MAU2 chromatid cohesion factor

Overview
NameMAU2 chromatid cohesion factor
Smed IDSMED30013477
Length (bp)2434
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MAU2 chromatid cohesion factor (SMED30013477) t-SNE clustered cells

Violin plots show distribution of expression levels for MAU2 chromatid cohesion factor (SMED30013477) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MAU2 chromatid cohesion factor (SMED30013477) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MAU2 chromatid cohesion factor (SMED30013477) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013477

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30013477h1SMcG0005445 Contig5057uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30013477h1SMcG0005445 Contig5057newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30013477h1SMcG0005445 Contig5057uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30013477h1SMcG0005445 Contig5057newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30013477h1SMcG0005445 Contig5057uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013477h1SMcG0005445 Contig5057newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30013477h1SMcG0005445 Contig5057uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30013477h1SMcG0005445 Contig5057newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30013477h1SMcG0013020 Contig5057uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30013477h1SMcG0013020 Contig5057newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30013477h1SMcG0013020 Contig5057uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30013477h1SMcG0013020 Contig5057newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30013477h1SMcG0013020 Contig5057uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013477h1SMcG0013020 Contig5057newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30013477h1SMcG0013020 Contig5057uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30013477h1SMcG0013020 Contig5057newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Human
Match: MAU2 (MAU2 sister chromatid cohesion factor [Source:HGNC Symbol;Acc:HGNC:29140])

HSP 1 Score: 416.001 bits (1068), Expect = 3.727e-135
Identity = 251/634 (39.59%), Postives = 379/634 (59.78%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADC-KTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L + Q                                              L  FI+ NLA V+IR+ NR  +   +LL RI+ + S  ++  +CL+AA FYV    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +GP P
Sbjct:   24 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ---------------------------------------------ELWAFIVTNLASVYIREGNRHQEVLYSLLERINPDHSFPVSS-HCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPP 596          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Human
Match: MAU2 (MAU2 sister chromatid cohesion factor [Source:HGNC Symbol;Acc:HGNC:29140])

HSP 1 Score: 169.859 bits (429), Expect = 2.024e-47
Identity = 105/234 (44.87%), Postives = 158/234 (67.52%), Query Frame = 2
Query:  650 ALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKL---ALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVV 1339
            A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL   +++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V
Sbjct:    1 AIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKSKSVLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQV 234          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Human
Match: MAU2 (MAU2 sister chromatid cohesion factor [Source:HGNC Symbol;Acc:HGNC:29140])

HSP 1 Score: 130.954 bits (328), Expect = 3.111e-34
Identity = 80/209 (38.28%), Postives = 127/209 (60.77%), Query Frame = 2
Query:  377 NIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAK 1000
             IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA ++ A  KP                            +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K
Sbjct:    1 KIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKANSVDA-AKP----------------------------LLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVK 180          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Celegans
Match: mau-2 (Maternal uncoordinated protein 2 [Source:UniProtKB/Swiss-Prot;Acc:O17581])

HSP 1 Score: 60.8474 bits (146), Expect = 3.009e-9
Identity = 82/416 (19.71%), Postives = 173/416 (41.59%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYL----EKARALGAHLKPPDDIIKFEAADLLSDL--FEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEV--LAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRRPDVNNSLTVATHLIDNLNGTPYQK---EALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDS-SP-------LLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPH 1510
            A   ALLG+AE  RT  PP +++ + C +S L  ++   ++A   L +GK+L  ++ + +  K +L    +K  A+G          K  A  +L+DL    ++   +     +   +  +   P    +L+ +L      DK++ GA E+  LA+ S  A      Y +    L    L+     PD+++   + + +    N T   K   E ++ F +  +++ +   G +++++  L+Q+  S           +SG + I    W+    + +L  ++    A+      R  +Y    +   +++    + SP        + +++ + LE  A C ++     + +  +  +++   N   G  L     P +H ++GL           E+ F+ A+K L ++    H
Sbjct:    5 AVAKALLGMAEALRTQDPPKLKMAIKCARSTLSMEISDEMKAICNLQLGKLLFFYTDNFELAKNHLQCAYDKMSAMGTFYTRD----KMNAISMLADLHIHYQQWPLTSIKATIRHEITTTRGFPALSNKLMFQLIELMKIDKDVEGAIEMCQLAINSSHADPKMELYFRIAKTLVTYQLMH--EEPDISDVTRIGSMIKVMENSTTSDKAHLECIKDFYVCTKLAYMFYEGKSRTSRQLLRQIQKS----------QTSGETKIHGIRWLGEPSITLLACVMNQICALVQSNTDRVEKYYHLVIKHADEIIFKSTRSPQEPGVVRCINMIKMTTLEMMACCNVLACRPQKTLHNVRDMLEW-SNRTSGPLLTRYFTPHIHYILGLQCCYFRQHENAENHFRAAMKKLHKEDITAH 403          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Fly
Match: Mau2 (gene:FBgn0038300 transcript:FBtr0083048)

HSP 1 Score: 360.918 bits (925), Expect = 5.697e-114
Identity = 233/655 (35.57%), Postives = 365/655 (55.73%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRS-ESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRRP-DVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAM---EEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPEMCLSNDAAARLLPP*SIS 2269
            A Y +LLGLAE FRT  PPNI+ C+ CL+++  +  P  +EART+L +G+IL+ ++K+ D  + +LEKA ++   L  P+  +KF+ A LL+ L  +  + S ++  +L  A+ LS++N YWHC+LLL+L+  + +D+    A E+LA+G+E A +  + Y K LFLLS+ M+L+  R+  DV   L  A  +IDN    P+QKE L++F LV+Q+   L  G  K+ K  LKQL  SIQ   A     ++   G + ++ F+W+P+E + VLVYLVTV  +M +G M +A +Y EKALTQIEKL   +  P+L++ +  +LEH  MCR+V GN+  AI EI     +C  AP+   LL R   QLH LIGLY+M+ N     E QF +                                   +++TS  +           L +F  LNLA++++R  R  D K +L  +S+E +   +    L    +YV    AF +  + ++K +LR  L+M N EDLNRLT+  L+ L  +F+++ NS           +ES  ++ P + LA++IPDI +QLW +A+LKD++++ +D   E   +  H  +S+ +I D     + + H+L+NW +G  P       A   L+P  S++
Sbjct:   15 ACYISLLGLAEYFRTSQPPNIKKCIQCLQALFTFMPPSKVEARTHLQMGQILMAYTKNIDLARQHLEKAWSISEPL--PNFDVKFDTASLLAQLHLQTDRNSHQAKAMLRRAVELSQNNVYWHCKLLLQLAQIHASDREYSLASELLAVGAESADEASATYLKVLFLLSRAMILMIERKTNDVLALLNSAGQIIDNNIPNPHQKEYLKVFFLVLQVCYYLALGQVKTVKPSLKQLQMSIQTIMAPNWPSDEAIFGANQLEMFVWLPKEQLYVLVYLVTVSHSMMAGYMDKAQKYTEKALTQIEKLKQQEDKPILSVFKVILLEHIVMCRMVMGNRELAIREIAAARDVCMAAPQR-SLLRRHSAQLHCLIGLYSMSTNLFEHAERQFVV----------------------------------CVSETSERD-----------LKLFANLNLAIIYLRTKRDTDLKQILDAVSTENTHTYSS-QALMGGFYYVQGLHAFHKNSFHEAKRFLRETLKMANAEDLNRLTSCSLVLLSHVFLSIGNS-----------KESMNMVTPAMQLASKIPDIHVQLWGSAILKDLHRMSKDVQHEKDAYANHVKYSENLIADQRKCVQSAHHELVNWFQGDPPVTSGPPAAPVLLMPESSVT 609          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Zebrafish
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:ZFIN;Acc:ZDB-GENE-050522-383])

HSP 1 Score: 303.523 bits (776), Expect = 2.111e-94
Identity = 173/395 (43.80%), Postives = 259/395 (65.57%), Query Frame = 2
Query:  314 PFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQ 1495
            P ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +  + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++   G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q
Sbjct:   15 PDSWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPPQRVEARTHLQLGSVLYHHTKNSELARTHLEKAWMISQQVAQFEDV-KFEAASLLSELYCQQNLVDSAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRSLFLLSKGMLLLMERKLQEVHPLLTLCGQIVETWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNSADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ 405          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Zebrafish
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:ZFIN;Acc:ZDB-GENE-050522-383])

HSP 1 Score: 271.166 bits (692), Expect = 8.596e-81
Identity = 181/487 (37.17%), Postives = 273/487 (56.06%), Query Frame = 2
Query:  725 DKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDH 2179
            +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++   G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALLK   +     D  ++W   +    +  +N HT    H+ H
Sbjct:   60 EKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVETWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNSADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPDHNFPVSS-HCLRAAAFYIRGLLSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLKVDGRASSCADSSSEW--TYNKPGEPALNTHTYIHAHTVH 484          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Zebrafish
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:ZFIN;Acc:ZDB-GENE-050522-383])

HSP 1 Score: 265.774 bits (678), Expect = 3.878e-79
Identity = 174/448 (38.84%), Postives = 259/448 (57.81%), Query Frame = 2
Query:  725 DKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLK 2062
            +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++   G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALLK
Sbjct:   60 EKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVETWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNSADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPDHNFPVSS-HCLRAAAFYIRGLLSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLK 447          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Zebrafish
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:ZFIN;Acc:ZDB-GENE-050522-383])

HSP 1 Score: 74.3294 bits (181), Expect = 1.127e-15
Identity = 31/54 (57.41%), Postives = 41/54 (75.93%), Query Frame = 2
Query:  314 PFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKIL 475
            P ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L
Sbjct:    8 PDSWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPPQRVEARTHLQLGSVL 61          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Xenopus
Match: mau2 (MAU2, sister chromatid cohesion factor [Source:NCBI gene;Acc:548681])

HSP 1 Score: 407.527 bits (1046), Expect = 5.112e-132
Identity = 247/633 (39.02%), Postives = 374/633 (59.08%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K    +EART+L +G +L  H+K+ +  + +LEKA        P  + +KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++DSSP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +G  P
Sbjct:   24 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPSQRIEARTHLQLGSVLYHHTKNSELARQHLEKA-------IPQFEDVKFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDSSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPDHNFPVSS-HCLRAAAFYIRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNNIDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGSPP 589          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Xenopus
Match: mau2 (MAU2, sister chromatid cohesion factor [Source:NCBI gene;Acc:548681])

HSP 1 Score: 407.527 bits (1046), Expect = 5.443e-132
Identity = 247/633 (39.02%), Postives = 374/633 (59.08%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K    +EART+L +G +L  H+K+ +  + +LEKA        P  + +KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++DSSP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +G  P
Sbjct:   19 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPSQRIEARTHLQLGSVLYHHTKNSELARQHLEKA-------IPQFEDVKFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDSSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPDHNFPVSS-HCLRAAAFYIRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNNIDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGSPP 584          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Xenopus
Match: mau2 (MAU2, sister chromatid cohesion factor [Source:NCBI gene;Acc:548681])

HSP 1 Score: 405.986 bits (1042), Expect = 2.041e-131
Identity = 245/637 (38.46%), Postives = 375/637 (58.87%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQ----QAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K    +EART+L +G +L  H+K+ +  + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYL  +Q     +MQ+G + +A +Y +KAL Q+EKL ++DSSP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +G  P
Sbjct:   16 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPSQRIEARTHLQLGSVLYHHTKNSELARQHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLSHLQVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDSSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPDHNFPVSS-HCLRAAAFYIRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNNIDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGSPP 591          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Xenopus
Match: mau2 (MAU2, sister chromatid cohesion factor [Source:NCBI gene;Acc:548681])

HSP 1 Score: 377.096 bits (967), Expect = 1.123e-120
Identity = 231/632 (36.55%), Postives = 353/632 (55.85%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRRPDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K    +EART+L +G +L  H+K+ +  + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT    L    +LL+  +  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++DSSP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ +                  H+F           + +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +G  P
Sbjct:   19 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPSQRIEARTHLQLGSVLYHHTKNSELARQHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTS---LPLFQLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDSSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPD------------------HNFPV---------RRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNNIDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGSPP 560          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Mouse
Match: Mau2 (MAU2 sister chromatid cohesion factor [Source:MGI Symbol;Acc:MGI:1921799])

HSP 1 Score: 420.624 bits (1080), Expect = 6.477e-137
Identity = 251/633 (39.65%), Postives = 379/633 (59.87%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L + Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ + S  ++  +CL+AA FYV    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +GP P
Sbjct:   30 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ---------------------------------------------ELWAFIVTNLASVYIREGNRHQELYSLLERINPDHSFPVSS-HCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPP 601          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Mouse
Match: Mau2 (MAU2 sister chromatid cohesion factor [Source:MGI Symbol;Acc:MGI:1921799])

HSP 1 Score: 416.001 bits (1068), Expect = 3.133e-135
Identity = 252/634 (39.75%), Postives = 379/634 (59.78%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADC-KTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA  L +   P  + +KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L + Q                                              L  FI+ NLA V+IR+ NR  +   +LL RI+ + S  ++  +CL+AA FYV    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +GP P
Sbjct:   30 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKA-VLASSQIPQFEDVKFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ---------------------------------------------ELWAFIVTNLASVYIREGNRHQEVLYSLLERINPDHSFPVSS-HCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPP 602          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Mouse
Match: Mau2 (MAU2 sister chromatid cohesion factor [Source:MGI Symbol;Acc:MGI:1921799])

HSP 1 Score: 416.001 bits (1068), Expect = 3.167e-135
Identity = 251/634 (39.59%), Postives = 379/634 (59.78%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADC-KTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L + Q                                              L  FI+ NLA V+IR+ NR  +   +LL RI+ + S  ++  +CL+AA FYV    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +GP P
Sbjct:   30 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ---------------------------------------------ELWAFIVTNLASVYIREGNRHQEVLYSLLERINPDHSFPVSS-HCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPP 602          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Mouse
Match: Mau2 (MAU2 sister chromatid cohesion factor [Source:MGI Symbol;Acc:MGI:1921799])

HSP 1 Score: 404.06 bits (1037), Expect = 3.012e-130
Identity = 247/627 (39.39%), Postives = 374/627 (59.65%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADC-KTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLIN 2191
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L + Q                                              L  FI+ NLA V+IR+ NR  +   +LL RI+ + S  ++  +CL+AA FYV    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI 
Sbjct:   30 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ---------------------------------------------ELWAFIVTNLASVYIREGNRHQEVLYSLLERINPDHSFPVSS-HCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLIT 595          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Mouse
Match: Mau2 (MAU2 sister chromatid cohesion factor [Source:MGI Symbol;Acc:MGI:1921799])

HSP 1 Score: 307.375 bits (786), Expect = 8.033e-96
Identity = 174/393 (44.27%), Postives = 261/393 (66.41%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQ 1495
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L + Q
Sbjct:   30 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ 418          
BLAST of MAU2 chromatid cohesion factor vs. UniProt/SwissProt
Match: sp|Q9Y6X3|SCC4_HUMAN (MAU2 chromatid cohesion factor homolog OS=Homo sapiens OX=9606 GN=MAU2 PE=1 SV=2)

HSP 1 Score: 416.001 bits (1068), Expect = 1.790e-134
Identity = 251/634 (39.59%), Postives = 379/634 (59.78%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADC-KTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L + Q                                              L  FI+ NLA V+IR+ NR  +   +LL RI+ + S  ++  +CL+AA FYV    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +GP P
Sbjct:   24 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ---------------------------------------------ELWAFIVTNLASVYIREGNRHQEVLYSLLERINPDHSFPVSS-HCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPP 596          
BLAST of MAU2 chromatid cohesion factor vs. UniProt/SwissProt
Match: sp|Q9D2X5|SCC4_MOUSE (MAU2 chromatid cohesion factor homolog OS=Mus musculus OX=10090 GN=Mau2 PE=1 SV=3)

HSP 1 Score: 416.001 bits (1068), Expect = 2.215e-134
Identity = 251/634 (39.59%), Postives = 379/634 (59.78%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADC-KTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +Q + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L + Q                                              L  FI+ NLA V+IR+ NR  +   +LL RI+ + S  ++  +CL+AA FYV    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +GP P
Sbjct:   30 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPPQRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQ---------------------------------------------ELWAFIVTNLASVYIREGNRHQEVLYSLLERINPDHSFPVSS-HCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPP 602          
BLAST of MAU2 chromatid cohesion factor vs. UniProt/SwissProt
Match: sp|B4ZIX8|SCC4_XENLA (MAU2 chromatid cohesion factor homolog OS=Xenopus laevis OX=8355 GN=mau2 PE=1 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 6.779e-133
Identity = 247/633 (39.02%), Postives = 376/633 (59.40%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +  + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++DSSP+L+  Q  +LEH  MCRLVTG+K  A+ EI  + +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +   LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +G  P
Sbjct:   19 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPPQRIEARTHLQLGSVLYHHTKNSELARQHLEKAWFISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDSSPILSSFQVILLEHIIMCRLVTGHKATALQEISQLCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYALLERINPDHNFPVSS-HCLRAAAFYIRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNNIDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGSPP 590          
BLAST of MAU2 chromatid cohesion factor vs. UniProt/SwissProt
Match: sp|B1H1Z8|SCC4_XENTR (MAU2 chromatid cohesion factor homolog OS=Xenopus tropicalis OX=8364 GN=mau2 PE=2 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 2.565e-132
Identity = 247/633 (39.02%), Postives = 376/633 (59.40%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            ++Y ALLG AE FRT SPP IRLCVHCL+++  +K    +EART+L +G +L  H+K+ +  + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++DSSP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALL+D+ +   +  +  +  Q+H+ FSQ ++ DH  A    +H LI W +G  P
Sbjct:   16 SWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPSQRIEARTHLQLGSVLYHHTKNSELARQHLEKAWLISQQIPQFEDV-KFEAASLLSELYCQENSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDSSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPDHNFPVSS-HCLRAAAFYIRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNNIDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGSPP 587          
BLAST of MAU2 chromatid cohesion factor vs. UniProt/SwissProt
Match: sp|B4NKT1|SCC4_DROWI (MAU2 chromatid cohesion factor homolog OS=Drosophila willistoni OX=7260 GN=GK13302 PE=3 SV=2)

HSP 1 Score: 367.466 bits (942), Expect = 3.408e-115
Identity = 231/636 (36.32%), Postives = 358/636 (56.29%), Query Frame = 2
Query:  320 AYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDL-FEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRRP-DVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAM---EEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            A Y +LLGLAE FRT  PPNI+ C+ CL+++  +  P  +EART+L +G+IL+ ++++ D  + +LEKA  +   L   DD+ KF+ A LL+ L  + +   + +  +L  A+ LS++N YWHC+LLL+LS  + +D+    A E+LA+G++ A++  + Y K LFLLS+ M+L+  R+  DV   L  A  +IDN    P+QKE L++F LV+Q+   L  G  K+ K  LKQL  SIQ   A     +D   G + ++ F+W+P+E + VLVYLVTV  +M +G M +A +Y EKALTQIEKL L +  P+L++ +  +LEH  MCR+V GN+  AI EI     +C  AP+   LL R   QLH LIGLYAM+ +  +  E QF + +                                    + +T  DL          +F  LNLA++++R  R  D K +L  +S+E +   +    L    +YV    AF +  + ++K +LR  L+M N EDLNRLT+  L+ L  +F+++ NS           +ES  ++ P + LA++IPDI +QLW +A+LKD++++ +D   E + +  H  +S+ +I D     + S H+L+NW  G  P
Sbjct:   15 ACYISLLGLAEYFRTSQPPNIKKCIQCLQALFTFTPPSKVEARTHLQMGQILMAYTRNIDMARQHLEKAWNISESLMNFDDV-KFDTASLLAQLHLQTEPSSNAAKAMLRRAVELSQNNVYWHCKLLLQLSQIHASDREYSSASELLAVGADSAEEAGATYLKVLFLLSRAMILMIERKTNDVLALLNSAGQIIDNNIPNPHQKEYLKVFFLVLQVCYYLALGQVKTVKPSLKQLQMSIQTIMAPNWPSDDTIFGSNQLEMFVWLPKEQLYVLVYLVTVSHSMMAGYMDKAQKYTEKALTQIEKLKLQEDKPILSVFKVILLEHIVMCRMVMGNRELAIREIAAARDVCLAAPQRRSLLKRHSAQLHCLIGLYAMSTSFFDHAERQFLVCV------------------------------------SETTERDLK---------LFANLNLAIIYLRTKRETDLKQILDAVSTENTHTYSS-QALMGGFYYVQGLHAFHKNSFHEAKRFLRETLKMANAEDLNRLTSCSLVLLSHVFLSIGNS-----------KESMNMVTPAMQLASKIPDIHVQLWGSAILKDLHRMSKDAQHEKEAYANHVKYSENLIADQRKCVQSSHHELVNWFHGDPP 592          
BLAST of MAU2 chromatid cohesion factor vs. TrEMBL
Match: A0A4Z2D8B8 (MAU2 chromatid cohesion factor OS=Schistosoma japonicum OX=6182 GN=EWB00_003484 PE=4 SV=1)

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 345/642 (53.74%), Postives = 451/642 (70.25%), Query Frame = 2
Query:  326 YSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLL--DQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPEMCLSNDAAA 2242
            Y++LLGLAETFRTMSPPN+RL VHCLK+IL +KLP NLEART+L +G++L  +SKSD+Q KF+LEKAR LGAHLK  DD IKFEAA LL++ FE+KGKR E+ C+L DA+RLS ++PYWHCR+LL+L+ A++A++++  ACE+LAMGSE+A+ H SDYT GLFLLSKCMLLL+ R+ P+V  +LT A+ LI+   GT Y +EALR+F LV+ +S  LI G AKSA   L+QLH SIQQFAAM+E  ++  ++ID+F WMPREH+V+LVYLVTV Q+MQ+G++ RA R AEKAL QIEKL++ D+SPLL +   S+LEH+AM RLV G +  A  +IG   ++C   P    L+Y+R PQLH LIGLYAM+MN MN  E+QFK ALKL+   QQT     C   S  D N           ++ T+ST           SL V I LNLALVHIR+    +C+ LL+ + S  + VL  CYCL+AA  YV +FQAF E R  D+KS+LR  +R+ N E+L+RL+A+  +T+GQI +N  N+            E  ++I   I +ANR+PDIGIQLWATALLK +  L  DT EET+WF  H  FS+ VI++H  A    +H LI WL+GPLPE+  SN  A+
Sbjct:   85 YASLLGLAETFRTMSPPNMRLAVHCLKAILQFKLPVNLEARTHLQLGRLLFHYSKSDEQTKFHLEKARTLGAHLKADDDSIKFEAATLLAEFFERKGKRYEATCILNDAIRLSNNSPYWHCRILLELAQAHIAERDVNSACEILAMGSEYARLHNSDYTNGLFLLSKCMLLLASRQLPEVTVTLTTASRLIEQFKGTMYHREALRVFYLVLHVSFYLISGQAKSAHPILRQLHQSIQQFAAMDEADNASINEIDRFHWMPREHMVILVYLVTVMQSMQAGMLDRAKRSAEKALIQIEKLSVFDTSPLLTVFHLSLLEHTAMGRLVMGVQTAAAQDIGQACRICQANP---TLMYKRLPQLHTLIGLYAMSMNCMNQAENQFKYALKLIAGPQQTIG---CRSGS-GDKN----------LLSLTTSTRASCQPDGPRDSLSVLICLNLALVHIRKGNTTECEALLNEVFSCGAHVLEGCYCLRAAADYVRAFQAFYENRLLDAKSFLRETVRLGNEEELHRLSASAFITMGQIHLNEQNTS-----------EGHKMISAAIHIANRLPDIGIQLWATALLKGVANLRGDTQEETRWFTEHDRFSKIVIHEHMRAISAPEHSLIEWLDGPLPEIQSSNTVAS 698          
BLAST of MAU2 chromatid cohesion factor vs. TrEMBL
Match: H2KSU9 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_110380 PE=4 SV=1)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 339/638 (53.13%), Postives = 451/638 (70.69%), Query Frame = 2
Query:  326 YSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGG--SDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTS-STNDDLSNPH-QLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPEMCL 2224
            Y++LLGLAE FRT SPPN+RL VHCLK++LH+KLP NLEART+L +G++L  +SKSDDQ K++LEKAR LGAHL+  DD IKFEAA LL++ FE+KGKR E+ C+L DA+RLS +NPYWHCRLLL+L+ A+V ++++  ACE+L MGSEFA  H SDYT+GLFLLSKCMLLL+ R+ P+V  +LTV + +I+   G  Y KEALR+F LV+ +S  LI G AKSA+  L+QLH SIQQFAAMEE VS     ++ID+F WMPREH+V+LVYL+TV Q+MQ+G++ RA R AEKALTQIEKL + D+SPLL +   S+LEH+AM RLV G +  A  +IG   ++CH  P    L+Y+R PQLH LIGLYAM+MN MN  E+QFK AL+L+              R  T+  S   +AS+A++ T+ +TN     P      L V I LNLALVHIR+    +C+TLL+ + +    VL  CYCL+AA  YV +FQAFCE R  D+ ++LR  +R+ N E+L+RL+A+  +T+GQI++N  N+            E +++I   I +ANR+PDIGIQLWATALLK +  L  DT EET+WF  H  +S+ VI++H  A    +H+LI WL+GPL ++ L
Sbjct:   95 YASLLGLAEYFRTTSPPNMRLAVHCLKAVLHFKLPVNLEARTHLQLGRLLFHYSKSDDQTKYHLEKARTLGAHLRAKDDSIKFEAAALLAEFFERKGKRYEATCILNDAIRLSNNNPYWHCRLLLELAQAHVTERDVNSACEILQMGSEFAMMHNSDYTRGLFLLSKCMLLLASRQLPEVTTTLTVVSQMIEGFRGIGYHKEALRVFYLVLHVSFYLISGQAKSARPILRQLHQSIQQFAAMEE-VSDAAVTNEIDRFQWMPREHMVILVYLITVMQSMQTGMLERARRSAEKALTQIEKLYVFDTSPLLTVFHLSLLEHTAMGRLVMGVQTAAAQDIGQACRICHANP---ALMYKRLPQLHTLIGLYAMSMNCMNHAENQFKFALRLISS-----------PRVGTDLAS---MASNALSLTTPTTNRACCQPDGPRDPLSVLICLNLALVHIRKGNTKECETLLNEVFTSGVHVLEGCYCLRAAASYVRAFQAFCENRIPDAMTFLRETVRLGNEEELHRLSASAFITMGQIYLNERNTG-----------EGQKMISAAIHVANRLPDIGIQLWATALLKGVANLRGDTQEETRWFAEHDRYSKLVIHEHVRAISAPEHRLIEWLDGPLVDLHL 703          
BLAST of MAU2 chromatid cohesion factor vs. TrEMBL
Match: A0A3R7C5U6 (MAU2 chromatid cohesion factor-like protein OS=Clonorchis sinensis OX=79923 GN=MAU2 PE=4 SV=1)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 339/638 (53.13%), Postives = 451/638 (70.69%), Query Frame = 2
Query:  326 YSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGG--SDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTS-STNDDLSNPH-QLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPEMCL 2224
            Y++LLGLAE FRT SPPN+RL VHCLK++LH+KLP NLEART+L +G++L  +SKSDDQ K++LEKAR LGAHL+  DD IKFEAA LL++ FE+KGKR E+ C+L DA+RLS +NPYWHCRLLL+L+ A+V ++++  ACE+L MGSEFA  H SDYT+GLFLLSKCMLLL+ R+ P+V  +LTV + +I+   G  Y KEALR+F LV+ +S  LI G AKSA+  L+QLH SIQQFAAMEE VS     ++ID+F WMPREH+V+LVYL+TV Q+MQ+G++ RA R AEKALTQIEKL + D+SPLL +   S+LEH+AM RLV G +  A  +IG   ++CH  P    L+Y+R PQLH LIGLYAM+MN MN  E+QFK AL+L+              R  T+  S   +AS+A++ T+ +TN     P      L V I LNLALVHIR+    +C+TLL+ + +    VL  CYCL+AA  YV +FQAFCE R  D+ ++LR  +R+ N E+L+RL+A+  +T+GQI++N  N+            E +++I   I +ANR+PDIGIQLWATALLK +  L  DT EET+WF  H  +S+ VI++H  A    +H+LI WL+GPL ++ L
Sbjct:  181 YASLLGLAEYFRTTSPPNMRLAVHCLKAVLHFKLPVNLEARTHLQLGRLLFHYSKSDDQTKYHLEKARTLGAHLRAKDDSIKFEAAALLAEFFERKGKRYEATCILNDAIRLSNNNPYWHCRLLLELAQAHVTERDVNSACEILQMGSEFAMMHNSDYTRGLFLLSKCMLLLASRQLPEVTTTLTVVSQMIEGFRGIGYHKEALRVFYLVLHVSFYLISGQAKSARPILRQLHQSIQQFAAMEE-VSDAAVTNEIDRFQWMPREHMVILVYLITVMQSMQTGMLERARRSAEKALTQIEKLYVFDTSPLLTVFHLSLLEHTAMGRLVMGVQTAAAQDIGQACRICHANP---ALMYKRLPQLHTLIGLYAMSMNCMNHAENQFKFALRLISS-----------PRVGTDLAS---MASNALSLTTPTTNRACCQPDGPRDPLSVLICLNLALVHIRKGNTKECETLLNEVFTSGVHVLEGCYCLRAAASYVRAFQAFCENRIPDAMTFLRETVRLGNEEELHRLSASAFITMGQIYLNERNTG-----------EGQKMISAAIHVANRLPDIGIQLWATALLKGVANLRGDTQEETRWFAEHDRYSKLVIHEHVRAISAPEHRLIEWLDGPLVDLHL 789          
BLAST of MAU2 chromatid cohesion factor vs. TrEMBL
Match: A0A0X3PWP6 (MAU2 chromatid cohesion factor homolog (Fragment) OS=Schistocephalus solidus OX=70667 GN=SCC4 PE=4 SV=1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 336/636 (52.83%), Postives = 446/636 (70.13%), Query Frame = 2
Query:  326 YSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSN-----PHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPE 2215
            Y++LLGLAE FRT++PPNIRL +HCLKSIL +KLP N EART+L +GK+L +HSK+++QIKF+LEKAR LGAHL+ PDD+IKFEAADLL+D +E+KGKR E+ C+L DA+RLS +NPYW+CRLLLK + A++AD+++  ACE+LAMGSEFAQ H S+YT+GLFLLSKCMLLL+ R+ P+V N+LTVA  LI+ LNGT YQ+EALR+F L+I +S  L+ G AKSA   L+QLH SIQ F +MEED+SS   ++D+F WMPRE++V+L+YL++V Q MQSG++ RA   AEK LTQIEKL++ D++PLL +   S+LEH+ M RLV G K +A+ +IG   KL  + P    L+YRR PQLH LIGLYAM+MN MN  E+QFKLAL+ +                  +QP       +++A   ++  DL++     P    SL V I LNLALV+IR+     C+ LL+ + +    VL  CYCL+AA  YV  FQAF E R QD+K+ LR  +R+ N E+LNRL+ + L+TLGQI +N  N           + E+ + I   I  AN++PDIGIQLWATALLKD+  L  + +EE  WF  H  FS+ VI DH  A    +H+LI WLEG +P+
Sbjct:  145 YASLLGLAEYFRTINPPNIRLVIHCLKSILSFKLPVNYEARTHLQLGKVLFLHSKNEEQIKFHLEKARILGAHLRAPDDVIKFEAADLLADFYERKGKRYEATCILNDAMRLSNNNPYWNCRLLLKRAQAHMADRDVNSACELLAMGSEFAQLHSSEYTRGLFLLSKCMLLLASRQLPEVTNTLTVANRLIEKLNGTAYQREALRLFYLIIHVSLYLLAGQAKSAHPILRQLHQSIQLFMSMEEDLSS-TKEVDRFQWMPREYMVILIYLISVMQLMQSGMLERAQHSAEKGLTQIEKLSIFDNNPLLTVFHLSLLEHTVMGRLVMGAKTRAVQDIGHACKLSQSCP---ALMYRRLPQLHTLIGLYAMSMNCMNQAENQFKLALRYIAN----------------SQPGSNARPGTSLAFVGASTTDLASTLSGGPRD--SLSVLICLNLALVYIRKGDTTACELLLNEVFTAGLPVLEGCYCLRAAAAYVRGFQAFYENRLQDAKAALRETMRLGNEEELNRLSTSALITLGQINLNERN-----------IVEAHKQIGASITAANKLPDIGIQLWATALLKDVANLMMNPEEERLWFDEHDKFSKMVIYDHMKATASPEHRLIEWLEGQMPD 747          
BLAST of MAU2 chromatid cohesion factor vs. TrEMBL
Match: A0A0V0J9R9 (MAU2 chromatid cohesion factor homolog OS=Schistocephalus solidus OX=70667 GN=SCC4 PE=4 SV=1)

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 336/636 (52.83%), Postives = 446/636 (70.13%), Query Frame = 2
Query:  326 YSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSN-----PHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPE 2215
            Y++LLGLAE FRT++PPNIRL +HCLKSIL +KLP N EART+L +GK+L +HSK+++QIKF+LEKAR LGAHL+ PDD+IKFEAADLL+D +E+KGKR E+ C+L DA+RLS +NPYW+CRLLLK + A++AD+++  ACE+LAMGSEFAQ H S+YT+GLFLLSKCMLLL+ R+ P+V N+LTVA  LI+ LNGT YQ+EALR+F L+I +S  L+ G AKSA   L+QLH SIQ F +MEED+SS   ++D+F WMPRE++V+L+YL++V Q MQSG++ RA   AEK LTQIEKL++ D++PLL +   S+LEH+ M RLV G K +A+ +IG   KL  + P    L+YRR PQLH LIGLYAM+MN MN  E+QFKLAL+ +                  +QP       +++A   ++  DL++     P    SL V I LNLALV+IR+     C+ LL+ + +    VL  CYCL+AA  YV  FQAF E R QD+K+ LR  +R+ N E+LNRL+ + L+TLGQI +N  N           + E+ + I   I  AN++PDIGIQLWATALLKD+  L  + +EE  WF  H  FS+ VI DH  A    +H+LI WLEG +P+
Sbjct:   76 YASLLGLAEYFRTINPPNIRLVIHCLKSILSFKLPVNYEARTHLQLGKVLFLHSKNEEQIKFHLEKARILGAHLRAPDDVIKFEAADLLADFYERKGKRYEATCILNDAMRLSNNNPYWNCRLLLKRAQAHMADRDVNSACELLAMGSEFAQLHSSEYTRGLFLLSKCMLLLASRQLPEVTNTLTVANRLIEKLNGTAYQREALRLFYLIIHVSLYLLAGQAKSAHPILRQLHQSIQLFMSMEEDLSS-TKEVDRFQWMPREYMVILIYLISVMQLMQSGMLERAQHSAEKGLTQIEKLSIFDNNPLLTVFHLSLLEHTVMGRLVMGAKTRAVQDIGHACKLSQSCP---ALMYRRLPQLHTLIGLYAMSMNCMNQAENQFKLALRYIAN----------------SQPGSNARPGTSLAFVGASTTDLASTLSGGPRD--SLSVLICLNLALVYIRKGDTTACELLLNEVFTAGLPVLEGCYCLRAAAAYVRGFQAFYENRLQDAKAALRETMRLGNEEELNRLSTSALITLGQINLNERN-----------IVEAHKQIGASITAANKLPDIGIQLWATALLKDVANLMMNPEEERLWFDEHDKFSKMVIYDHMKATASPEHRLIEWLEGQMPD 678          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Cavefish
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:NCBI gene;Acc:103028532])

HSP 1 Score: 421.779 bits (1083), Expect = 9.484e-138
Identity = 253/635 (39.84%), Postives = 381/635 (60.00%), Query Frame = 2
Query:  314 PFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            P ++Y ALLG AE FRT SPP IRLCVHCL+++L +K    +EART+L +G +L  H+K+ D  + +LEKA  +   +   +D+ KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALLKD+ +   +T +  +  Q+H+ FSQ ++ DH AA    +H LI+W +GP P
Sbjct:    8 PESWYLALLGFAEHFRTSSPPKIRLCVHCLQAVLQFKPSQRVEARTHLQLGSVLYHHTKNSDLARSHLEKAWCISQQVPQFEDV-KFEAASLLSELYCQQNLVDSAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTSHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPDHNFPVSS-HCLRAAAFYIRGLLSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLKDLNKACGNTIDAHEAAQMHQNFSQQLLQDHIAACSLPEHNLISWTDGPPP 581          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Cavefish
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:NCBI gene;Acc:103028532])

HSP 1 Score: 389.808 bits (1000), Expect = 7.498e-126
Identity = 245/635 (38.58%), Postives = 364/635 (57.32%), Query Frame = 2
Query:  314 PFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            P ++Y ALLG AE FRT SPP IRLCVHCL+++L +K    +EART+L +G +L  H+K+ D  + +LEKA  +     P  + +KFEAA LLS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  LT+   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  FI+ NLA V+IR+ NR  +  +LL RI+ +                  H+F           + +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALLKD+ +   +T +  +  Q+H+ FSQ ++ DH AA    +H LI+W +GP P
Sbjct:    8 PESWYLALLGFAEHFRTSSPPKIRLCVHCLQAVLQFKPSQRVEARTHLQLGSVLYHHTKNSDLARSHLEKA--VRCSQVPQFEDVKFEAASLLSELYCQQNLVDSAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFSNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTSHQ---------------------------------------------ELWTFIVTNLASVYIREGNRHQELYSLLERINPD------------------HNFPV---------RRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLKDLNKACGNTIDAHEAAQMHQNFSQQLLQDHIAACSLPEHNLISWTDGPPP 554          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Sea Lamprey
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:ZFIN;Acc:ZDB-GENE-050522-383])

HSP 1 Score: 273.863 bits (699), Expect = 2.300e-84
Identity = 180/464 (38.79%), Postives = 272/464 (58.62%), Query Frame = 2
Query:  551 PPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVAD-CKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSN 1933
            P  + +KFEAA LL++L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ A ++L +G+E+A+   S+YT+ LFLLSK +LLL  R+  +V+  L++   L++   G P QKE+LRIF LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL QIEKL ++D+SP+L+  Q  +LEH  MCRLVTG+K  A+ EI    +LC  +P   RL      QLH L+GLY++++N M + E+QF  AL+L   Q                                              L  +I+ NLA V+IR+ NR  D   TLL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF +L N
Sbjct:    3 PSFEDVKFEAASLLAELYCQQNLVDSAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLISASDLLGVGAEYARVVGSEYTRVLFLLSKGLLLLMERKLQEVHPILSLCGTLVEGWQGNPIQKESLRIFFLVLQVTHYLDAGQMKSVKPCLKQLQQGIQTISTLHDDEILPTNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQIEKLKILDTSPILSSFQVMLLEHIIMCRLVTGHKALALQEISQACQLCQQSP---RLFSNHAAQLHTLLGLYSVSVNCMESAEAQFTTALRLTSHQ---------------------------------------------ELWTYIVTNLASVYIREGNRHQDQLYTLLERINPDHNFPVSS-HCLRAAAFYIRGLLSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYSLGN 417          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Nematostella
Match: EDO32521 (MAU2 chromatid cohesion factor homolog [Source:UniProtKB/Swiss-Prot;Acc:A7SUU7])

HSP 1 Score: 313.153 bits (801), Expect = 1.458e-96
Identity = 213/633 (33.65%), Postives = 329/633 (51.97%), Query Frame = 2
Query:  326 YSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLS--EHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTK-GXXXXXXXXXXXSIRRPDVN---NSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDI---DQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVK-LCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINW 2194
            Y+ L+GLAE FRT +PP IR C+ CL++IL +  P   +A+T+L IG+IL  ++K+DD  +  LEKA  + A L    + I FEA+ +LS +++ +G+   +  VL  AL ++  E+  +W  RL  +L+  +  D     + EVL MG   A+Q  S Y +  +     C++++ +   DVN   N L      ++   G  YQ+E+L +F L++++ Q+L  G AK+ +  LKQL  SIQ    M  +    G ++   ++F W+PREH+ VLVYLVTV  +M +G M + L+Y+ KAL Q+E+L +   S L+++ Q  +LEH+ MCR+V G    AI EI  V + L H       L+    P LH L+GLYAM+MN M    + F +A K  D                                    N  L+N         F+ LNL++++IR       +      S   S++    + LQA  +YV + +AF + R QD+K YLR  L++ N EDLNRLTA  L+ LG  F+   N            QE+  ++ P   L+ +IPD  IQLWA  LL+D+Y +     + ++ F  H + ++ +I +H  A K  +H L  W
Sbjct:   11 YAGLVGLAEGFRTSNPPRIRECIQCLQAILQFNPPPATQAKTHLQIGRILQQYTKNDDLARRTLEKA--VSAELGHGYEEISFEASSILSLVYKDQGQYPLAKQVLRQALEITSGENLYFWQFRLFFQLAEVHACDNEFTASVEVLEMGERIAEQCGSQYMRYNIRHSHNCIIIVLLIMKDVNRVSNILMSTGSFLERWQGQSYQRESLVVFHLLLRVWQLLSVGQAKTVRPYLKQLQQSIQNLTTMTFEGMQPGPNVYEAEKFEWLPREHLCVLVYLVTVMHSMYAGYMDKVLKYSAKALNQVERLKVTSPSALVSVFQLMLLEHTIMCRVVQGQPAHAIKEISQVYQTLKHENC----LVRAHKPILHTLLGLYAMSMNLMEQATTHFNIAFKTAD------------------------------------NPVLAN---------FVGLNLSIIYIRAGESKQIELSSVMSSIHPSNMATNSHSLQAGYYYVCALRAFFQTRIQDAKKYLRESLKIANAEDLNRLTACSLVLLGHTFLASGNP-----------QEALNMVLPATQLSGKIPDNYIQLWAAGLLRDLYGMLGQPVQASESFHKHHSITKQLIENHMQARKLPEHGLTEW 581          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Medaka
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:NCBI gene;Acc:101167356])

HSP 1 Score: 414.461 bits (1064), Expect = 5.251e-135
Identity = 247/635 (38.90%), Postives = 379/635 (59.69%), Query Frame = 2
Query:  314 PFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            P  +Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +  + +LE+A  +   +   +D+ KFEAA +LS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  L++   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  +I+ NLA V+IR+ NR  +  +LL RI+ + +  ++  +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALLKD+ +   +  +  +  Q+H+ FSQ ++ DH AA    +H LI+W +GP P
Sbjct:    8 PERWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPPQRIEARTHLQLGSVLYHHTKNSELARNHLEQAWFISQQVPQFEDV-KFEAASILSELYCQQNMVDSAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLGEVHPLLSLCGTIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSTFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFTNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTYIVTNLASVYIREGNRHQELYSLLERINPDHNFPVSS-HCLRAAAFYIRGLLSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLKDLNKALGNNMDAHEAAQMHQNFSQQLLQDHIAACSLPEHNLISWTDGPPP 581          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Medaka
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:NCBI gene;Acc:101167356])

HSP 1 Score: 382.489 bits (981), Expect = 4.932e-123
Identity = 228/634 (35.96%), Postives = 354/634 (55.84%), Query Frame = 2
Query:  314 PFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRRPDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQ-NRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            P  +Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +  + +LE+A  +   +   +D+ KFEAA +LS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+        ++   +   +V+  L++   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +P   RL      QLH L+GLY +++N M+  E+QF  AL+L   Q                                              L  +I+ NLA V+IR+ NR  +  +LL RI+ +                  H+F           + +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALLKD+ +   +  +  +  Q+H+ FSQ ++ DH AA    +H LI+W +GP P
Sbjct:    8 PERWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPPQRIEARTHLQLGSVLYHHTKNSELARNHLEQAWFISQQVPQFEDV-KFEAASILSELYCQQNMVDSAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRYSRGFLLLLMERKLG--EVHPLLSLCGTIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSTFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSP---RLFTNHAAQLHTLLGLYCISVNCMDNAEAQFTTALRLTTHQ---------------------------------------------ELWTYIVTNLASVYIREGNRHQELYSLLERINPD------------------HNFPV---------RRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLKDLNKALGNNMDAHEAAQMHQNFSQQLLQDHIAACSLPEHNLISWTDGPPP 552          
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Medaka
Match: mau2 (MAU2 sister chromatid cohesion factor [Source:NCBI gene;Acc:101167356])

HSP 1 Score: 271.552 bits (693), Expect = 3.372e-81
Identity = 154/352 (43.75%), Postives = 235/352 (66.76%), Query Frame = 2
Query:  314 PFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRR-PDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPR 1366
            P  +Y ALLG AE FRT SPP IRLCVHCL+++  +K P  +EART+L +G +L  H+K+ +  + +LE+A  +   +   +D+ KFEAA +LS+L+ ++     +  +L  A+++S+  PYWHCRLL +L+  +  +K+++ AC++L +G+E+A+   S+YT+ LFLLSK MLLL  R+  +V+  L++   +++N  G P QKE+LR+F LV+Q++  L  G  KS K  LKQL   IQ  + + +D     +  D F W+P+EH+ VLVYLVTV  +MQ+G + +A +Y +KAL Q+EKL ++D SP+L+  Q  +LEH  MCRLVTG+K  A+ EI  V +LC  +PR
Sbjct:    8 PERWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFQFKPPQRIEARTHLQLGSVLYHHTKNSELARNHLEQAWFISQQVPQFEDV-KFEAASILSELYCQQNMVDSAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGSEYTRALFLLSKGMLLLMERKLGEVHPLLSLCGTIVENWQGNPIQKESLRVFFLVLQVTHYLDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSTFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSPR 358          

HSP 2 Score: 127.102 bits (318), Expect = 2.847e-30
Identity = 62/153 (40.52%), Postives = 95/153 (62.09%), Query Frame = 2
Query: 1754 YCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLP 2212
            +CL+AA FY+    +F + RY ++K +LR  L+M+N EDLNRLTA  L+ LG IF  L N            +ES  ++ P + LA++IPD+ +QLW++ALLKD+ +   +  +  +  Q+H+ FSQ ++ DH AA    +H LI+W +GP P
Sbjct:  390 HCLRAAAFYIRGLLSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNH-----------RESNNMVVPAMQLASKIPDMSVQLWSSALLKDLNKALGNNMDAHEAAQMHQNFSQQLLQDHIAACSLPEHNLISWTDGPPP 531          
BLAST of MAU2 chromatid cohesion factor vs. Planmine SMEST
Match: SMESG000008077.1 (SMESG000008077.1)

HSP 1 Score: 1374.38 bits (3556), Expect = 0.000e+0
Identity = 724/729 (99.31%), Postives = 724/729 (99.31%), Query Frame = 2
Query:   71 MNNSGTSNYNSRFYXXXXXXXXXXXXXXXVTDVSNNLSHSNSVANYQPQWGSVKVSSESLQFYGQHXXXXXXXXXXXXXXXPFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGXXXXXXXXXXXSIRRPDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHXXXXXXXXXXQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPEMCLSNDAAARLLPP 2257
            MNNSGTSNYNSRFYQSTSHLSNTNLSNQLVTDVSNNLSHSNSVANYQPQWGSVKVSSESLQFYGQHNIESIMQQSNNQQISPFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGLFLLSKCMLLLSIRRPDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHVVVLVYLVTVQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQP QPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLI    ESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPEMCLSNDAAARLLPP
Sbjct:    1 MNNSGTSNYNSRFYQSTSHLSNTNLSNQLVTDVSNNLSHSNSVANYQPQWGSVKVSSESLQFYGQHNIESIMQQSNNQQISPFAYYSALLGLAETFRTMSPPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLEKARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEHNPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGLFLLSKCMLLLSIRRPDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQILIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHVVVLVYLVTVQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVLEHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGLYAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPPQPDVASSAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRISSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLEDLNRLTAAGLMTLGQIFMNLSNSDVNSPVLI----ESKEIIQPVIPLANRIPDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKHSDHQLINWLEGPLPEMCLSNDAAARLLPP 725          
The following BLAST results are available for this feature:
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MAU23.727e-13539.59MAU2 sister chromatid cohesion factor [Source:HGNC... [more]
MAU22.024e-4744.87MAU2 sister chromatid cohesion factor [Source:HGNC... [more]
MAU23.111e-3438.28MAU2 sister chromatid cohesion factor [Source:HGNC... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mau-23.009e-919.71Maternal uncoordinated protein 2 [Source:UniProtK... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mau25.697e-11435.57gene:FBgn0038300 transcript:FBtr0083048[more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mau22.111e-9443.80MAU2 sister chromatid cohesion factor [Source:ZFIN... [more]
mau28.596e-8137.17MAU2 sister chromatid cohesion factor [Source:ZFIN... [more]
mau23.878e-7938.84MAU2 sister chromatid cohesion factor [Source:ZFIN... [more]
mau21.127e-1557.41MAU2 sister chromatid cohesion factor [Source:ZFIN... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mau25.112e-13239.02MAU2, sister chromatid cohesion factor [Source:NCB... [more]
mau25.443e-13239.02MAU2, sister chromatid cohesion factor [Source:NCB... [more]
mau22.041e-13138.46MAU2, sister chromatid cohesion factor [Source:NCB... [more]
mau21.123e-12036.55MAU2, sister chromatid cohesion factor [Source:NCB... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mau26.477e-13739.65MAU2 sister chromatid cohesion factor [Source:MGI ... [more]
Mau23.133e-13539.75MAU2 sister chromatid cohesion factor [Source:MGI ... [more]
Mau23.167e-13539.59MAU2 sister chromatid cohesion factor [Source:MGI ... [more]
Mau23.012e-13039.39MAU2 sister chromatid cohesion factor [Source:MGI ... [more]
Mau28.033e-9644.27MAU2 sister chromatid cohesion factor [Source:MGI ... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y6X3|SCC4_HUMAN1.790e-13439.59MAU2 chromatid cohesion factor homolog OS=Homo sap... [more]
sp|Q9D2X5|SCC4_MOUSE2.215e-13439.59MAU2 chromatid cohesion factor homolog OS=Mus musc... [more]
sp|B4ZIX8|SCC4_XENLA6.779e-13339.02MAU2 chromatid cohesion factor homolog OS=Xenopus ... [more]
sp|B1H1Z8|SCC4_XENTR2.565e-13239.02MAU2 chromatid cohesion factor homolog OS=Xenopus ... [more]
sp|B4NKT1|SCC4_DROWI3.408e-11536.32MAU2 chromatid cohesion factor homolog OS=Drosophi... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D8B80.000e+053.74MAU2 chromatid cohesion factor OS=Schistosoma japo... [more]
H2KSU90.000e+053.13Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A3R7C5U60.000e+053.13MAU2 chromatid cohesion factor-like protein OS=Clo... [more]
A0A0X3PWP60.000e+052.83MAU2 chromatid cohesion factor homolog (Fragment) ... [more]
A0A0V0J9R90.000e+052.83MAU2 chromatid cohesion factor homolog OS=Schistoc... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mau29.484e-13839.84MAU2 sister chromatid cohesion factor [Source:NCBI... [more]
mau27.498e-12638.58MAU2 sister chromatid cohesion factor [Source:NCBI... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mau22.300e-8438.79MAU2 sister chromatid cohesion factor [Source:ZFIN... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO325211.458e-9633.65MAU2 chromatid cohesion factor homolog [Source:Un... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mau25.251e-13538.90MAU2 sister chromatid cohesion factor [Source:NCBI... [more]
mau24.932e-12335.96MAU2 sister chromatid cohesion factor [Source:NCBI... [more]
mau23.372e-8143.75MAU2 sister chromatid cohesion factor [Source:NCBI... [more]
back to top
BLAST of MAU2 chromatid cohesion factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008077.10.000e+099.31SMESG000008077.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013477 ID=SMED30013477|Name=MAU2 chromatid cohesion factor|organism=Schmidtea mediterranea sexual|type=transcript|length=2434bp
AAAAATCTATATGTAAATAATTATAAAATTTAATTAAATATATTATAATT
TGATAGCATTTGAATAAATAATGAATAATTCTGGAACAAGTAATTACAAT
TCTCGATTTTATCAATCGACAAGTCATCTAAGTAATACTAATTTATCAAA
TCAATTGGTAACCGATGTTAGCAACAATTTGTCCCATAGTAATAGCGTTG
CTAATTATCAACCTCAGTGGGGGTCGGTTAAAGTATCTAGTGAAAGTCTG
CAATTTTATGGTCAGCATAATATTGAATCTATTATGCAACAATCAAACAA
TCAACAAATTTCACCATTCGCATATTATAGCGCATTGTTGGGCCTTGCAG
AAACTTTTCGAACAATGAGCCCTCCAAATATTCGTCTCTGTGTGCATTGC
TTGAAATCGATATTGCATTACAAACTTCCTGGTAATTTAGAAGCCCGAAC
CTATTTACACATTGGAAAAATCCTATTGATTCATAGTAAAAGTGATGATC
AAATCAAATTTTATTTGGAAAAAGCTCGTGCCCTAGGAGCTCATTTAAAA
CCTCCTGATGACATAATTAAATTTGAAGCTGCTGATTTATTGTCTGATCT
ATTTGAGAAAAAAGGAAAACGCAGTGAATCCATTTGTGTATTAATGGATG
CTCTAAGATTGTCTGAACACAATCCTTATTGGCATTGTAGATTATTATTA
AAACTATCAAGTGCTTATGTTGCTGATAAAAATATTTTAGGAGCATGTGA
AGTTTTAGCAATGGGATCAGAGTTTGCTCAGCAACATCAATCAGATTACA
CGAAAGGATTATTTTTACTAAGTAAATGCATGCTATTATTATCAATAAGA
CGCCCGGATGTTAATAATAGCCTGACAGTTGCTACACATTTAATTGATAA
TCTCAATGGAACTCCATATCAGAAAGAAGCTTTGAGAATCTTTCAATTAG
TTATACAAATTAGTCAAATTTTGATTGGTGGTGGAGCAAAATCTGCTAAA
CTCCAGCTAAAGCAACTACATACTAGTATTCAACAATTTGCTGCAATGGA
AGAAGATGTAAGCAGTGGTGGAAGTGATATAGATCAATTTCTATGGATGC
CCCGTGAACATGTTGTAGTACTTGTTTATTTAGTCACAGTTCAGCAAGCT
ATGCAAAGTGGACTTATGGCTAGAGCCCTTCGTTATGCCGAGAAAGCACT
TACTCAAATTGAAAAGTTAGCATTGATTGATTCTAGTCCACTCCTTGCGA
TTTTGCAATTTTCGGTACTTGAACATAGTGCCATGTGCCGTTTAGTAACT
GGCAATAAATTGCAAGCTATCACGGAAATCGGAGTCGTTGTTAAACTGTG
TCATAATGCTCCAAGGGGAATGCGATTACTTTATCGAAGGGGCCCACAAT
TGCATGCCCTTATTGGGCTGTATGCAATGGCAATGAATGCCATGAATGCT
GGAGAAAGTCAATTCAAATTGGCATTAAAGTTACTTGATCAACAAACAAG
AGCTCCACATCGCTGCAACCAGCCGTCGCGATCAGACACAAATCAACCCT
CTCAACCCGATGTCGCCAGTAGCGCAATAGCTCAAACCTCATCGACAAAT
GATGACCTGTCCAATCCACATCAATTGACGAGCCTTCACGTCTTCATAAT
GCTTAATCTCGCACTAGTCCATATCCGGCAGAACCGAGTAGCCGACTGCA
AAACCCTTCTACATCGAATCAGCAGCGAGGCATCTTCAGTTCTCAATCAA
TGCTACTGTTTACAGGCTGCCAATTTCTATGTCCACAGTTTTCAGGCGTT
TTGTGAACGCCGCTACCAGGACAGCAAGTCCTATCTTCGGGCGGTTCTTC
GAATGACAAATCTCGAGGACCTCAATCGATTGACTGCCGCCGGATTGATG
ACGTTGGGCCAGATATTTATGAACCTCAGCAACAGCGATGTCAATTCTCC
AGTGCTCATAGATTCACTCCAGGAAAGCAAAGAGATCATCCAGCCCGTCA
TTCCATTGGCCAATCGAATTCCCGATATCGGCATCCAATTATGGGCCACT
GCGTTACTGAAGGACATGTACCAGTTGTACCAGGATACTGACGAGGAAAC
TAAATGGTTCCAACTCCACAAGGCGTTCTCCCAGGCGGTAATCAATGATC
ACACCGCTGCCGGGAAACATTCGGATCACCAATTGATCAATTGGCTGGAA
GGCCCTTTGCCAGAAATGTGCTTGTCAAATGATGCTGCAGCCCGGTTGCT
CCCTCCATAATCGATTTCCCATGCTTCCTTTTTATATTTGATTCTGTATT
TATTCGTCTCAATCACACAGAGAGAGAGAGAGAGCCGAGTGGACTTGTAC
AGATTTTGTATTTATTTTCATAATTTATCTATCTGTGATCATCTTATGTA
ATATAAAATATATTATTCGCATGTCTTTTTTATG
back to top

protein sequence of SMED30013477-orf-1

>SMED30013477-orf-1 ID=SMED30013477-orf-1|Name=SMED30013477-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=730bp
MNNSGTSNYNSRFYQSTSHLSNTNLSNQLVTDVSNNLSHSNSVANYQPQW
GSVKVSSESLQFYGQHNIESIMQQSNNQQISPFAYYSALLGLAETFRTMS
PPNIRLCVHCLKSILHYKLPGNLEARTYLHIGKILLIHSKSDDQIKFYLE
KARALGAHLKPPDDIIKFEAADLLSDLFEKKGKRSESICVLMDALRLSEH
NPYWHCRLLLKLSSAYVADKNILGACEVLAMGSEFAQQHQSDYTKGLFLL
SKCMLLLSIRRPDVNNSLTVATHLIDNLNGTPYQKEALRIFQLVIQISQI
LIGGGAKSAKLQLKQLHTSIQQFAAMEEDVSSGGSDIDQFLWMPREHVVV
LVYLVTVQQAMQSGLMARALRYAEKALTQIEKLALIDSSPLLAILQFSVL
EHSAMCRLVTGNKLQAITEIGVVVKLCHNAPRGMRLLYRRGPQLHALIGL
YAMAMNAMNAGESQFKLALKLLDQQTRAPHRCNQPSRSDTNQPSQPDVAS
SAIAQTSSTNDDLSNPHQLTSLHVFIMLNLALVHIRQNRVADCKTLLHRI
SSEASSVLNQCYCLQAANFYVHSFQAFCERRYQDSKSYLRAVLRMTNLED
LNRLTAAGLMTLGQIFMNLSNSDVNSPVLIDSLQESKEIIQPVIPLANRI
PDIGIQLWATALLKDMYQLYQDTDEETKWFQLHKAFSQAVINDHTAAGKH
SDHQLINWLEGPLPEMCLSNDAAARLLPP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000103central nervous system
Vocabulary: INTERPRO
TermDefinition
IPR019440MAU2
Vocabulary: biological process
TermDefinition
GO:0007064mitotic sister chromatid cohesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019440Chromatid cohesion factor MAU2PFAMPF10345Cohesin_loadcoord: 85..688
e-value: 1.6E-56
score: 192.0
IPR019440Chromatid cohesion factor MAU2PANTHERPTHR21394UNCHARACTERIZEDcoord: 70..708
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 478..513