVICQGKIMLE-DGNLHVTQGAGRFIPCS--PFSDYVYKRIKARRKMADLH-AVPRGMYDGPVFD 505          
BLAST of Dihydropyrimidinase vs. UniProt/SwissProt
Match: sp|Q6GL72|DPYL3_XENTR (Dihydropyrimidinase-related protein 3 OS=Xenopus tropicalis OX=8364 GN=dpysl3 PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 7.743e-91
Identity = 173/506 (34.19%), Postives = 278/506 (54.94%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            T  +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+      G+ + +++F GTKAA+ GGTT +V+ +    + SL E +E  ++    +  C+ ++ + +   N+++K E   L++ K V   +V ++  D      ++ + ELY+   +      +  VHAEN  ++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  KV +KSS+D I   Q +    ++ G  + A L  +   Y   NW  AA+FVT P L  + TT      LL   AS  +    S+H  F    KA G+++F  I  GTNG++ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSD+D+++W  D+V    + S+  A + N+FE +     P  VI  G ++++ +G    ++G+G+ +  S      Y  K++       E+   + R  YDGPV D
Sbjct:   13 TSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHLQMPYRGMTTVDDFFQGTKAALAGGTTMIVDHVIPEPEASLTEAFEKWREWADGKTCCDYSLHVDITHWNDSVKQEVEALVKQKGVNSFMVYMAYKD----LYQMSNTELYEVFTFLGGLGAIAQVHAENGDIIAQEQNRMLELGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSSVDLIS--QARKKGYVVFGEPITASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLL---ASGDLQVTGSAHATFSTAQKAIGKDNFTLIPEGTNGIEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDAVKIVSAKSHHSAAEYNIFEGMELRGAPLVVICQGKIMME-DGTLHVTQGTGRFIPCS--PFPDYVYKRIKARTKMAELH-AVPRGMYDGPVYD 505          
BLAST of Dihydropyrimidinase vs. TrEMBL
Match: Q5DF26 (SJCHGC09277 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 2.328e-101
Identity = 207/585 (35.38%), Postives = 310/585 (52.99%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS----HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPV----IDPSAD---NKEEKHVLYSH---MVNNDVYKRGGP-AEDKKEALPPGQ----RVIRTSVKTAQPPGGSAQASW 1825
            + +  +Q +LLIK G V+N D  + AD+ IE+G I  +   +        IDA+G  V+PGG+D  T F +   G+ + ++++SGTKAA+ GGTTT++NC+ +    SL + Y+  +     +  C+ A    LP+ +  +  E   L++ K V    V LS  +     + IDD + ++    CRD   +  VHAEN K+V ILE ++  DG+TGPEG   S PE  E EA  R L++AE   CP++  +V +  +  +I    R   N ++  T   AL  +   Y+   W+ AA +V  P L+ N  T     EL+  V++  +   AS H  F    KA G++DFR I PG NGV+ RM I+W+K V SG M+P  FV   ST  AK+ ++YPHKG I +GSDAD+++W GD        SN E  D N+FE + CH  P  VI  G VVL+ +G    ++G+G+ V  S  + + Y  ++     L   V K + R+PY GPV    I P+A    N  EK  + S    +      + GG   ++   +L   Q    R +RT ++T QPPGG++ A W
Sbjct:    1 MHLQSSQNRLLIKGGKVVNDDRMFTADIYIEDGVIRQVGNQLSIPGGVRIIDASGKMVIPGGIDPHTCFESSCFGLNTSDDFYSGTKAALAGGTTTIINCI-MPTQSSLLDMYDKCRQAADAKACCDYAFHFVLPQYDPKVSKEMELLVKEKGVNSFRVFLSNTNN----MLIDDGDFFEVAKRCRDLGAILQVHAENGKLVKILESKIYNDGITGPEGCLYSHPEMAEVEATHRALSLAESAVCPLYILQVTSTKAAHQISK-ARWRGNAVVGETLAAALGADGTHYKHNCWRHAAGYVLSPPLRANPCTP---EELMRYVSTGVLECTASGHCTFKADQKALGKDDFRKIPPGVNGVEDRMSIVWEKGVMSGFMDPCKFVAVTSTNAAKVFSLYPHKGRIDVGSDADLVIWDGDMTRTISVKSNHENVDFNIFEGLHCHGVPLVVITAGRVVLE-DGELRVTQGAGRFVPAS--SFSPYIFERTKRLALMRSV-KPVVRDPYSGPVSAEFIVPTAGIVTNGTEKVPVGSDGDGLRPRSPTRSGGRNMQESSFSLSGAQYDDSRPLRTGIRTKQPPGGASNALW 572          
BLAST of Dihydropyrimidinase vs. TrEMBL
Match: A0A4Z2DJ15 (Dihydropyrimidinase-related protein isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_000398 PE=4 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 3.470e-101
Identity = 207/585 (35.38%), Postives = 310/585 (52.99%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS----HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPV----IDPSAD---NKEEKHVLYSH---MVNNDVYKRGGP-AEDKKEALPPGQ----RVIRTSVKTAQPPGGSAQASW 1825
            + +  +Q +LLIK G V+N D  + AD+ IE+G I  +   +        IDA+G  V+PGG+D  T F +   G+ + ++++SGTKAA+ GGTTT++NC+ +    SL + Y+  +     +  C+ A    LP+ +  +  E   L++ K V    V LS  +     + IDD + ++    CRD   +  VHAEN K+V ILE ++  DG+TGPEG   S PE  E EA  R L++AE   CP++  +V +  +  +I    R   N ++  T   AL  +   Y+   W+ AA +V  P L+ N  T     EL+  V++  +   AS H  F    KA G++DFR I PG NGV+ RM I+W+K V SG M+P  FV   ST  AK+ ++YPHKG I +GSDAD+++W GD        SN E  D N+FE + CH  P  VI  G VVL+ +G    ++G+G+ V  S  + + Y  ++     L   V K + R+PY GPV    I P+A    N  EK  + S    +      + GG   ++   +L   Q    R +RT ++T QPPGG++ A W
Sbjct:   15 MHLQSSQNRLLIKGGKVVNDDRMFTADIYIEDGVIRQVGNQLSIPGGVRIIDASGKMVIPGGIDPHTCFESSCFGLNTSDDFYSGTKAALAGGTTTIINCI-MPTQSSLLDMYDKCRQAADAKACCDYAFHFVLPQYDPKVSKEMELLVKEKGVNSFRVFLSNTNN----MLIDDGDFFEVAKRCRDLGAILQVHAENGKLVKILESKIYNDGITGPEGCLYSHPEMAEVEATHRALSLAESAVCPLYILQVTSTKAAHQISK-ARWRGNAVVGETLAAALGADGTHYKHNCWRHAAGYVLSPPLRANPCTP---EELMRYVSTGVLECTASGHCTFKADQKALGKDDFRKIPPGVNGVEDRMSIVWEKGVMSGFMDPCKFVAVTSTNAAKVFSLYPHKGRIDVGSDADLVIWDGDMTRTISVKSNHENVDFNIFEGLHCHGVPLVVITAGRVVLE-DGELRVTQGAGRFVPAS--SFSPYIFERTKRLALMRSV-KPVVRDPYSGPVSAEFIVPTAGIVTNGTEKVPVGSDGDGLRPRSPTRSGGRNMQESSFSLSGAQYDDSRPLRTGIRTKQPPGGASNALW 586          
BLAST of Dihydropyrimidinase vs. TrEMBL
Match: C1L524 (Dihydropyrimidinase-like 2 OS=Schistosoma japonicum OX=6182 GN=DPYSL2 PE=2 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 3.470e-101
Identity = 207/585 (35.38%), Postives = 310/585 (52.99%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS----HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPV----IDPSAD---NKEEKHVLYSH---MVNNDVYKRGGP-AEDKKEALPPGQ----RVIRTSVKTAQPPGGSAQASW 1825
            + +  +Q +LLIK G V+N D  + AD+ IE+G I  +   +        IDA+G  V+PGG+D  T F +   G+ + ++++SGTKAA+ GGTTT++NC+ +    SL + Y+  +     +  C+ A    LP+ +  +  E   L++ K V    V LS  +     + IDD + ++    CRD   +  VHAEN K+V ILE ++  DG+TGPEG   S PE  E EA  R L++AE   CP++  +V +  +  +I    R   N ++  T   AL  +   Y+   W+ AA +V  P L+ N  T     EL+  V++  +   AS H  F    KA G++DFR I PG NGV+ RM I+W+K V SG M+P  FV   ST  AK+ ++YPHKG I +GSDAD+++W GD        SN E  D N+FE + CH  P  VI  G VVL+ +G    ++G+G+ V  S  + + Y  ++     L   V K + R+PY GPV    I P+A    N  EK  + S    +      + GG   ++   +L   Q    R +RT ++T QPPGG++ A W
Sbjct:   15 MHLQSSQNRLLIKGGKVVNDDRMFTADIYIEDGVIRQVGNQLSIPGGVRIIDASGKMVIPGGIDPHTCFESSCFGLNTSDDFYSGTKAALAGGTTTIINCI-MPTQSSLLDMYDKCRQAADAKACCDYAFHFVLPQYDPKVSKEMELLVKEKGVNSFRVFLSNTNN----MLIDDGDFFEVAKRCRDLGAILQVHAENGKLVKILESKIYNDGITGPEGCLYSHPEMAEVEATHRALSLAESAVCPLYILQVTSTKAAHQISK-ARWRGNAVVGETLAAALGADGTHYKHNCWRHAAGYVLSPPLRANPCTP---EELMRYVSTGVLECTASGHCTFKADQKALGKDDFRKIPPGVNGVEDRMSIVWEKGVMSGFMDPCKFVAVTSTNAAKVFSLYPHKGRIDVGSDADLVIWDGDMTRTISVKSNHENVDFNIFEGLHCHGVPLVVITAGRVVLE-DGELRVTQGAGRFVPAS--SFSPYIFERTKRLALMRSV-KPVVRDPYSGPVSAEFIVPTAGIVTNGTEKVPVGSDGDGLRPRSPTRSGGRNMQESSFSLSGAQYDDSRPLRTGIRTKQPPGGASNALW 586          
BLAST of Dihydropyrimidinase vs. TrEMBL
Match: A0A183QW39 (Amidohydro-rel domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 2.378e-97
Identity = 196/594 (33.00%), Postives = 313/594 (52.69%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMD--WQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKR--GGPAEDKKEALPP--------------------GQRVIRTSVKTAQPPGGSAQASW 1825
            + +  +Q +LLIK G V+N D  + AD+ IE+G I  +   +        I+A+G  V+PGGVD  T   +   G+ + ++++SGT+AA+ GGTTT++NC+   K  SL + YE  +     +  C+ ++   L + +  I  E   L++ K V    V LS  +     + +DD + ++    C+D   +  VHAEN K+V ILE ++  DG+TGPEG+  S PE  E EA  R +++A+   CP++  +V +  + D+I +  W R   N ++  T   AL  +   Y++  W+ +A +V  P L++N  T     +L+  V++  +   AS H  F  + KA G++DFR I PG NGV+ RM ++W++ V SG ++P  FV   ST  AK+ N+YPHKG I +GSDAD+++W GD+     + +N E  D N+FE + CH  P  VI  G VVL+ +G    ++G+G+ V P+L   + Y  ++     L   + K + R+ Y GP+      + E    +   +VNN   K   G  AE  +   P                       R IRT ++T QPPGG++ A W
Sbjct:   15 MHLQSSQNRLLIKGGKVVNDDRMFTADIYIEDGVIRQVGSQLSIPGGVRIIEASGKMVIPGGVDPHTCLDSSCFGLDTSDDFYSGTRAALAGGTTTIINCIVPTK-SSLLDMYEKSRQAADSKACCDYSMHFILSQYDSKISKEMELLVKEKGVNSFRVFLSNTND----MLVDDGDFFEIAKRCKDLGAVLQVHAENGKLVKILESKIYNDGITGPEGYLYSHPEMAEIEATHRAISLADAAGCPLYILQVTSPKAADQISEARWNR---NVVVGETLAAALGADGTHYKNSCWRHSAGYVLSPPLRINPNTP---DKLMRYVSTGVLECTASGHCTFKTEQKAVGKDDFRKIPPGVNGVEDRMSVVWERGVMSGFIDPCKFVAVTSTNAAKVFNLYPHKGRIDVGSDADLVIWDGDATRTISAKNNHENVDFNIFEGLQCHGVPVVVISAGRVVLE-DGELRVTQGAGRFV-PALP-FSPYIFERTKRLALMRSI-KPVIRDSYTGPI------STEFTGPMKDGIVNNGTEKASVGSDAEGLRPRSPTRSGGRNMQESSFSLSGAQYDDSRPIRTGIRTKQPPGGASNALW 587          
BLAST of Dihydropyrimidinase vs. TrEMBL
Match: H2STX2 (Collapsin response mediator protein 1 OS=Takifugu rubripes OX=31033 GN=LOC101061532 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 3.010e-97
Identity = 198/576 (34.38%), Postives = 305/576 (52.95%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID-----------PSADNKEEKH-------------VLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSV 1783
            T +K+LIK G V+N D ++ ADV IE+G I  + +++      + I+A G  V+PGG+D  T       G    +++  GTKAAI GGTT +++ +     ESL E +E  ++   K+  C+ ++ + +P+ NEA+K E   L+  K +    V ++  D      ++ D ELY+A  + +    +  VHAEN  ++A  +K++L  G+TGPEGH LSRPE++E EAVFR +T+   V CP++  KV +KS+ D I   +RK S  ++ G  + A L  +   Y   NW  AA++VT P L  + TT      LL   A   +  V S+H  ++   KA G++DF  I  GTNGV+ RM  +WDKAV  G+M+   FV   ST  AK+ N+YP KG I++GSDAD+++W  DSV    + +   A D N+FE + C  GP  V+  G VV + EGN    +G+G+ + P  +  +  +Q+  +  +    V + + R  YDGPV D           PSA      H              L    +++++ +R G     +   PPG R   TS+
Sbjct:   16 TSEKVLIKGGRVVNDDQSFYADVYIEDGLIKQVGEDLALPGDVKVIEANGRMVMPGGIDVNTCLMKPYLGTRPVDDFCQGTKAAITGGTTMIIDHVTPQPGESLLEAFECWQEAADKKACCDYSLHVDIPQWNEAVKDELELLVHEKGINSFQVYMAYKD----VYQLSDSELYEAFSFLKQLGAVVLVHAENGDLIAQEQKKILGMGITGPEGHPLSRPEELEAEAVFRAITLGSRVNCPVYITKVMSKSAADTITQARRKGS--VVFGEPITASLATDGSHYFSKNWAKAAAYVTSPPLSPDPTTPDHLHTLL---ACGDLQVVGSAHCAYNTSQKAIGKDDFTLIPEGTNGVEERMGFVWDKAVAMGKMDENQFVAVTSTNAAKIFNLYPRKGRIAMGSDADVVIWDPDSVKTITARTQQSASDYNIFEGLECRGGPALVLSQGRVVYE-EGNLQVQQGTGRFI-PRKQFPDYAYQR--VKCRNQVRVNQGVMRGMYDGPVYDMVPTPKYITPAPSAKTSPTSHQPPPIRNLHQSNFSLSGAQIDDNIPRRSG----HRIVAPPGGRSNITSL 574          
BLAST of Dihydropyrimidinase vs. Ensembl Cavefish
Match: dpysl5a (dihydropyrimidinase like 5 [Source:NCBI gene;Acc:103037842])

HSP 1 Score: 293.893 bits (751), Expect = 9.302e-91
Identity = 188/567 (33.16%), Postives = 293/567 (51.68%), Query Frame = 2
Query:  158 KLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS----HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVI------RTSVKTAQPPGGSAQASW 1825
            ++LIK G V+N D T +ADV IENG I  + K +     A+ IDATG  VLPGG+D   +         + ++++SGTKAA+ GGTT V+  +   K+ESL + YE  +     +  C+ A+ + +      ++++   L++ K V    ++    K  + ++  D EL+ AL  C+D   +  VHAEN ++VA   KE L  G++GPEG  +SRPE++E EAV R +TIA    CPI+   V + S+ D ++   +     +   TS    V N  +Y   +W  AA++VT+P L+++  T      LL  + +  +N V S H  F  K KA G++DF  I  G  GVQ RM I+W+K V  G+M+   FV   S+  AK+ N+YP KG I  G+DAD++VW  D+       + ++ GD+N++E + CH  P   I  G VV ++ G FT ++GSG+     L T   Y  K+++  +    + K + R PY G V       K+E       +      + GG  +  + +       I      R+S +   PPGG +   W
Sbjct:    9 RILIKGGKVVNDDYTQEADVYIENGIIQQVGKELMIPGGAKVIDATGKLVLPGGIDTSVHLQETFMNATTADDFYSGTKAALAGGTTMVIGHVLPEKNESLLDAYEKCRSHADAKSCCDYALHVAVTWWGPKVRAQMETLVREKGVNSF-QMFMAYKDVYMLR--DSELFQALQNCKDIGAIARVHAENGELVAEGAKEALDLGISGPEGIEISRPEELEAEAVHRAITIANRAHCPIYLVNVSSMSAGD-VLATAKMQGKVVHGETSTAHAVINGLQYYHQDWAHAAAYVTVPPLRLDPNTP---NFLLSLLGNDSLNVVTSDHRPFTTKQKAMGKDDFTKIPHGVPGVQDRMSIIWEKGVVGGKMDENRFVAVTSSNAAKIYNLYPRKGRIIPGADADVVVWDPDATRTISVTTQWQGGDVNLYEGLRCHGVPLVTISRGRVVYEN-GIFTCAEGSGKFY--PLRTFPDYLYKKMVQREKCQAL-KGVDRAPYIGDVAAVQNSGKKETVPAVGDLAQRPCTRHGGMRDLHESSFSLSGVQIDDNLPKRSSQRILAPPGGRSSGIW 564          
BLAST of Dihydropyrimidinase vs. Ensembl Cavefish
Match: dpysl4 (dihydropyrimidinase like 4 [Source:NCBI gene;Acc:103040013])

HSP 1 Score: 293.123 bits (749), Expect = 2.203e-90
Identity = 176/507 (34.71%), Postives = 276/507 (54.44%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW-----KGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            T  KL+IK G ++N D ++ AD+ IE+G I  I +N I  S  + +DA G  V+PGG+D  T+  A+  G+   ++++ GT+AA+ GGTT +++ +      SL   ++  +D+  K   C+ ++ + +   +E +  E   L++ + V   LV +S  D+     +  D ++Y+     RD   +  VHAEN  ++   +K LL  G+TGPEGH LS PE+VE EAV+R +TIA+   CP++  KV ++ + D I   ++K    +I G  + A L  +   Y   NW  AA+FV  P L  +  T      +L   +   +   AS+H  F    KA G+++F  I  GTNG++ RM I+WDKAV SG+M+   FV   ST  AK+ N+YP KG I++GSDAD+++W     K  S +  N    ++N+FED+ C   P  VI  G +VL+ +G   A +GSG+ V    +    Y  K++       E  + + R  YDGPV D
Sbjct:   13 TGDKLIIKGGKIVNDDQSFYADIFIEDGTIKQIGENLIVPSGVKTVDAYGHIVIPGGIDVNTSLQAQHMGMSPADDFYHGTRAALAGGTTMIIDHVVPEPGASLLAAFDQWRDVADKRSCCDYSLHIDITRWHEGMFEELETLVKDQGVNSFLVFMSYKDR----FQSSDSQMYEIFGILRDLGAIAQVHAENGDIIDEEQKRLLDMGITGPEGHVLSHPEEVETEAVYRAITIAKQANCPLYITKVMSRPAADVIAKARKK--GMVIYGEPIAASLGTDGSHYWSQNWAKAAAFVMSPPLSPDPATPDYLNSML---SCGDLQVTASAHCTFSTAQKAVGKDNFTLIPEGTNGIEERMSIVWDKAVASGKMDENEFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVIWNTKETKTFSATSHNLTV-EMNIFEDMECRGFPVVVISQGRIVLE-DGKLDAMEGSGRFV--PRKAFPDYVYKRIKARSRMAEA-RGVPRGNYDGPVHD 505          
BLAST of Dihydropyrimidinase vs. Ensembl Cavefish
Match: dpysl4 (dihydropyrimidinase like 4 [Source:NCBI gene;Acc:103040013])

HSP 1 Score: 292.738 bits (748), Expect = 4.002e-89
Identity = 175/504 (34.72%), Postives = 275/504 (54.56%), Query Frame = 2
Query:  158 KLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW-----KGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            KL+IK G ++N D ++ AD+ IE+G I  I +N I  S  + +DA G  V+PGG+D  T+  A+  G+   ++++ GT+AA+ GGTT +++ +      SL   ++  +D+  K   C+ ++ + +   +E +  E   L++ + V   LV +S  D+     +  D ++Y+     RD   +  VHAEN  ++   +K LL  G+TGPEGH LS PE+VE EAV+R +TIA+   CP++  KV ++ + D I   ++K    +I G  + A L  +   Y   NW  AA+FV  P L  +  T      +L   +   +   AS+H  F    KA G+++F  I  GTNG++ RM I+WDKAV SG+M+   FV   ST  AK+ N+YP KG I++GSDAD+++W     K  S +  N    ++N+FED+ C   P  VI  G +VL+ +G   A +GSG+ V    +    Y  K++       E  + + R  YDGPV D
Sbjct:  119 KLIIKGGKIVNDDQSFYADIFIEDGTIKQIGENLIVPSGVKTVDAYGHIVIPGGIDVNTSLQAQHMGMSPADDFYHGTRAALAGGTTMIIDHVVPEPGASLLAAFDQWRDVADKRSCCDYSLHIDITRWHEGMFEELETLVKDQGVNSFLVFMSYKDR----FQSSDSQMYEIFGILRDLGAIAQVHAENGDIIDEEQKRLLDMGITGPEGHVLSHPEEVETEAVYRAITIAKQANCPLYITKVMSRPAADVIAKARKK--GMVIYGEPIAASLGTDGSHYWSQNWAKAAAFVMSPPLSPDPATPDYLNSML---SCGDLQVTASAHCTFSTAQKAVGKDNFTLIPEGTNGIEERMSIVWDKAVASGKMDENEFVAVTSTNAAKIFNLYPRKGRIAVGSDADLVIWNTKETKTFSATSHNLTV-EMNIFEDMECRGFPVVVISQGRIVLE-DGKLDAMEGSGRFV--PRKAFPDYVYKRIKARSRMAEA-RGVPRGNYDGPVHD 608          
BLAST of Dihydropyrimidinase vs. Ensembl Cavefish
Match: crmp1 (collapsin response mediator protein 1 [Source:ZFIN;Acc:ZDB-GENE-050720-1])

HSP 1 Score: 285.804 bits (730), Expect = 3.750e-88
Identity = 170/511 (33.27%), Postives = 271/511 (53.03%), Query Frame = 2
Query:  137 FMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVS---------PSLETMNSYFQKQLINYKLSHEVEKKIARE 1621
             +    ++LLIK G V+N D ++ ADV +E+G I  + +N I       ++A G  V+PGG+D  T       G +  +++F GTKAA+ GGTT +++ +      SL   +E  +    ++  C+ ++ + +P+ +  +K E   L+Q K +    V ++  D      ++ + +LY+AL   RD   +  VHAEN  +VA  +K++L+ G+TGPEGH LS PE++E EAVFR +TI   V CPI+  +V +K++ D +   +RK    ++ G  L A L  +   Y   NW  AA++V  P L  + TT     + L T+ +  +  V S H  +    KA G+++F  I  GTNGV+ RM  +WD+AV  G+M+   FV   ST  AKL N+YP KG I++GSDADI++W  D V    +     A + N+FE + C   P +VI  G VV + +G     +G+G+ +            + T N  +   L  Y L  +V+  + R 
Sbjct:   12 LLHHMGEQLLIKGGRVVNDDQSFYADVYVEDGVIRQVGENLIVPGGVRVVEADGRMVIPGGIDTNTCLHKDYLGSLPVDDFFQGTKAALAGGTTMIIDHVTPQPGASLLHAFEQWQAAADRKCCCDYSLHVDIPQWDGGVKDELEVLVQEKGINSFQVYMAYKD----LFQMTNSQLYEALSCLRDLGAVVLVHAENGDLVAQEQKKILSMGITGPEGHPLSHPEELEAEAVFRAITIGNQVNCPIYITRVMSKTAADTLAQARRKGC--VVFGEPLTASLATDGSHYWSRNWAKAAAYVISPPLSPDPTTP----QHLHTMLTGDLQVVGSGHCAYSTAQKAIGKDNFTLIPEGTNGVEERMGFVWDRAVALGKMDENQFVAVTSTNAAKLFNLYPRKGRIAVGSDADIVIWDPDHVKTITAKLQQSALEYNIFEGMECRGVPVFVISQGRVVYE-DGKLNVQQGTGRFIPRKPFPDHAYQRINTRNKLYVIYLYVYILGAQVDDNVPRR 511          
BLAST of Dihydropyrimidinase vs. Ensembl Cavefish
Match: crmp1 (collapsin response mediator protein 1 [Source:ZFIN;Acc:ZDB-GENE-050720-1])

HSP 1 Score: 283.108 bits (723), Expect = 3.619e-87
Identity = 171/507 (33.73%), Postives = 270/507 (53.25%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVS---------PSLETMNSYFQKQLINYKLSHEVEKKIARE 1621
            T ++LLIK G V+N D ++ ADV +E+G I  + +N I       ++A G  V+PGG+D  T       G +  +++F GTKAA+ GGTT +++ +      SL   +E  +    ++  C+ ++ + +P+ +  +K E   L+Q K +    V ++  D      ++ + +LY+AL   RD   +  VHAEN  +VA  +K++L+ G+TGPEGH LS PE++E EAVFR +TI   V CPI+  +V +K++ D +   +RK    ++ G  L A L  +   Y   NW  AA++V  P L  + TT      +L T    ++  V S H  +    KA G+++F  I  GTNGV+ RM  +WD+AV  G+M+   FV   ST  AKL N+YP KG I++GSDADI++W  D V    +     A + N+FE + C   P +VI  G VV + +G     +G+G+ +            + T N  +   L  Y L  +V+  + R 
Sbjct:   13 TGEQLLIKGGRVVNDDQSFYADVYVEDGVIRQVGENLIVPGGVRVVEADGRMVIPGGIDTNTCLHKDYLGSLPVDDFFQGTKAALAGGTTMIIDHVTPQPGASLLHAFEQWQAAADRKCCCDYSLHVDIPQWDGGVKDELEVLVQEKGINSFQVYMAYKD----LFQMTNSQLYEALSCLRDLGAVVLVHAENGDLVAQEQKKILSMGITGPEGHPLSHPEELEAEAVFRAITIGNQVNCPIYITRVMSKTAADTLAQARRKGC--VVFGEPLTASLATDGSHYWSRNWAKAAAYVISPPLSPDPTTPQHLHTML-TCGDLQV--VGSGHCAYSTAQKAIGKDNFTLIPEGTNGVEERMGFVWDRAVALGKMDENQFVAVTSTNAAKLFNLYPRKGRIAVGSDADIVIWDPDHVKTITAKLQQSALEYNIFEGMECRGVPVFVISQGRVVYE-DGKLNVQQGTGRFIPRKPFPDHAYQRINTRNKLYVIYLYVYILGAQVDDNVPRR 509          
BLAST of Dihydropyrimidinase vs. Ensembl Sea Lamprey
Match: dpysl3 (dihydropyrimidinase like 3 [Source:NCBI gene;Acc:553166])

HSP 1 Score: 226.098 bits (575), Expect = 6.135e-67
Identity = 144/459 (31.37%), Postives = 239/459 (52.07%), Query Frame = 2
Query:  497 EIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVS----HSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALP-----------PGQRV-----IRTSVKTAQPPGG 1807
            ++ C+ ++ + +P+ +E +  E   L++ + +   LV ++  D+     ++ D E+Y+   + RD   +  VHAEN  ++A  +K +L  G+ GPEGH LSR E+VE EAV R ++IA    CP++  KV +KS+ D I   ++K +  ++ G  + A L  +   Y   NW  AA+FVT P L  + TT      LL   +   +    S+H  F    KA G+++F  I  GTNG++ RM I+WDKAV +G+M+   FV   ST  AK+ ++YP KG I++GSDAD+++W+ D+++     ++  A + N+FE +     P  VI  G +VL+ EG  +A++G+G+ V P        +++     KL+    + + R  YDGPV + S+ +      + S         R  PA+   ++ P            G +V      RT  +   PPGG
Sbjct:   27 KVCCDYSLHVAVPQWHEGVAEELEILVKDRGINSFLVYMAYKDQ----YQMSDTEMYEVFTFLRDIGAIAMVHAENGDIIAEEQKRILEMGIAGPEGHVLSRAEEVEAEAVNRAISIANHTNCPLYITKVMSKSAADVISQARKKGA--VVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDYLNSLL---SCGDLQVTGSAHCTFTTAQKALGKDNFTLIPEGTNGIEERMSIVWDKAVATGKMDENQFVAVTSTNAAKIFSLYPRKGRIAVGSDADLVIWEPDTITTISAKTHTAAVEYNIFEGMEVRGAPLVVISQGRIVLE-EGKLSATQGAGRFV-PRKAFPEQVYKRIKARNKLAE--MRGVPRGLYDGPVFELSSSS------VRSTTATPTPSARTSPAKSAAQSAPLRNLHQSGFSLSGAQVDDELPRRTGHRIVAPPGG 466          
BLAST of Dihydropyrimidinase vs. Ensembl Sea Lamprey
Match: dpysl2b (dihydropyrimidinase like 2b [Source:ZFIN;Acc:ZDB-GENE-031105-1])

HSP 1 Score: 154.066 bits (388), Expect = 7.719e-43
Identity = 92/265 (34.72%), Postives = 146/265 (55.09%), Query Frame = 2
Query:  158 KLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVP-LVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTII 946
            +LLIK G +IN D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+      G  + ++++ GT+AA+ GGTT +++ +      SL   YE  ++    +  C+ ++ + L   N  + SE   L++ K V   LV ++  DK     ++ D E+Y+A    RD   +  VHAEN  ++A  +K +L   +TGPEGH LSRPE+VE EAV R +TI     CP++  KV ++S+ D I   ++K     I
Sbjct:    2 RLLIKGGRIINDDQSFTADIYVEDGFIKQIGDNLIVPGGVKSIEANGRMVMPGGIDVHTHLQMPYLGTSTMDDFYQGTRAALAGGTTMIIDHVIPEPGCSLLGAYEQWREWADAKACCDYSLHVQLTYWNSELCSEMETLIKDKGVNSFLVYMAYKDK----YQLTDAEIYEAFTAIRDLGAIALVHAENGSIIAEEQKRILGLQITGPEGHVLSRPEEVEAEAVNRAITIGNQTNCPLYITKVMSRSAADVIALSRKKVRGQYI 262          
BLAST of Dihydropyrimidinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006054.1 (pep scaffold:Pmarinus_7.0:GL477305:540:7425:1 gene:ENSPMAG00000005460.1 transcript:ENSPMAT00000006054.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 2.451e-29
Identity = 65/179 (36.31%), Postives = 100/179 (55.87%), Query Frame = 2
Query: 1115 VASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPV 1639
              S+H  F    KA G++DF  I  GTNG++ RM I+WDK V +G+M+   FV   ST  AK+ N+YP KG I++GSDAD+I+W  D V    + ++ +A + N+FE +     P  VI  G +V++ +G   A +G G+ V P        +++     +L+    + + R  YDGPV
Sbjct:    7 TGSAHCTFSTAQKALGKDDFTLIPEGTNGIEERMSIVWDKGVATGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLIIWDPDVVKTISAKTHHQAVEYNIFEGMEVRGVPLAVISQGKIVME-DGTLHAMQGVGRFV-PRKAFPEQVYKRIKARSQLTE--LQGVPRGLYDGPV 181          
BLAST of Dihydropyrimidinase vs. Ensembl Nematostella
Match: EDO46551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ7])

HSP 1 Score: 287.345 bits (734), Expect = 1.021e-88
Identity = 185/574 (32.23%), Postives = 303/574 (52.79%), Query Frame = 2
Query:  152 QKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV-SPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVI----DPSA---------DNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            + ++LIK GT++N D  ++ADV IENG I  I+K+ I     + IDA+   +LPGG+D  T+      G  + +++F GTKAA+ GGTT +++ +   K ESL E Y+  +    +++ C+    + +   +E +  E   L++ K +               + I+D E+ +    C++   +  VHAEN  ++    K+++A G+TGPEGH + RPE+VE EA  R +TIA  V CP++   V +KSS   I D +R     ++ G  + A L  +   Y    W+  A  V  P L+ + +T      L+  +A+  +    + +  F  + KA G+NDFR I  G NG++ RM ++W+K V +G+M+P  FV   STT AK+ N+YP KG I++GSDADI+VW  ++     + ++ +A D N+FE + CH  P   I  G VV +  G F   +GSG+ + +P      S++    I+ +  +   KK+ REPY G V+    DP A           KE + V  +   + D+++ G     ++      +R  R S + A+PPGG++
Sbjct:    8 KDRILIKGGTIVNDDQMFEADVYIENGLIKEISKSVICPGGTKVIDASRKLILPGGIDTHTHLQMPFMGTTAIDDFFIGTKAALAGGTTMIIDFVIPAKGESLLEAYDKWRGWADEKVCCDYGFHVAVTWWSEEVAEEMEILVKEKGINSFKTFMAYKD---VMMINDAEMINCYKKCKEIGAIAQVHAENGDLIDESAKKMIAMGITGPEGHEMCRPEEVEAEATQRAITIANQVSCPLYVVHVMSKSSAKVISDARRLGK--VVIGEPIAAGLGCDGTNYWHKCWRHGAGHVMGPPLRPDTSTP---EHLMNLLANDDLQCTGTDNCTFSSEQKALGKNDFRKIPNGVNGIEDRMSVIWEKGVHAGKMDPCRFVAVTSTTAAKIFNVYPQKGRIAVGSDADIVVWDPEATRVISAKTHHQAVDFNIFEGMECHGVPVVTISQGKVVYEG-GEFHVVRGSGRFIPTPPF----SHYMYSRIHTRDKNCQPKKVDREPYTGKVLTIEPDPKAAVFTSPAQRRMKEREEVKKN--PHRDLHRSGFELSGRQFD---DERPYRPSSRVAKPPGGAS 563          
BLAST of Dihydropyrimidinase vs. Ensembl Nematostella
Match: EDO49158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH45])

HSP 1 Score: 63.1586 bits (152), Expect = 1.285e-10
Identity = 51/191 (26.70%), Postives = 83/191 (43.46%), Query Frame = 2
Query:  794 SRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW 1366
            +RPE +E++A+  V+ + +  + P H   + + S+LD I    R S   +   T+   L   AE+  D     A  +   P ++     E     L   V  R I+ V S H       K   + DF     G + +QY + + W  A   G +     V  +   P+KL ++   KG IS+G DAD ++W
Sbjct:  154 TRPESMENKAIEMVIHLCDHYRVPCHIVHLSSGSALDSIRS-ARSSGIPLTVETTHHYLSLTAEEVPDG----ATQYKCCPPIRDRSNQEV----LWNAVKFRDIDLVVSDHSPCTPDLKLLDQGDFIGAWGGISSLQYGLSLFWSGARCRG-LGLHDVVRVLCEQPSKLCSLQHRKGMISVGKDADFVIW 334          
BLAST of Dihydropyrimidinase vs. Ensembl Nematostella
Match: EDO25804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVF6])

HSP 1 Score: 59.6918 bits (143), Expect = 1.629e-9
Identity = 35/111 (31.53%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  161 LLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLAEC--IDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVV----NCLEIMKDESLKEKYEM 475
             LI+   ++N    ++ DVLIE+  I  IA  I    +EC  IDA G +++PG +D + +F  +  G+    N  S ++AAI GG T+ +         +  E L++KY++
Sbjct:    4 FLIRNAKIVNEGVVFEGDVLIEDEFIKEIADKISPKSSECVIIDAEGSYLIPGAIDDQVHF--REPGLTHKGNIASESRAAIAGGITSFIEQPNTVPNAVTQELLEQKYQI 112          
BLAST of Dihydropyrimidinase vs. Ensembl Medaka
Match: crmp1 (dihydropyrimidinase-related protein 1 [Source:NCBI gene;Acc:101159888])

HSP 1 Score: 305.449 bits (781), Expect = 2.814e-95
Identity = 180/506 (35.57%), Postives = 275/506 (54.35%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            T ++LLI+ G V+N D ++  DV IE+G I  + +N +     + I+A G  V+PGG+D  T       G    +++  GTKAA+ GGTT +++ +     ESL E +E  ++   K   C+ ++ + +P  NE +K E   L+Q K +    V ++  D      ++ D +LY+A  + +    +  VHAEN  ++   ++++L  G+TGPEGH LSRPE+VE EAVFR +T+   V CP++  KV +KS+ D I   +RK S  ++ G  + A L  +   Y   NW  AA++VT P L  + TT      LL   AS  +  V SSH  +    KA G++DF  I  GTNGV+ RM  +WDKAV  G+M+   FV   ST  AK+ N+YP KG I++ SDADI++W  D V    +     A + N+FE + C  GP  V+  G VV +  G     +G+G+ + P     +  FQ+  I ++     ++ + R  YDGPV D
Sbjct:   16 TDERLLIRGGRVVNDDRSFFGDVYIEDGLIKQVGENLVVPGGVKVIEANGRMVIPGGIDVNTCLMKTYLGTQPVDDFLQGTKAALAGGTTMIIDHVTPEPGESLLEAFERWQEAADKRACCDYSLHVDIPLWNETVKDELEVLVQDKGINSFQVYMAYKD----VYQMTDSQLYEAFSFLKQLGAVVLVHAENGDLIFEEQRKILGMGITGPEGHPLSRPEEVEAEAVFRAITLGNCVNCPVYITKVMSKSAADTIAQARRKGS--VVFGEPITAGLATDGSHYWSKNWAKAAAYVTSPPLSPDPTTPEHLHTLL---ASGDLQVVGSSHCAYSTSQKAIGKDDFTLIPEGTNGVEERMGFVWDKAVAMGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVDSDADIVIWDPDIVKTITAKQQQSAAEYNIFEGLECRGGPALVLSQGRVVYEG-GKLQIQQGTGRFI-PRKPFPDYAFQR--IKFRNQVSSKQGVTRGVYDGPVHD 508          
BLAST of Dihydropyrimidinase vs. Ensembl Medaka
Match: crmp1 (dihydropyrimidinase-related protein 1 [Source:NCBI gene;Acc:101159888])

HSP 1 Score: 303.523 bits (776), Expect = 1.567e-93
Identity = 179/504 (35.52%), Postives = 274/504 (54.37%), Query Frame = 2
Query:  155 KKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID 1645
            ++LLI+ G V+N D ++  DV IE+G I  + +N +     + I+A G  V+PGG+D  T       G    +++  GTKAA+ GGTT +++ +     ESL E +E  ++   K   C+ ++ + +P  NE +K E   L+Q K +    V ++  D      ++ D +LY+A  + +    +  VHAEN  ++   ++++L  G+TGPEGH LSRPE+VE EAVFR +T+   V CP++  KV +KS+ D I   +RK S  ++ G  + A L  +   Y   NW  AA++VT P L  + TT      LL   AS  +  V SSH  +    KA G++DF  I  GTNGV+ RM  +WDKAV  G+M+   FV   ST  AK+ N+YP KG I++ SDADI++W  D V    +     A + N+FE + C  GP  V+  G VV +  G     +G+G+ + P     +  FQ+  I ++     ++ + R  YDGPV D
Sbjct:  121 ERLLIRGGRVVNDDRSFFGDVYIEDGLIKQVGENLVVPGGVKVIEANGRMVIPGGIDVNTCLMKTYLGTQPVDDFLQGTKAALAGGTTMIIDHVTPEPGESLLEAFERWQEAADKRACCDYSLHVDIPLWNETVKDELEVLVQDKGINSFQVYMAYKD----VYQMTDSQLYEAFSFLKQLGAVVLVHAENGDLIFEEQRKILGMGITGPEGHPLSRPEEVEAEAVFRAITLGNCVNCPVYITKVMSKSAADTIAQARRKGS--VVFGEPITAGLATDGSHYWSKNWAKAAAYVTSPPLSPDPTTPEHLHTLL---ASGDLQVVGSSHCAYSTSQKAIGKDDFTLIPEGTNGVEERMGFVWDKAVAMGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVDSDADIVIWDPDIVKTITAKQQQSAAEYNIFEGLECRGGPALVLSQGRVVYEG-GKLQIQQGTGRFI-PRKPFPDYAFQR--IKFRNQVSSKQGVTRGVYDGPVHD 611          
BLAST of Dihydropyrimidinase vs. Ensembl Medaka
Match: dpysl3 (dihydropyrimidinase-related protein 3 [Source:NCBI gene;Acc:101165934])

HSP 1 Score: 297.36 bits (760), Expect = 3.640e-91
Identity = 186/573 (32.46%), Postives = 300/573 (52.36%), Query Frame = 2
Query:  146 ETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV--SPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID--------PSADNKEEKHVLYSHMVNNDVYK-RGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSA 1813
            E   +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G  + +++  G+KAA+ GGTT +V+ +      SL E Y+  +    ++  C+ ++ + +   N+++K E + L++ K V    V ++  D      ++ + +LY+   +  +   +  VHAEN +++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  +V +KS+ D I+   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  ++   S+H  F +  KA G++DF  I  G NGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSDAD+I+W  DSV    + ++  A + N+FE +     P  VI  G +VL+ +G    + G+G+ +  SP  +     F  + +  +    V + + R  YDGPV +        PSA  +          ++   +   G P  D+    P G+R++        PPGG +
Sbjct:   96 EKSDRLLIKGGRIVNDDQSFHADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDIHTHFQMPYRGTTTVDDFAQGSKAALAGGTTMIVDHVIPEPGTSLMEAYDQWRQWADEKACCDYSLHVDITHWNDSVKQEVDSLIKDKGVNSFQVYMAYKD----YYQLSNSQLYEIFTFLAEKGGIVQVHAENGEIIAEEQARMLQMGITGPEGHVLSRPEELEAEAVFRAVTIASQTNCPLYVTRVMSKSAAD-IISQARKKGNVVFGEPITASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLNTLL---ASGDLSVTGSAHCTFSVAQKAIGKDDFTQIPEGVNGVEERMALIWDKAVTTGKMDENMFVAITSTNAAKILNLYPRKGRIAVGSDADLIIWDTDSVRTITAKTHNSAAEYNIFEGMELRGAPLVVICQGKIVLE-DGKLQVTSGAGRFIPCSPFPD-----FAYKRVKARKQLAVLRAVPRGMYDGPVSEFSMSRGGTPSASARTSPTKQPVRNLHQSGFSLTGPPTPDEVPIRPAGRRIV-------VPPGGRS 647          
BLAST of Dihydropyrimidinase vs. Ensembl Medaka
Match: dpysl3 (dihydropyrimidinase-related protein 3 [Source:NCBI gene;Acc:101165934])

HSP 1 Score: 294.278 bits (752), Expect = 9.547e-91
Identity = 173/505 (34.26%), Postives = 277/505 (54.85%), Query Frame = 2
Query:  149 TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIV--SPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPV 1639
            T  +LLIK G ++N D ++ AD+ +E+G I  I  N I     + I+A G  V+PGG+D  T+F     G  + +++  G+KAA+ GGTT +V+ +      SL E Y+  +    ++  C+ ++ + +   N+++K E + L++ K V    V ++  D      ++ + +LY+   +  +   +  VHAEN +++A  +  +L  G+TGPEGH LSRPE++E EAVFR +TIA    CP++  +V +KS+ D I+   RK  N +       +L  +   Y   NW  AA+FVT P L  + TT      LL   AS  ++   S+H  F +  KA G++DF  I  G NGV+ RM ++WDKAV +G+M+   FV   ST  AK+ N+YP KG I++GSDAD+I+W  DSV    + ++  A + N+FE +     P  VI  G +VL+ +G    + G+G+ +  SP  +     F  + +  +    V + + R  YDGPV
Sbjct:   13 TSDRLLIKGGRIVNDDQSFHADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDIHTHFQMPYRGTTTVDDFAQGSKAALAGGTTMIVDHVIPEPGTSLMEAYDQWRQWADEKACCDYSLHVDITHWNDSVKQEVDSLIKDKGVNSFQVYMAYKD----YYQLSNSQLYEIFTFLAEKGGIVQVHAENGEIIAEEQARMLQMGITGPEGHVLSRPEELEAEAVFRAVTIASQTNCPLYVTRVMSKSAAD-IISQARKKGNVVFGEPITASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLNTLL---ASGDLSVTGSAHCTFSVAQKAIGKDDFTQIPEGVNGVEERMALIWDKAVTTGKMDENMFVAITSTNAAKILNLYPRKGRIAVGSDADLIIWDTDSVRTITAKTHNSAAEYNIFEGMELRGAPLVVICQGKIVLE-DGKLQVTSGAGRFIPCSPFPD-----FAYKRVKARKQLAVLRAVPRGMYDGPV 503          
BLAST of Dihydropyrimidinase vs. Ensembl Medaka
Match: crmp1 (dihydropyrimidinase-related protein 1 [Source:NCBI gene;Acc:101159888])

HSP 1 Score: 288.5 bits (737), Expect = 4.681e-89
Identity = 188/566 (33.22%), Postives = 285/566 (50.35%), Query Frame = 2
Query:  200 TYDADVLIENGKIVNIAKN-IEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSV----SHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVID-----------PSADNKEEKH----VLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSAQASWWG 1831
            ++  DV IE+G I  + +N +     + I+A G  V+PGG+D  T       G    +++  GTKAA+ GGTT +++ +     ESL E +E  ++   K   C+ ++ + +P  NE +K E   L+Q K +    V ++  D      ++ D +LY+A  + +    +  VHAEN  ++   ++++L  G+TGPEGH LSRPE+VE EAVFR +T+   V CP++  KV +KS+ D I   +RK S  ++ G  + A L  +   Y   NW  AA++VT P L  + TT      LL   AS  +  V SSH  +    KA G++DF  I  GTNGV+ RM  +WDKAV  G+M+   FV   ST  AK+ N+YP KG I++ SDADI++W  D V    +     A + N+FE + C  GP  V+  G VV +  G     +G+G+ + P     +  FQ+  I ++     ++ + R  YDGPV D           PSA      H    V   H+ N   +   G   D       G R++        PPGG +  +  G
Sbjct:    2 SFFGDVYIEDGLIKQVGENLVVPGGVKVIEANGRMVIPGGIDVNTCLMKTYLGTQPVDDFLQGTKAALAGGTTMIIDHVTPEPGESLLEAFERWQEAADKRACCDYSLHVDIPLWNETVKDELEVLVQDKGINSFQVYMAYKD----VYQMTDSQLYEAFSFLKQLGAVVLVHAENGDLIFEEQRKILGMGITGPEGHPLSRPEEVEAEAVFRAITLGNCVNCPVYITKVMSKSAADTIAQARRKGS--VVFGEPITAGLATDGSHYWSKNWAKAAAYVTSPPLSPDPTTPEHLHTLL---ASGDLQVVGSSHCAYSTSQKAIGKDDFTLIPEGTNGVEERMGFVWDKAVAMGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVDSDADIVIWDPDIVKTITAKQQQSAAEYNIFEGLECRGGPALVLSQGRVVYEG-GKLQIQQGTGRFI-PRKPFPDYAFQR--IKFRNQVSSKQGVTRGVYDGPVHDVTPTPKYITPSPSAKTSPTSHQPPTVRNLHLSN---FSLSGAQIDDNIPRRSGHRIV-------APPGGRSNITSLG 544          
BLAST of Dihydropyrimidinase vs. Planmine SMEST
Match: SMESG000060188.1 (SMESG000060188.1)

HSP 1 Score: 1164.83 bits (3012), Expect = 0.000e+0
Identity = 562/564 (99.65%), Postives = 563/564 (99.82%), Query Frame = 2
Query:  140 MSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSAQASWWG 1831
            MSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNK TEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLS+EVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSAQASWWG
Sbjct:    1 MSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKNTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSNEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSAQASWWG 564          
BLAST of Dihydropyrimidinase vs. Planmine SMEST
Match: SMESG000060188.1 (SMESG000060188.1)

HSP 1 Score: 1160.21 bits (3000), Expect = 0.000e+0
Identity = 560/564 (99.29%), Postives = 562/564 (99.65%), Query Frame = 2
Query:  140 MSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSAQASWWG 1831
            +S TQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNK TEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLS+EVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSAQASWWG
Sbjct:    4 VSLTQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKNTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSNEVEKKIAREPYDGPVIDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKTAQPPGGSAQASWWG 567          
BLAST of Dihydropyrimidinase vs. Planmine SMEST
Match: SMESG000002633.1 (SMESG000002633.1)

HSP 1 Score: 321.242 bits (822), Expect = 4.797e-101
Identity = 192/589 (32.60%), Postives = 314/589 (53.31%), Query Frame = 2
Query:  134 LFMSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIE-DSLAECIDATGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKSVVPL-VRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVA-LVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVWKGD---SVSHS-NFEAGDINVFEDVICHSGPKYVIVNGIVVLDHEGNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPVIDPSA-----------DNKEEKHVLYSHMVNND--VYKRGGP-AEDKKEALPPGQ----RVIRTSVKTAQPPGGSAQASW 1825
            L +  +Q +L IK   ++N D  +DADV IE+G I  +  N+       C++A G  ++PGG+D  T+      G VS ++++SGT+AA+ GGTT +++ +   K  SL + Y   ++    ++ C+  + + +   NE++ +E  +L     +    + ++  D     + ++D+E+Y+    C+    L  VHAEN K++     EL++ G+TGPEGH  SRPE+VE EA  R + +A+   CP++   V +K + D I D +R+    ++ G  + A L  +   Y    W+ AA +V  P L+ ++ T      L++ +AS  +    + H VF    KA G++DFR I  G NGV+ RM ++W+K V +G ++P  FV   ST  AK+ NIYP KG I IGSDAD+++W  D   ++S S +++  D N+FE + CH   + VI  G VVL+ +GN   ++G+G+ V P+    N  F K  +  +    +  K+ R+PYDGPV D S            D   +++ + S  VN    +   GG   +D   AL   Q       R+ ++T QPPGG+A + W
Sbjct:   15 LHLQSSQNRLCIKGAKIVNDDRMFDADVYIEDGIIKQLGTNLVIPGGVRCVEANGKLLIPGGIDTHTHMEFPFMGTVSSDDFYSGTRAALAGGTTMIIDFVIGQKGTSLIDSYNQYREKADSKVCCDYGLHVIVSSYNESVGNEMEKLASEHGINSFKIFMAYKDS----LMLEDDEMYEVFKKCKSIGALAQVHAENGKLIEKKSLELISKGITGPEGHLYSRPEEVECEATNRAIMLADQANCPLYVVHVMSKGAADIISDARRQGK--VVFGEPIAAGLGTDGSHYSHSCWRHAAGYVMSPPLRNDRNTS---KHLMQLLASGDLECTGTDHCVFKASQKALGKDDFRSIPNGVNGVEDRMSVIWEKGVVTGILDPCKFVAVTSTNAAKIFNIYPKKGRIDIGSDADLVLWNPDVRRTISASTHYQNVDFNIFEGMHCHGVAEMVISGGKVVLE-DGNLRVAQGTGKFV-PTNPFCNYVFNKVKLRDQCHKTLANKVERQPYDGPVEDLSKEMTNLNMNFDDDTDSQQNAISSEFVNTKRPLTSGGGRHMQDSSFALSGAQIDDNLPTRSGIRTRQPPGGTATSLW 592          
BLAST of Dihydropyrimidinase vs. Planmine SMEST
Match: SMESG000028784.1 (SMESG000028784.1)

HSP 1 Score: 186.808 bits (473), Expect = 3.613e-51
Identity = 133/451 (29.49%), Postives = 226/451 (50.11%), Query Frame = 2
Query:  158 KLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSL-AECIDATGCFVLPGGVDAETNFAAKRGGIVSPEN---YFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCL-PEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDE---ELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW---KGDSVSH-SNFEAGDINVFEDVICHSGPKYVIVNGIV 1474
            K+L+K G ++N D  + +DVLIEN  I  I ++I  S   + ID T   ++PGG+D  TNF       +SP +     + + AA+ GGTTT++  ++      L    +  +  +  +++CN    + + P  +E +KS          +  L R   ++  C  + I +E        L  C++   L  +   +   +  +E+EL+  G++GPEG + SR  + E E ++R+L +  +  C +   +V     + K++   +     I   T   AL  ++ KY   NW  +AS +T P ++ +     Q   ++ ++    I+ VAS H       ++ G+ DFR I  G +GV+ R+ +LWD+ VKSG +    FV+  ST  AK+ N+YP +G I++GS ADI++W   K  ++S  S     D N+FE + C   P+ VIVNG V
Sbjct:    2 KMLLKGGYIVNSDRKFQSDVLIENNIIKQIGQSIVVSGDTKVIDVTNKLIIPGGIDPSTNFN------LSPNHRDILHNESMAALAGGTTTIITLVKEQSGAELVNSLKALQSDLKSKVLCNYGFCVQIDPNDDECVKS----------MEKLARQFGIN--CFQMTIGNEINANTVSVLKKCKELQCLLKLRVHDSTYLEAVEEELITAGISGPEGFFQSRCIENEMEQLYRILKLNHVFPCCLIIPQVM-NEDIAKLVAKMKMEGRPIFSETIPPALALSSHKYFSNNWDESASLITDPPVRND-----QDAAIIRSIHCGDIDMVASEHTTITNADRSIGKRDFRNIPHGVSGVEERLSMLWDRGVKSGIINECEFVSATSTNAAKIFNLYPDRGHIAVGSVADIVIWNPVKTRTISALSQHLQNDTNIFEGISCQGVPEVVIVNGSV 428          
BLAST of Dihydropyrimidinase vs. Planmine SMEST
Match: SMESG000028784.1 (SMESG000028784.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.489e-50
Identity = 132/450 (29.33%), Postives = 225/450 (50.00%), Query Frame = 2
Query:  161 LLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSL-AECIDATGCFVLPGGVDAETNFAAKRGGIVSPEN---YFSGTKAAIYGGTTTVVNCLEIMKDESLKEKYEMEKDIISKEIVCNLAIQLCL-PEVNEAIKSEFNELLQSKSVVPLVRLSTVDKGCHCVKIDDE---ELYDALCWCRDNSVLPTVHAENDKMVAILEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYAKSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPALKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIPGTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISIGSDADIIVW---KGDSVSH-SNFEAGDINVFEDVICHSGPKYVIVNGIV 1474
            +L+K G ++N D  + +DVLIEN  I  I ++I  S   + ID T   ++PGG+D  TNF       +SP +     + + AA+ GGTTT++  ++      L    +  +  +  +++CN    + + P  +E +KS          +  L R   ++  C  + I +E        L  C++   L  +   +   +  +E+EL+  G++GPEG + SR  + E E ++R+L +  +  C +   +V     + K++   +     I   T   AL  ++ KY   NW  +AS +T P ++ +     Q   ++ ++    I+ VAS H       ++ G+ DFR I  G +GV+ R+ +LWD+ VKSG +    FV+  ST  AK+ N+YP +G I++GS ADI++W   K  ++S  S     D N+FE + C   P+ VIVNG V
Sbjct:    1 MLLKGGYIVNSDRKFQSDVLIENNIIKQIGQSIVVSGDTKVIDVTNKLIIPGGIDPSTNFN------LSPNHRDILHNESMAALAGGTTTIITLVKEQSGAELVNSLKALQSDLKSKVLCNYGFCVQIDPNDDECVKS----------MEKLARQFGIN--CFQMTIGNEINANTVSVLKKCKELQCLLKLRVHDSTYLEAVEEELITAGISGPEGFFQSRCIENEMEQLYRILKLNHVFPCCLIIPQVM-NEDIAKLVAKMKMEGRPIFSETIPPALALSSHKYFSNNWDESASLITDPPVRND-----QDAAIIRSIHCGDIDMVASEHTTITNADRSIGKRDFRNIPHGVSGVEERLSMLWDRGVKSGIINECEFVSATSTNAAKIFNLYPDRGHIAVGSVADIVIWNPVKTRTISALSQHLQNDTNIFEGISCQGVPEVVIVNGSV 426          
The following BLAST results are available for this feature:
BLAST of Dihydropyrimidinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DPYSL37.810e-9434.65dihydropyrimidinase like 3 [Source:HGNC Symbol;Acc... [more]
DPYSL31.400e-9234.11dihydropyrimidinase like 3 [Source:HGNC Symbol;Acc... [more]
DPYSL58.070e-9132.00dihydropyrimidinase like 5 [Source:HGNC Symbol;Acc... [more]
DPYSL58.070e-9132.00dihydropyrimidinase like 5 [Source:HGNC Symbol;Acc... [more]
DPYSL58.070e-9132.00dihydropyrimidinase like 5 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhp-27.802e-8230.88Dihydropyrimidinase 2 [Source:UniProtKB/Swiss-Pro... [more]
dhp-12.192e-7132.27Dihydropyrimidinase 1 [Source:UniProtKB/Swiss-Pro... [more]
dhp-12.192e-7132.27Dihydropyrimidinase 1 [Source:UniProtKB/Swiss-Pro... [more]
dhp-12.192e-7132.27Dihydropyrimidinase 1 [Source:UniProtKB/Swiss-Pro... [more]
unc-331.169e-4629.46pep chromosome:WBcel235:IV:3518147:3525572:1 gene:... [more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CRMP4.439e-7732.28gene:FBgn0023023 transcript:FBtr0114453[more]
CRMP2.491e-7331.14gene:FBgn0023023 transcript:FBtr0089686[more]
CRMP4.400e-4330.53gene:FBgn0023023 transcript:FBtr0089685[more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crmp11.092e-9635.03collapsin response mediator protein 1 [Source:ZFIN... [more]
dpysl31.934e-9232.69dihydropyrimidinase like 3 [Source:NCBI gene;Acc:5... [more]
dpysl5a1.106e-8932.81dihydropyrimidinase like 5a [Source:ZFIN;Acc:ZDB-G... [more]
dpysl5a1.106e-8932.81dihydropyrimidinase like 5a [Source:ZFIN;Acc:ZDB-G... [more]
dpysl5a2.336e-8632.31dihydropyrimidinase like 5a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpysl45.161e-9332.87dihydropyrimidinase like 4 [Source:NCBI gene;Acc:5... [more]
dpysl45.388e-9332.87dihydropyrimidinase like 4 [Source:NCBI gene;Acc:5... [more]
dpysl45.719e-9332.87dihydropyrimidinase like 4 [Source:NCBI gene;Acc:5... [more]
dpysl41.141e-9132.87dihydropyrimidinase like 4 [Source:NCBI gene;Acc:5... [more]
rfc11.241e-9134.10replication factor C subunit 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dpysl33.005e-9234.46dihydropyrimidinase-like 3 [Source:MGI Symbol;Acc:... [more]
Dpysl38.196e-9234.46dihydropyrimidinase-like 3 [Source:MGI Symbol;Acc:... [more]
Crmp13.230e-9132.53collapsin response mediator protein 1 [Source:MGI ... [more]
Dpysl36.030e-9133.91dihydropyrimidinase-like 3 [Source:MGI Symbol;Acc:... [more]
Dpysl54.819e-9031.83dihydropyrimidinase-like 5 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Dihydropyrimidinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14195|DPYL3_HUMAN3.751e-9334.65Dihydropyrimidinase-related protein 3 OS=Homo sapi... [more]
sp|Q52PJ5|DPYL3_DANRE1.460e-9132.69Dihydropyrimidinase-related protein 3 OS=Danio rer... [more]
sp|Q62952|DPYL3_RAT1.852e-9134.46Dihydropyrimidinase-related protein 3 OS=Rattus no... [more]
sp|Q62188|DPYL3_MOUSE2.102e-9134.46Dihydropyrimidinase-related protein 3 OS=Mus muscu... [more]
sp|Q6GL72|DPYL3_XENTR7.743e-9134.19Dihydropyrimidinase-related protein 3 OS=Xenopus t... [more]
back to top
BLAST of Dihydropyrimidinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5DF262.328e-10135.38SJCHGC09277 protein OS=Schistosoma japonicum OX=61... [more]
A0A4Z2DJ153.470e-10135.38Dihydropyrimidinase-related protein isoform 3 OS=S... [more]
C1L5243.470e-10135.38Dihydropyrimidinase-like 2 OS=Schistosoma japonicu... [more]
A0A183QW392.378e-9733.00Amidohydro-rel domain-containing protein OS=Schist... [more]
H2STX23.010e-9734.38Collapsin response mediator protein 1 OS=Takifugu ... [more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpysl5a9.302e-9133.16dihydropyrimidinase like 5 [Source:NCBI gene;Acc:1... [more]
dpysl42.203e-9034.71dihydropyrimidinase like 4 [Source:NCBI gene;Acc:1... [more]
dpysl44.002e-8934.72dihydropyrimidinase like 4 [Source:NCBI gene;Acc:1... [more]
crmp13.750e-8833.27collapsin response mediator protein 1 [Source:ZFIN... [more]
crmp13.619e-8733.73collapsin response mediator protein 1 [Source:ZFIN... [more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dpysl36.135e-6731.37dihydropyrimidinase like 3 [Source:NCBI gene;Acc:5... [more]
dpysl2b7.719e-4334.72dihydropyrimidinase like 2b [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000006054.12.451e-2936.31pep scaffold:Pmarinus_7.0:GL477305:540:7425:1 gene... [more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO465511.021e-8832.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491581.285e-1026.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258041.629e-931.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Dihydropyrimidinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crmp12.814e-9535.57dihydropyrimidinase-related protein 1 [Source:NCBI... [more]
crmp11.567e-9335.52dihydropyrimidinase-related protein 1 [Source:NCBI... [more]
dpysl33.640e-9132.46dihydropyrimidinase-related protein 3 [Source:NCBI... [more]
dpysl39.547e-9134.26dihydropyrimidinase-related protein 3 [Source:NCBI... [more]
crmp14.681e-8933.22dihydropyrimidinase-related protein 1 [Source:NCBI... [more]
back to top
BLAST of Dihydropyrimidinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060188.10.000e+099.65SMESG000060188.1[more]
SMESG000060188.10.000e+099.29SMESG000060188.1[more]
SMESG000002633.14.797e-10132.60SMESG000002633.1[more]
SMESG000028784.13.613e-5129.49SMESG000028784.1[more]
SMESG000028784.11.489e-5029.33SMESG000028784.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013480 ID=SMED30013480|Name=Dihydropyrimidinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1993bp
CTTCCGATCTTGTCTCTTAAGCAAAGATGTATTAATTCGAAAATGGTGCG
ACCAATAGAAAATTAGGAAACTGGTGAGTAAAAGAGATTTATATAATTGT
GACAAATTATAAACAAAGTTATTGATTAAAGTTTTGTTTATGTCTGAAAC
GCAGAAAAAACTTCTGATTAAATGTGGAACCGTAATAAATCACGATTGCA
CATATGATGCCGATGTATTGATTGAAAATGGCAAAATTGTGAATATTGCA
AAAAATATTGAAGATTCTTTAGCAGAATGCATAGATGCTACTGGTTGTTT
TGTGCTTCCAGGAGGAGTAGATGCAGAAACAAATTTTGCGGCCAAAAGAG
GTGGTATTGTAAGCCCCGAAAATTATTTCTCCGGCACCAAGGCAGCGATA
TATGGTGGAACTACCACTGTCGTTAACTGTCTTGAAATCATGAAGGATGA
ATCTTTAAAAGAGAAATACGAAATGGAGAAGGATATTATTTCCAAGGAAA
TCGTGTGCAATTTGGCTATTCAGTTGTGTTTGCCGGAAGTCAATGAAGCT
ATTAAATCAGAATTTAATGAATTATTACAATCGAAATCCGTCGTCCCATT
GGTCAGGTTATCAACTGTTGACAAAGGTTGTCATTGTGTGAAAATTGATG
ATGAAGAATTGTATGATGCGTTGTGCTGGTGTCGAGATAATTCCGTGCTA
CCAACTGTACATGCTGAAAATGACAAAATGGTTGCAATTCTTGAGAAAGA
ATTGCTAGCTGATGGAGTAACTGGTCCTGAGGGTCACTATTTATCTAGGC
CGGAAAAAGTTGAAGATGAAGCCGTTTTTCGTGTTTTGACTATAGCGGAA
ATGGTAAAATGCCCAATACACTTTGGTAAAGTCTACGCCAAATCGTCTCT
TGATAAAATAATGGACTGGCAGAGGAAGAGTTCAAATACTATTATTTGCG
GGACAAGCCTTGTGGCTCTCGTTCACAACGCAGAGAAATATCGAGATCCT
AACTGGAAAGTAGCTGCATCATTCGTTACGATGCCAGCATTAAAAATGAA
TAAAACTACTGAATTTCAATGCACGGAGTTACTCGAAACCGTTGCGAGTA
GAAAAATAAATCACGTTGCTTCTTCACATTTAGTTTTTGACATGAAGCAT
AAAGCTAGTGGTAGGAATGATTTCCGCTGCATAATTCCCGGAACTAATGG
AGTTCAATATCGCATGAAAATTCTATGGGACAAAGCTGTGAAATCCGGTA
GAATGGAACCGACATCATTTGTCAATTGCGTAAGCACAACTCCAGCGAAA
TTAGCGAATATTTACCCGCATAAAGGCACGATATCTATCGGATCTGATGC
TGATATAATTGTTTGGAAGGGTGACAGTGTCTCACATAGCAATTTTGAGG
CCGGGGATATCAACGTATTCGAGGACGTAATTTGCCATAGTGGTCCAAAA
TATGTGATTGTTAATGGAATTGTCGTTCTGGATCATGAAGGGAATTTCAC
TGCCTCTAAAGGCTCTGGTCAAATTGTTTCACCTTCACTTGAAACAATGA
ATTCTTATTTCCAAAAGCAATTGATAAATTACAAACTGTCACATGAAGTA
GAGAAGAAAATCGCACGGGAACCCTATGACGGTCCGGTTATAGATCCAAG
CGCTGATAACAAAGAAGAGAAGCATGTTCTCTATTCTCACATGGTTAATA
ATGATGTTTATAAACGAGGTGGACCAGCAGAGGATAAAAAAGAAGCATTG
CCTCCTGGTCAACGGGTTATTAGAACTTCAGTGAAAACGGCTCAGCCCCC
AGGAGGATCAGCGCAAGCAAGTTGGTGGGGATAATTGGCCTGGAGAACCC
CTACTATTTATTATAAATTCAGTTCAAATGTTTACTTTTTATGTTTTATT
TGTTTTATTTGTGCCATAGGATTTCAGACTATTCTCCTAGGAATGTATTT
GTAATGTTCTGACAATAAATTTTTAATTTCTTTCAAAAAAAAA
back to top

protein sequence of SMED30013480-orf-1

>SMED30013480-orf-1 ID=SMED30013480-orf-1|Name=SMED30013480-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=565bp
MSETQKKLLIKCGTVINHDCTYDADVLIENGKIVNIAKNIEDSLAECIDA
TGCFVLPGGVDAETNFAAKRGGIVSPENYFSGTKAAIYGGTTTVVNCLEI
MKDESLKEKYEMEKDIISKEIVCNLAIQLCLPEVNEAIKSEFNELLQSKS
VVPLVRLSTVDKGCHCVKIDDEELYDALCWCRDNSVLPTVHAENDKMVAI
LEKELLADGVTGPEGHYLSRPEKVEDEAVFRVLTIAEMVKCPIHFGKVYA
KSSLDKIMDWQRKSSNTIICGTSLVALVHNAEKYRDPNWKVAASFVTMPA
LKMNKTTEFQCTELLETVASRKINHVASSHLVFDMKHKASGRNDFRCIIP
GTNGVQYRMKILWDKAVKSGRMEPTSFVNCVSTTPAKLANIYPHKGTISI
GSDADIIVWKGDSVSHSNFEAGDINVFEDVICHSGPKYVIVNGIVVLDHE
GNFTASKGSGQIVSPSLETMNSYFQKQLINYKLSHEVEKKIAREPYDGPV
IDPSADNKEEKHVLYSHMVNNDVYKRGGPAEDKKEALPPGQRVIRTSVKT
AQPPGGSAQASWWG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011059Metal-dep_hydrolase_composite
IPR006680Amidohydro-rel
IPR032466Metal_Hydrolase
Vocabulary: molecular function
TermDefinition
GO:0016810hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011059Metal-dependent hydrolase, composite domain superfamilyGENE3DG3DSA:2.30.40.10coord: 8..466
e-value: 3.7E-133
score: 446.5
IPR011059Metal-dependent hydrolase, composite domain superfamilySUPERFAMILYSSF51338Composite domain of metallo-dependent hydrolasescoord: 7..463
NoneNo IPR availableGENE3DG3DSA:3.20.20.140coord: 58..433
e-value: 3.7E-133
score: 446.5
NoneNo IPR availablePANTHERPTHR11647:SF1COLLAPSIN RESPONSE MEDIATOR PROTEINcoord: 3..504
NoneNo IPR availablePANTHERPTHR11647AMINOHYDROLASEcoord: 3..504
IPR006680Amidohydrolase-relatedPFAMPF01979Amidohydro_1coord: 54..445
e-value: 1.2E-13
score: 51.1
IPR032466Metal-dependent hydrolaseSUPERFAMILYSSF51556Metallo-dependent hydrolasescoord: 58..396