SWI:SNF matrix associated

Overview
NameSWI:SNF matrix associated
Smed IDSMED30013475
Length (bp)3208
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SWI:SNF matrix associated (SMED30013475) t-SNE clustered cells

Violin plots show distribution of expression levels for SWI:SNF matrix associated (SMED30013475) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SWI:SNF matrix associated (SMED30013475) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SWI:SNF matrix associated (SMED30013475) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013475

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013475SMESG000013560.1 SmedASXL_013017SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013475SMESG000013560.1 SmedASXL_013017SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30013475SMESG000013560.1 dd_Smed_v4_3355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013475SMESG000013560.1 dd_Smed_v4_3355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013475SMESG000013560.1 dd_Smed_v4_3355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013475SMESG000013560.1 dd_Smed_v4_3355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013475SMESG000013560.1 dd_Smed_v4_3355_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013475SMESG000013560.1 Contig49344uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013475SMESG000013560.1 Contig49344newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SWI:SNF matrix associated vs. Ensembl Human
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 1272.69 bits (3292), Expect = 0.000e+0
Identity = 636/883 (72.03%), Postives = 759/883 (85.96%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            S+GD+RH +TEQEE+E+LLTE+ +   +  RFE SP +V  G++RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW++EF RWVP+++ +CLIGD+E R+  +R+ +LP +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELW+LLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH VL+PFLLRRIKADVEK LPPKKE+KIY+GLS +QRE YT+ILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPHDERQ SI+ YN+P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQTKTVRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+Q  N++GK+E+L MI++GA ++F SK+++I DEDID +L RG +KTAEMN+KL ++GES+LR    D +     SVYNFEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P A   + EEQ KI EAESL + E+ E+E+LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK+NVYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE
Sbjct:  137 SVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTES----SVYNFEGEDYREK--QKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVPR-NPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERE 1011          
BLAST of SWI:SNF matrix associated vs. Ensembl Human
Match: SMARCA1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:HGNC Symbol;Acc:HGNC:11097])

HSP 1 Score: 1259.97 bits (3259), Expect = 0.000e+0
Identity = 647/985 (65.69%), Postives = 794/985 (80.61%), Query Frame = 2
Query:  116 MEP-VKEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKF-----------SSSSIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSK-------------GGNHAPESSGGQLVSK 2974
            M+P  +E ++ D+ K  E +L + E F+       +   T+P   K            S  S GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ER+ +I+ +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F SK++++ DEDI  +L RGE+KTAEMN++L ++GES+LR  + D ++    S+Y FEGEDYREK   K  M  WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   L + EEQ KI  AE LT  E  E+E+LL QGFT WTKRDF QFIKANEKYGRDDI++I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGT+KGKNYTEEEDRFLICMLHK+GFD++NVY+ LR  VR APQFRFDWFI+SRTA+E QRRC+TLI+LIE+E  ++EE+ R  K                 A ESSG + V K
Sbjct:   79 MDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLGRPRIKKDEKQSLISAGDYRHRRTEQEEDEELLSESRKTSNVCIRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVSNSGKMVVLDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREEAIEAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFASKESELTDEDITTILERGEKKTAEMNERLQKMGESSLRNFRMDIEQ----SLYKFEGEDYREK--QKLGMVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPDIPNPALAQREEQKKIDGAEPLTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEKKKRATKTPMSQKRKAESATESSGKKDVKK 1055          
BLAST of SWI:SNF matrix associated vs. Ensembl Human
Match: SMARCA1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:HGNC Symbol;Acc:HGNC:11097])

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 647/997 (64.89%), Postives = 794/997 (79.64%), Query Frame = 2
Query:  116 MEP-VKEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKF-----------SSSSIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQI------------SIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSK-------------GGNHAPESSGGQLVSK 2974
            M+P  +E ++ D+ K  E +L + E F+       +   T+P   K            S  S GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ER+             +I+ +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F SK++++ DEDI  +L RGE+KTAEMN++L ++GES+LR  + D ++S    +Y FEGEDYREK   K  M  WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   L + EEQ KI  AE LT  E  E+E+LL QGFT WTKRDF QFIKANEKYGRDDI++I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGT+KGKNYTEEEDRFLICMLHK+GFD++NVY+ LR  VR APQFRFDWFI+SRTA+E QRRC+TLI+LIE+E  ++EE+ R  K                 A ESSG + V K
Sbjct:   79 MDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLGRPRIKKDEKQSLISAGDYRHRRTEQEEDEELLSESRKTSNVCIRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVSNSGKMVVLDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREDKFLEVEFLGQREAIEAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFASKESELTDEDITTILERGEKKTAEMNERLQKMGESSLRNFRMDIEQS----LYKFEGEDYREK--QKLGMVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPDIPNPALAQREEQKKIDGAEPLTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEKKKRATKTPMSQKRKAESATESSGKKDVKK 1067          
BLAST of SWI:SNF matrix associated vs. Ensembl Human
Match: SMARCA1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:HGNC Symbol;Acc:HGNC:11097])

HSP 1 Score: 1248.8 bits (3230), Expect = 0.000e+0
Identity = 640/968 (66.12%), Postives = 786/968 (81.20%), Query Frame = 2
Query:  116 MEP-VKEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKF-----------SSSSIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQI------------SIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSK 2926
            M+P  +E ++ D+ K  E +L + E F+       +   T+P   K            S  S GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ER+             +I+ +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F SK++++ DEDI  +L RGE+KTAEMN++L ++GES+LR  + D ++S    +Y FEGEDYREK   K  M  WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   L + EEQ KI  AE LT  E  E+E+LL QGFT WTKRDF QFIKANEKYGRDDI++I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGT+KGKNYTEEEDRFLICMLHK+GFD++NVY+ LR  VR APQFRFDWFI+SRTA+E QRRC+TLI+LIE+E  ++EE+ R  K
Sbjct:   79 MDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLGRPRIKKDEKQSLISAGDYRHRRTEQEEDEELLSESRKTSNVCIRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVSNSGKMVVLDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREDKFLEVEFLGQREAIEAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFASKESELTDEDITTILERGEKKTAEMNERLQKMGESSLRNFRMDIEQS----LYKFEGEDYREK--QKLGMVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPDIPNPALAQREEQKKIDGAEPLTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEK 1038          
BLAST of SWI:SNF matrix associated vs. Ensembl Human
Match: CHD2 (chromodomain helicase DNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:1917])

HSP 1 Score: 453.366 bits (1165), Expect = 2.038e-142
Identity = 253/578 (43.77%), Postives = 359/578 (62.11%), Query Frame = 2
Query:  338 FEQSPYFV--------IGGE---MRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRV-----IREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTD--------YHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQ----GRLVEQKN------NQLGKNEILDMIKYGANYIFR---SKDTDIRDEDIDVLLARGEQKTAEMN-KKLDELGESNLRQLKFDN 1957
             +Q P FV        +GGE   +RDYQ+ GLNWL   +  + + ILADEMGLGKT+QTIS + YL H   L GP LI+ P STL +W  EF  W P +  +  IGD  +R+ +     I  Q     ++ ++T+YE+ +K+K+ L   N+ +L +DEAHR+KN+ S L + +  FKS +RLLITGTPLQN+L ELW+LL+F+MPE F    +F++         E   Q LH VL+PFLLRR+K DVEK LP K E  + + +S LQ++ Y  IL ++   +   G +      LNI+M+L+KC NH YL       PP   +          L+ + GK++LLDKLL +L+E+G+R+L+FSQM RMLDIL +Y   + Y + RLDGS   + R+ ++D +N  GS+ F F+LSTRAGGLGINLA+AD V+++DSDWNPQ DLQAQ RAHRIGQ K V ++RL+T+ TVEE II RA+ K+ LD++VIQ+    GR + + N      N   K E+  ++K+GA  +F+    ++++ ++ DID +L   E +  E++    DEL    L Q K  N
Sbjct:  252 LKQRPRFVALKKQPAYLGGENLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEINVVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHGKG---RENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKAL-AKGTRGSTSGFLNIVMELKKCCNHCYLIK-----PPEENERENGQEILLSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTILENNSGRSNSNPFNKEELTAILKFGAEDLFKELEGEESEPQEMDIDEILRLAETRENEVSTSATDEL----LSQFKVAN 816          
BLAST of SWI:SNF matrix associated vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 1142.87 bits (2955), Expect = 0.000e+0
Identity = 585/970 (60.31%), Postives = 739/970 (76.19%), Query Frame = 2
Query:  146 DKKKTIECILSKAEQFS--------KLKDGGTTPSKNKFSSSSI----GDHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEET-LVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDG----WIQPPKRERKANYAVDQYFKDALRI-NEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATP-EAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQLVSKNSGSHTSK 2998
            D  K  E +L K E FS        KL  G    +K +   S      GDHRH KTEQEE+E+++ +  +   +  F++SP+++  GEMRDYQ+RGLNWL  L  +  NGILADEMGLGKTLQTISMIGY+KHY+N   PHL+I PKSTLQNW NEF +W PS+  + LIGD+  R++V+R+ ILPQ +DV  T+YEM +K K+ LKK N+ Y+ IDEAHRIKNEKSKLSE VR   S+NRLLITGTPLQNNLHELWALLNFL+P++F SS +FD  F+ +++   T LVQRLH VL+PFLLRRIK+DVEK L PKKE+K+Y+GLS +QRE YTK+LMKDID++NGAG K +K RL+NILM LRKC NHPYLFDG EPGPP+TTD HLV+N GKMV+LDKLL K KEQGSR+L+FSQ +RMLD+LED+C WR Y+YCRLDGSTPH++R  +I+ YN P SKKF+FML+TRAGGLGINLATADVVI+YDSDWNPQ DLQA DRAHRIGQ K VRVFRLITENTV+ERII +AE KL+LDNIVIQQGR+ E +   LGK +++ MI++GA  +F +KD+ I D+DID +L + E KTAE+N+K+ ++ E+NLR + F+++    ++VY FEGE+Y+ K       DG    WI+PPKRERKANY VD Y+K+A+R  N  +       PK P V DFQF+P RLFELLDKEIY +RK+IGYV  +     P EAE  + EEQ  I  A  LT+ E  E+ ELL Q  T WTKR+FQQF++ NEKYGR+D+ESI+ ++E +  EE++ Y++VFW R  ELQD EK LSQIE+GEA+IQR+ A+K+ALD K+A+Y+APF QLRI YGTNKGK YTEEEDRFL+C  H+LG DK+NV++ LR +VR+APQFRFDWF++SRTA+ELQRRC+TLITLIERE+ ++ E S+         + S  + +SK+SG+ T+K
Sbjct:   44 DSFKRFERLLQKTENFSHCLSSGDAKLATGAPVDTKKRGRPSKKNGIDGDHRHRKTEQEEDEEMVADAIKSDDLVIFDKSPFYIENGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDVILPQKFDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWFSNDAMSGNTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVLMKDIDIINGAG-KVEKARLMNILMHLRKCVNHPYLFDGAEPGPPFTTDQHLVDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQGRMSEAQKT-LGKGDMISMIRHGAEQVFAAKDSTISDDDIDTILEKAEVKTAELNEKMGKIDENNLRNMTFEDN--AKFTVYQFEGENYKAKQA-----DGMGHFWIEPPKRERKANYQVDLYYKEAMRAGNPTEKQSKAPRPKLPQVFDFQFYPRRLFELLDKEIYHYRKTIGYVAERPKDVPPKEAEKRQAEEQKLINNARPLTDKEQEEKAELLTQSVTDWTKREFQQFVRGNEKYGREDLESIAKEME-RPLEEIQSYAKVFWERIEELQDSEKVLSQIEKGEARIQRKYAVKKALDAKIAKYKAPFQQLRISYGTNKGKTYTEEEDRFLVCETHRLGHDKENVFEELRQSVRMAPQFRFDWFLKSRTAMELQRRCNTLITLIEREMGEVVE-SKPVIVTAADKKKSVAKDLSKSSGTPTAK 1002          
BLAST of SWI:SNF matrix associated vs. Ensembl Celegans
Match: swsn-4 (SWI/SNF nucleosome remodeling complex component; SWI2/SNF2-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF53])

HSP 1 Score: 453.751 bits (1166), Expect = 1.809e-138
Identity = 247/526 (46.96%), Postives = 337/526 (64.07%), Query Frame = 2
Query:  374 MRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTF-KSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN-----------INSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELY---TKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPY------TTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQK 1888
            ++ YQI+GL W++ LY ++ NGILADEMGLGKT+QTIS++ YL   +   GP+L+I P STL NW NEF +W PSV  I   G ++ R RV   QI    ++V++T+YE  IKEK+ L K  + Y+ IDE HR+KN   KL+ ++  F  +Q+RLL+TGTPLQN L ELWALLNFL+P +F+S   F+  FN           +N  E   +++RLH VL+PFLLRR+K +VE +LP K E  I    S LQ+ +Y    K L+ D  + +GA        L+N ++ LRK  NHP+LF  IE                L+   GK+ LLD++L KLK  G RIL+F QMT M++I ED+  +R+Y Y RLDGST  DER   + ++N P S  FLFMLSTRAGGLG+NL TAD VI++DSDWNP  D+QAQDRAHRIGQ K VRV RLIT N+VEE+I+A A  KL +D  VIQ G+  +Q++    + ++L+ I   A+     ++    DE ++ ++AR E++
Sbjct:  533 LKPYQIKGLEWMVSLYNNNLNGILADEMGLGKTIQTISLVTYLMEVKQNNGPYLVIVPLSTLSNWQNEFAKWAPSVTTIIYKGTKDARRRV-EGQIRKGAFNVLMTTYEYVIKEKALLGKIRWKYMIIDEGHRLKNHNCKLTLMLNGFFHAQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPFATTGEKVELNQEETMLIIRRLHKVLRPFLLRRLKKEVESQLPDKTEYVIKCDQSALQKVIYRHMQKGLLLDAKMSSGARS------LMNTVVHLRKLCNHPFLFPNIEDSCRAYWKVNEVNGTDLMRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGSTKPDERGDLLTQFNAPNSDLFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKKEVRVLRLITANSVEEKILAAARYKLNVDEKVIQAGKF-DQRSTGAERKQMLEQI-IQADGEEEEEEEVPDDETVNQMVARSEEE 1049          
BLAST of SWI:SNF matrix associated vs. Ensembl Celegans
Match: pqn-15 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:P91094])

HSP 1 Score: 447.203 bits (1149), Expect = 2.280e-133
Identity = 251/561 (44.74%), Postives = 356/561 (63.46%), Query Frame = 2
Query:  353 YFVIGG-----EMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN---------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPG------PPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDES 1966
            +F++GG     +++ YQI+GL W++ L+ ++ NGILADEMGLGKT+QTI+ I YL   +   GP L+I P ST+ NW NEF +W  +V  I   G +ETR +V    I    ++V++T++E  I+EK+ L K  + Y+ IDE HR+KN+  KL+E++ T F+ Q RLLITGTPLQN L ELWALLNFL+P +F+S + F+  FN         +   +EET+  ++RLH VL+PFLLRR+K +VE  LP K E  +   +S LQ+ LY K + K + L++G      K  L N ++ LRK  NHP+LF+ +E          + +   L    GK+ LL ++L KL+  G R+L+F QMT M+ I+ED+       Y RLDGST  DER   +D++N P S+ FLFMLSTRAGGLG+NL TAD VI++DSDWNP  D+QAQDRAHRIGQ   VRVFRLIT N+VEE+I+A A  KL +D  VIQ G+  + ++    + EIL+ I           +    DEDI+ +L+R E++  E+ +K+D        Q +F+N+++
Sbjct: 1189 HFMMGGGNPSLKLKPYQIKGLEWMVSLFNNNLNGILADEMGLGKTIQTIAFITYLMEIKKTSGPFLVIVPLSTVPNWQNEFDKWAANVHLIAYKGPKETR-KVFEPIIKSGKFNVLLTTFEYVIREKALLGKLRWKYMIIDEGHRLKNQHCKLTEMLNTRFQCQRRLLITGTPLQNKLPELWALLNFLLPSIFSSCSTFEQWFNAPFATTGEKVELTQEETMLIIRRLHKVLRPFLLRRLKKEVESELPDKMEFVVRCDMSALQKVLY-KHMQKGL-LLDGKTNTGSKS-LRNTMIHLRKLCNHPFLFENVEESCRNFWDARFISAVDLYRVSGKLELLSRILPKLQATGHRVLMFFQMTSMMTIVEDFLAGGTIQYLRLDGSTKPDERGALLDKFNAPNSEYFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKAEVRVFRLITANSVEEKILAAARYKLNVDEKVIQAGKF-DNRSTGAERREILENI-IKTENESEEDEEVPNDEDINDILSRSEEE-FELFQKMD--------QERFENEQA 1734          
BLAST of SWI:SNF matrix associated vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 432.565 bits (1111), Expect = 9.887e-131
Identity = 241/552 (43.66%), Postives = 349/552 (63.22%), Query Frame = 2
Query:  335 RFEQSPYFV-IGGE----MRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDW----------DVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDI-DLVNGAGGKSDKVRLLNILMQLRKCTNHPYL---FDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQ----GRLVEQKNNQ------LGKNEILDMIKYGANYIFRSKDTDIRDE--DIDVLLARGEQKTAE 1897
            +FE  P F+   GE    +RDYQ+ GLNW++  +    + ILADEMGLGKT+Q+IS++  L H  +L GP+L++ P ST+  W  EF +W P +  +  +GD      V R+ I   +W          + I+T+YE+ +K+K+ L   ++  L +DEAHR+KN++S L + +  F+  ++LLITGTPLQN+L ELWALL+F+MPE F     F+   N ++      +  LH  L+PFLLRR+K DVEK LPPK E  + + ++  Q++ Y  IL K+  +L  G  G  +    +N++M+L+KC NH  L   +D I           L+++ GK++LLDKLL +LK++G R+L+FSQM  MLDIL++Y   R++   RLDGS   D R+ ++D YN PGS  F F+LSTRAGGLGINLATAD VI++DSDWNPQ DLQA  RAHRIGQTKTV ++RL+T+ +VEE I+ RA+ KL LD++VIQ+    G+ V  KN          K E+  ++K+GA  +F+ K+ + ++   DID +L   E + AE
Sbjct:  387 KFESMPDFLKTDGESTHKLRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFHRYDLAGPYLVVVPLSTMAAWQKEFAQWAPEMNLVVYMGDV-----VSRDMIRQYEWFVGGTKKMKINAILTTYEILLKDKAFLSSIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDCWEEFETAHNESN---HKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKWILTKNYRELSKGVKGSING--FVNLVMELKKCCNHASLTRQYDHIYDDAQGRLQ-QLLKSSGKLILLDKLLCRLKDKGHRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKLVLDHLVIQRMDTTGKTVLSKNATASGSVPFDKQELSAILKFGAVELFKEKEGEEQEPEVDIDRILMGAETREAE 927          
BLAST of SWI:SNF matrix associated vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 422.55 bits (1085), Expect = 9.748e-126
Identity = 224/537 (41.71%), Postives = 334/537 (62.20%), Query Frame = 2
Query:  326 IVNRFEQSPYFV--IGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQIL----------PQ----------DWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLF-DGIEPGPPYTTDYH----LVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDED 1855
            I+ ++E  P F+   GG +  YQ+ G+NWL   + + T+ ILADEMGLGKT+Q+++ +  L    +  GP LI  P ST+ NW  E   W P    +  +GD+E+R  VIRE             P+           + V++TSYE    +K+ L   ++  L +DEAHR+KN +S   + +R +  Q R+L+TGTPLQNNL EL+ LLNFL P+ F    +F   F+   + +E  +++LH++L P +LRR+KADV   +P K+E+ + + LS +Q++ Y  IL ++ D +N   G + ++ L+NI+M+L+KC NHPYLF       P      +    L++N GK VLL K+L KLK+ G R+L+FSQMT MLDILED+C    Y Y R+DGS    +RQ +ID YN PG+K+F+F+LSTRAGGLGINLATAD VI+YDSDWNP  D+QA  RAHR+GQ   V ++R +T+ +VEERI + A+ K+ L ++V++ G L  +    + K E+ D++++G   +F+ ++  +   D
Sbjct:  598 ILKKYEVQPDFISETGGNLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESR-MVIREHEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQYRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFS--EISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDALNVKNGGT-QMSLINIIMELKKCCNHPYLFMKACLEAPKLKNGMYEGSALIKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVRAG-LGAKDGKSMSKTELDDVLRWGTEELFKEEEAPVEGAD 1129          
BLAST of SWI:SNF matrix associated vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087841)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 637/931 (68.42%), Postives = 765/931 (82.17%), Query Frame = 2
Query:  137 VEFDKKKTIECILSKAEQFSK-LKDGGTTPSKNK---------FSSSSIGDHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFD-NDESGVYSVYNFEGEDYREKAVSKFDMDG-WIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            +E D+ +  + +L + E F+  + +   +P+K K              + DHRH KTEQEE+E+LL E      + RF+ SP ++  GEMRDYQIRGLNW+I LY +  NGILADEMGLGKTLQTIS++GYLKH++N  GPH++I PKSTLQNW+NEF +W PS++ +CLIGDQ+TR+  IR+ ++P +WDV VTSYEMCI+EKS  KKFN+ YL IDEAHRIKNEKSKLSEI+R FK+ NRLLITGTPLQNNLHELWALLNFL+P++F SS +FD+ FN N+ L ++ L+ RLH+VLKPFLLRR+KA+VEKRL PKKE+KI++GLS +QR+ YTK+L+KDID+VNGAG K +K+RL NILMQLRKCTNHPYLFDG EPGPPYTTD HLV N GKM +LDKLL KL+EQGSR+L+FSQMTRMLDILEDYC WR Y+YCRLDG TPH++R   I E+N   S KFLFMLSTRAGGLGINLATADVVI+YDSDWNPQ+DLQA DRAHRIGQ K VRVFRLITE+TVEE+I+ RAE+KL+LD +VIQ GRLV+ ++NQL K+E+L++I++GAN +F SK+TDI DEDIDV+L RGE KTAE    LD LGES+LR    D N E+G  SVY FEGED+REK   K +  G WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP VQDFQFFPPRLFELLD+EIY FRK++GY VPK      +A   + EEQ KI EAE LTE E+ E+E LL QGFT WTKRDF QFIKANEKYGRDDI++I+ DVEGKTPEEV +Y+ VFW RC ELQD+E+ + QIERGE KIQRR++IK+ALD KM+RYRAPFHQLR+QYG NKGKNYTE EDRFL+CMLHKLGFDK+NVY+ LR A+R +PQFRFDWFI+SRTA+ELQRRC+TLITLIERE
Sbjct:   39 IEADRSRRFDFLLKQTEIFTHFMTNSAKSPTKPKGRPKKIKDKDKEKDVADHRHRKTEQEEDEELLAEDSATKEIFRFDASPAYIKSGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAG-KVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLNIIRFGANQVFSSKETDITDEDIDVILERGEAKTAEQKAALDSLGESSLRTFTMDTNGEAGTSSVYQFEGEDWREK--QKLNALGNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTELGSDATKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERE 966          
BLAST of SWI:SNF matrix associated vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087842)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 637/931 (68.42%), Postives = 765/931 (82.17%), Query Frame = 2
Query:  137 VEFDKKKTIECILSKAEQFSK-LKDGGTTPSKNK---------FSSSSIGDHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFD-NDESGVYSVYNFEGEDYREKAVSKFDMDG-WIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            +E D+ +  + +L + E F+  + +   +P+K K              + DHRH KTEQEE+E+LL E      + RF+ SP ++  GEMRDYQIRGLNW+I LY +  NGILADEMGLGKTLQTIS++GYLKH++N  GPH++I PKSTLQNW+NEF +W PS++ +CLIGDQ+TR+  IR+ ++P +WDV VTSYEMCI+EKS  KKFN+ YL IDEAHRIKNEKSKLSEI+R FK+ NRLLITGTPLQNNLHELWALLNFL+P++F SS +FD+ FN N+ L ++ L+ RLH+VLKPFLLRR+KA+VEKRL PKKE+KI++GLS +QR+ YTK+L+KDID+VNGAG K +K+RL NILMQLRKCTNHPYLFDG EPGPPYTTD HLV N GKM +LDKLL KL+EQGSR+L+FSQMTRMLDILEDYC WR Y+YCRLDG TPH++R   I E+N   S KFLFMLSTRAGGLGINLATADVVI+YDSDWNPQ+DLQA DRAHRIGQ K VRVFRLITE+TVEE+I+ RAE+KL+LD +VIQ GRLV+ ++NQL K+E+L++I++GAN +F SK+TDI DEDIDV+L RGE KTAE    LD LGES+LR    D N E+G  SVY FEGED+REK   K +  G WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP VQDFQFFPPRLFELLD+EIY FRK++GY VPK      +A   + EEQ KI EAE LTE E+ E+E LL QGFT WTKRDF QFIKANEKYGRDDI++I+ DVEGKTPEEV +Y+ VFW RC ELQD+E+ + QIERGE KIQRR++IK+ALD KM+RYRAPFHQLR+QYG NKGKNYTE EDRFL+CMLHKLGFDK+NVY+ LR A+R +PQFRFDWFI+SRTA+ELQRRC+TLITLIERE
Sbjct:   39 IEADRSRRFDFLLKQTEIFTHFMTNSAKSPTKPKGRPKKIKDKDKEKDVADHRHRKTEQEEDEELLAEDSATKEIFRFDASPAYIKSGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAG-KVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLNIIRFGANQVFSSKETDITDEDIDVILERGEAKTAEQKAALDSLGESSLRTFTMDTNGEAGTSSVYQFEGEDWREK--QKLNALGNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTELGSDATKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERE 966          
BLAST of SWI:SNF matrix associated vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087843)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 637/931 (68.42%), Postives = 765/931 (82.17%), Query Frame = 2
Query:  137 VEFDKKKTIECILSKAEQFSK-LKDGGTTPSKNK---------FSSSSIGDHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFD-NDESGVYSVYNFEGEDYREKAVSKFDMDG-WIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            +E D+ +  + +L + E F+  + +   +P+K K              + DHRH KTEQEE+E+LL E      + RF+ SP ++  GEMRDYQIRGLNW+I LY +  NGILADEMGLGKTLQTIS++GYLKH++N  GPH++I PKSTLQNW+NEF +W PS++ +CLIGDQ+TR+  IR+ ++P +WDV VTSYEMCI+EKS  KKFN+ YL IDEAHRIKNEKSKLSEI+R FK+ NRLLITGTPLQNNLHELWALLNFL+P++F SS +FD+ FN N+ L ++ L+ RLH+VLKPFLLRR+KA+VEKRL PKKE+KI++GLS +QR+ YTK+L+KDID+VNGAG K +K+RL NILMQLRKCTNHPYLFDG EPGPPYTTD HLV N GKM +LDKLL KL+EQGSR+L+FSQMTRMLDILEDYC WR Y+YCRLDG TPH++R   I E+N   S KFLFMLSTRAGGLGINLATADVVI+YDSDWNPQ+DLQA DRAHRIGQ K VRVFRLITE+TVEE+I+ RAE+KL+LD +VIQ GRLV+ ++NQL K+E+L++I++GAN +F SK+TDI DEDIDV+L RGE KTAE    LD LGES+LR    D N E+G  SVY FEGED+REK   K +  G WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP VQDFQFFPPRLFELLD+EIY FRK++GY VPK      +A   + EEQ KI EAE LTE E+ E+E LL QGFT WTKRDF QFIKANEKYGRDDI++I+ DVEGKTPEEV +Y+ VFW RC ELQD+E+ + QIERGE KIQRR++IK+ALD KM+RYRAPFHQLR+QYG NKGKNYTE EDRFL+CMLHKLGFDK+NVY+ LR A+R +PQFRFDWFI+SRTA+ELQRRC+TLITLIERE
Sbjct:   39 IEADRSRRFDFLLKQTEIFTHFMTNSAKSPTKPKGRPKKIKDKDKEKDVADHRHRKTEQEEDEELLAEDSATKEIFRFDASPAYIKSGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAG-KVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLNIIRFGANQVFSSKETDITDEDIDVILERGEAKTAEQKAALDSLGESSLRTFTMDTNGEAGTSSVYQFEGEDWREK--QKLNALGNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTELGSDATKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERE 966          
BLAST of SWI:SNF matrix associated vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0333580)

HSP 1 Score: 448.743 bits (1153), Expect = 1.788e-135
Identity = 245/543 (45.12%), Postives = 351/543 (64.64%), Query Frame = 2
Query:  356 FVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN---------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFDGIEP-------GPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLD 1915
             ++ G +++YQI+GL WL+ LY ++ NGILADEMGLGKT+QTIS++ YL   + + GP+LII P STL NW+ EF +W P+V  +   G  + R R+++ Q+    ++V++T+YE  IK+K+ L K  + Y+ IDE HR+KN   KL++++ T + +  RLL+TGTPLQN L ELWALLNFL+P +F S + F+  FN         +   EEET+  ++RLH VL+PFLLRR+K +VE +LP K E  I   +S LQR LY  +  K + L +G+     GK     L+N ++QLRK  NHP++F  IE        G    +   L    GK  LLD++L KLK    R+LLF QMT+ + I+EDY  WR++ Y RLDG+T  ++R   + ++N  GS  F+F+LSTRAGGLG+NL TAD V+++DSDWNP  DLQAQDRAHRIGQ   VRV RL+T N+VEERI+A A  KL +D  VIQ G + +QK+    + + L  I +  +     ++    DE I++++AR E++  E+ K++D
Sbjct:  771 IMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGR-RLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAG-MFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEI-EIFKRMD 1310          
BLAST of SWI:SNF matrix associated vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075524)

HSP 1 Score: 448.358 bits (1152), Expect = 2.068e-135
Identity = 245/543 (45.12%), Postives = 351/543 (64.64%), Query Frame = 2
Query:  356 FVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN---------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFDGIEP-------GPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLD 1915
             ++ G +++YQI+GL WL+ LY ++ NGILADEMGLGKT+QTIS++ YL   + + GP+LII P STL NW+ EF +W P+V  +   G  + R R+++ Q+    ++V++T+YE  IK+K+ L K  + Y+ IDE HR+KN   KL++++ T + +  RLL+TGTPLQN L ELWALLNFL+P +F S + F+  FN         +   EEET+  ++RLH VL+PFLLRR+K +VE +LP K E  I   +S LQR LY  +  K + L +G+     GK     L+N ++QLRK  NHP++F  IE        G    +   L    GK  LLD++L KLK    R+LLF QMT+ + I+EDY  WR++ Y RLDG+T  ++R   + ++N  GS  F+F+LSTRAGGLG+NL TAD V+++DSDWNP  DLQAQDRAHRIGQ   VRV RL+T N+VEERI+A A  KL +D  VIQ G + +QK+    + + L  I +  +     ++    DE I++++AR E++  E+ K++D
Sbjct:  763 IMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGR-RLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAG-MFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEI-EIFKRMD 1302          
BLAST of SWI:SNF matrix associated vs. Ensembl Zebrafish
Match: smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:ZFIN;Acc:ZDB-GENE-070705-296])

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 632/991 (63.77%), Postives = 784/991 (79.11%), Query Frame = 2
Query:  146 DKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSS-----------SIGDHRH--SXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREK----------------AVSK---FDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQLVSKNSGSHTSKHKA 3007
            D+    E +L + E F+       +   T+P K K               S+GD+RH  ++ E++EE    +    +V+V RFE+SP ++  G +RDYQIRGLNW+I LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVP++K +CLIG+++ R+  IR+ ++P +WDV VTSYEM I+EKS  KKFN+ YL IDEAHRIKNEKSKLSEI R FK+ NRLL+TGTPLQNNLHELW+LLNFL+P++F S+++FD  F+ N L ++ LV+RLH+VL+PFLLRRIKA+VEK LPPKKE+KIY+GLS +QRE YT+ILMKDID++N A GK DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV LDKLL K++EQGSR+L+FSQMTR+LDILEDYC+WR ++YCRLDG+TPH+ R+ +ID +N P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQ K V+VFRLIT+NTVEERI+ RAEMKL+LD+IVIQQGRL++Q+ N+LGK+E+L MI++GA ++F SKD+++ DEDID +L RG +KTAEMN+++  LGES+LR    D   +   S+YNFEGEDYREK                AV K     +  WI+PPKRERKANYAVD YF++ALR++EP+APKAPRPPKQP++QDFQFFPPRLFELL+ EI  +RK+IGY VP+       A++++ EEQ KI EAE L+  E  E+E+LL QGFT W KRDF QFIKANEKYGRDDI++I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD+K+ARY+APFHQLRIQYGTNKGKNYTEEEDRFLICMLHK+GFDK+ VY+ LR  VR APQFRFDWFI+SRTA+ELQRRC+TLI+LIE+E  ++EEK R  K     P+    Q       S   + KA
Sbjct:   50 DRANRFEFLLKQTELFAHFIQPASQKSPTSPLKVKMGRPRIKQDEKQNLLSVGDNRHRRTEQEEDEELLSESRKADNVLV-RFEESPSYIKNGTLRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGNKDERAAFIRDVMMPGEWDVCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIAREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASDFDSWFDTNCLGDQKLVERLHAVLRPFLLRRIKAEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSA-GKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVINSGKMVALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGFEYCRLDGNTPHEAREQAIDAFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQRKPVKVFRLITDNTVEERIVERAEMKLRLDSIVIQQGRLIDQQ-NKLGKDEMLQMIRHGATHVFASKDSELTDEDIDTILERGAKKTAEMNERMQNLGESSLRNFTVDTGATET-SLYNFEGEDYREKQKVGVFIFGHLIFVHIAVLKSINLSLIEWIEPPKRERKANYAVDAYFREALRVSEPRAPKAPRPPKQPNIQDFQFFPPRLFELLEMEILYYRKTIGYKVPRSPDIPNSAQVQK-EEQRKIDEAEPLSPEETEEKEKLLTQGFTNWNKRDFNQFIKANEKYGRDDIDNIAREVEGKTPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDVKIARYKAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKMGFDKEYVYEELRQCVRNAPQFRFDWFIKSRTAMELQRRCNTLISLIEKENMEIEEKERAEK-KRRTPKGQSAQKRKAEVSSEKKEKKA 1034          
BLAST of SWI:SNF matrix associated vs. Ensembl Zebrafish
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:ZFIN;Acc:ZDB-GENE-021125-1])

HSP 1 Score: 1244.95 bits (3220), Expect = 0.000e+0
Identity = 643/943 (68.19%), Postives = 771/943 (81.76%), Query Frame = 2
Query:  128 KEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSSSI-----------GDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDL 2902
            +E V+ D+    E +L + E F+       +   T+P K K     I           GD+RH +TEQEE+E+LL+E  +   +  RF+ SP +V  G++RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW+NEF RWVPS+K +CLIGD+E R+  IR+ +LP +WDV VTSYEM I E++  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F SS +FD  F+ N+ L +  LV+RLH+VL+PFLLRRIKADVEK L PKKEIKIY+GLS +QRE YTKILMKDID++N AG K DK+RLLN+LMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y YCRLDG TPH+ERQISI+ +N+P S KFLFMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQ K VRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+   N+LGK+E+L +I++GA ++F SK+++I DEDID +L RGE+KT EM +K+  LGE +LR    D +     SVYNFEGEDYREK   K  +  WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+       AE+++ EEQ KI EAE L E E+ E+E LL QGFT WTKRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK++VYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE  +L
Sbjct:   64 EEKVQTDRTNRFEYLLKQTEVFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSAGDNRHRRTEQEEDEELLSENSKATSVCTRFDDSPSYVKTGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLYNWMNEFKRWVPSLKAVCLIGDREERTAFIRDTLLPGEWDVCVTSYEMLIIERAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFDAWFDTNNCLGDTKLVERLHTVLRPFLLRRIKADVEKSLLPKKEIKIYVGLSKMQREWYTKILMKDIDILNSAG-KMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYGYCRLDGQTPHEERQISINAFNEPNSSKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQKKQVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDPSMNKLGKDEMLSIIRHGATHVFASKESEITDEDIDGILERGERKTMEMKEKMANLGEGSLRNFTMDTEN----SVYNFEGEDYREK---KKVVTNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPDLPNSAEMQK-EEQAKIDEAEPLNEEELEEKENLLSQGFTIWTKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDSKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKESVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMEL 997          
BLAST of SWI:SNF matrix associated vs. Ensembl Zebrafish
Match: chd1l (chromodomain helicase DNA binding protein 1-like [Source:NCBI gene;Acc:393283])

HSP 1 Score: 452.21 bits (1162), Expect = 1.857e-141
Identity = 244/553 (44.12%), Postives = 355/553 (64.20%), Query Frame = 2
Query:  374 MRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQD--WDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS--LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGR--LVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLAR---GEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDY 2005
            +R YQ+ G+ WL     +    IL DEMGLGKT QTIS++ Y +    + GP L++ P + L+NW  E  R+ PS+  IC  GD+E R+ +  +Q L  D  + V++T+YEMC+K+   LK + +  L +DEAHR+KN++S L + ++ F    R+L+TGTP+QNNL E+++LL F+ P +F   A  +D  N  +    E  LV  LH VL+PFLLRR+KA+V   LP K E+ ++ GLS LQ+  Y  ILM+D+D       +S K RLLN+LMQLRKC +HPYLFDG+EP  P+    HLVE  GK+ LLD +L  L+E G  +LLFSQMTRMLDIL+DY  +R Y Y RLDGS   +ER ++I  ++      F+F+LST+AGG+G+NL  AD VI  D D+NPQ DLQA  RAHRIGQT+ V+V RL+  +T+EE I +RA  KL+L + VI++GR  L++Q  +     ++ +++K+G + +  S+++ ++D D+ ++L +   G+  T E + KL+E  E     ++  N       +Y FEG+DY
Sbjct:   35 LRPYQLDGVKWLSLCMKNQQGCILGDEMGLGKTCQTISLLAYARGSLKMNGPFLVLCPLAVLENWRQELERFCPSLSVICYTGDKERRAEL--QQNLKSDPRFHVLLTTYEMCLKDARYLKSWKWKILVVDEAHRLKNQESLLHQTLKEFTVGFRVLLTGTPIQNNLQEVYSLLTFIQPSVFLPEA-VEDFVNAYADIQTEPALVDELHQVLQPFLLRRVKAEVAAELPKKTELVVFHGLSALQKRYYKAILMRDLDAFR--TDQSTKTRLLNVLMQLRKCVDHPYLFDGVEP-EPFEMGEHLVEASGKLSLLDSMLAYLQEGGHHVLLFSQMTRMLDILQDYLEYRGYSYERLDGSVRGEERNLAIKNFST--KDVFIFLLSTKAGGVGMNLTAADTVIFVDGDFNPQNDLQAAARAHRIGQTRPVKVIRLLGRDTIEEIIYSRAVSKLRLTDTVIEEGRFSLLDQAQSAASGLQLSEILKFGVDKLLSSEESSVQDVDLQLILGQSRDGQWLTDEEHAKLNESNEEEDEDMEGQN------HMYYFEGKDY 573          
BLAST of SWI:SNF matrix associated vs. Ensembl Zebrafish
Match: SMARCA4 (transcription activator BRG1-like [Source:NCBI gene;Acc:100535713])

HSP 1 Score: 446.432 bits (1147), Expect = 4.708e-135
Identity = 237/520 (45.58%), Postives = 330/520 (63.46%), Query Frame = 2
Query:  323 VIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN---------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHL------------VENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMI 1798
             +  R ++    +I G+++ YQI+GL WL+ LY ++ NGILADEMGLGKT+QTI++I YL  Y+ L GP+LII P STL NW+ EF +W PSV  +   G    R R    Q+    ++V++T+YE  IK+K  L K  + Y+ +DE HR+KN   KL++++ T + +  R+L+TGTPLQN L ELWALLNFL+P +F S + F+  FN         ++  EEET+  ++RLH VL+PFLLRR+K +VE +LP K E  I   +S LQR LY  +  K + L +G+     GK     L+N +MQLRK  NHPY+F  IE     T   HL                GK  +LD++L KL+    ++LLF QMT ++ I+EDY  +R + Y RLDG+T  ++R + +  +N P S+ F+F+LSTRAGGLG+NL +AD VI++DSDWNP  DLQAQDRAHRIGQ   VRV RL T N+VEE+I+A A+ KL +D  VIQ G + +QK++   +   L  I
Sbjct:  690 AVTERVDKQSSLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAAR-RAFVPQLRSGKFNVLLTTYEYIIKDKQILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIE----ETFSEHLGFSGGIVQGLDLYRASGKFEVLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRNFKYLRLDGTTKAEDRGMLLKTFNDPASQYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQLNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAG-MFDQKSSSHERRAFLQAI 1203          
BLAST of SWI:SNF matrix associated vs. Ensembl Zebrafish
Match: smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5964])

HSP 1 Score: 443.351 bits (1139), Expect = 7.214e-134
Identity = 243/544 (44.67%), Postives = 343/544 (63.05%), Query Frame = 2
Query:  323 VIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN---------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFDGIEP------GPP--YTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGE 1882
             ++ R ++   F+I G ++ YQI+GL W++ LY ++ NGILADEMGLGKT+QTI +I YL  ++ L GP+LII P STL NW+ E  +W PS+  I   G    R R +  Q+    ++V++T+YE  IK+K  L K  + Y+ +DE HR+KN   KL++++ T + +  RLL+TGTPLQN L ELWALLNFL+P +F S + F+  FN         ++  EEET+  ++RLH VL+PFLLRR+K +VE +LP K E  I   +S +Q+ LY  +  K I L +G+     GK     L+N +MQL+K  NHPY+F  IE       G P    +   L    GK  LLD++L KLK    R+LLF QMT ++ ILEDY  +R + Y RLDG+T  ++R + + ++N+ GS+ F+F+LSTRAGGLG+NL  AD V+++DSDWNP  DLQAQDRAHRIGQ   VRV RL T N+VEE+I+A A+ KL +D  VIQ G + +QK++   +   L  I          +D    DE ++ ++AR E
Sbjct:  709 AVIERVDKQSTFLINGTLKQYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSIVKIAYKGTPSMR-RSLVPQLRSGKFNVLITTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQGKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYMFQHIEESFAEHLGFPNGIISGPDLYRASGKFELLDRILPKLKATNHRVLLFCQMTSLMTILEDYFGYRNFLYLRLDGTTKSEDRAMLLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAG-MFDQKSSSHERRAFLQAILEHEEQNM-EEDEVPDDETLNQMIARNE 1249          
BLAST of SWI:SNF matrix associated vs. Ensembl Xenopus
Match: mettl6 (methyltransferase like 6 [Source:Xenbase;Acc:XB-GENE-5809155])

HSP 1 Score: 1268.45 bits (3281), Expect = 0.000e+0
Identity = 635/880 (72.16%), Postives = 753/880 (85.57%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLI 2881
            S+GD+RH +TEQEE+E+LLTE+ +   +  RFE SP +V GG +RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYR++PGPH+++ PKSTL NW+ EF RWVPS+  ICLIGD++ R+  +R+ +LP +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH VLKPFLLRRIKADVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K+DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL +LKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ERQ SI  YN PGS KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQTKTVRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+Q  N+LGK+E+L MI++GA ++F SKD++I +EDI+ +L RGE+KTAEMN+KL  +GES+LR    DN+     SVYNFEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P A   + EEQ KI EAE L + E+ E+E+LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK+NVYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLI
Sbjct:  133 SMGDYRHRRTEQEEDEELLTESSKTTNVCTRFEDSPSYVKGGTLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRSIPGPHMVLVPKSTLHNWMAEFKRWVPSLCAICLIGDKDHRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDTNNCLGDQKLVERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWYTKILMKDIDILNSSG-KTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQDSIIAYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKLGKDEMLQMIRHGATHVFASKDSEITEEDINAILERGEKKTAEMNEKLSNMGESSLRNFTVDNES----SVYNFEGEDYREK--QKMAFTEWIEPPKRERKANYAVDAYFREALRVSEPKVPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPDLPNAAQAQKEEQLKIDEAEPLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLI 1004          
BLAST of SWI:SNF matrix associated vs. Ensembl Xenopus
Match: mettl6 (methyltransferase like 6 [Source:Xenbase;Acc:XB-GENE-5809155])

HSP 1 Score: 1242.25 bits (3213), Expect = 0.000e+0
Identity = 625/874 (71.51%), Postives = 743/874 (85.01%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREK-AVSK------FDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAI 2842
            S+GD+RH +TEQEE+E+LLTE+ +   +  RFE SP +V GG +RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYR++PGPH+++ PKSTL NW+ EF RWVPS+  ICLIGD++ R+  +R+ +LP +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH VLKPFLLRRIKADVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K+DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL +LKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ERQ SI  YN PGS KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQTKTVRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+Q  N+LGK+E+L MI++GA ++F SKD++I +EDI+ +L RGE+KTAEMN+KL  +GES+LR    DN+     SVYNFEGEDYREK  VS       F +  WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P A   + EEQ KI EAE L + E+ E+E+LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK+NVYD LR  +R +PQFRFDWF++SRTA+
Sbjct:   62 SMGDYRHRRTEQEEDEELLTESSKTTNVCTRFEDSPSYVKGGTLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRSIPGPHMVLVPKSTLHNWMAEFKRWVPSLCAICLIGDKDHRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDTNNCLGDQKLVERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWYTKILMKDIDILNSSG-KTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQDSIIAYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKLGKDEMLQMIRHGATHVFASKDSEITEEDINAILERGEKKTAEMNEKLSNMGESSLRNFTVDNES----SVYNFEGEDYREKQKVSHIFHRCVFSLTEWIEPPKRERKANYAVDAYFREALRVSEPKVPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPDLPNAAQAQKEEQLKIDEAEPLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAM 929          
BLAST of SWI:SNF matrix associated vs. Ensembl Xenopus
Match: mettl6 (methyltransferase like 6 [Source:Xenbase;Acc:XB-GENE-5809155])

HSP 1 Score: 1241.1 bits (3210), Expect = 0.000e+0
Identity = 623/867 (71.86%), Postives = 740/867 (85.35%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAI 2842
            S+GD+RH +TEQEE+E+LLTE+ +   +  RFE SP +V GG +RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYR++PGPH+++ PKSTL NW+ EF RWVPS+  ICLIGD++ R+  +R+ +LP +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH VLKPFLLRRIKADVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K+DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL +LKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ERQ SI  YN PGS KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQTKTVRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+Q  N+LGK+E+L MI++GA ++F SKD++I +EDI+ +L RGE+KTAEMN+KL  +GES+LR    DN+     SVYNFEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P A   + EEQ KI EAE L + E+ E+E+LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK+NVYD LR  +R +PQFRFDWF++SRTA+
Sbjct:   85 SMGDYRHRRTEQEEDEELLTESSKTTNVCTRFEDSPSYVKGGTLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRSIPGPHMVLVPKSTLHNWMAEFKRWVPSLCAICLIGDKDHRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDTNNCLGDQKLVERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWYTKILMKDIDILNSSG-KTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQDSIIAYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKLGKDEMLQMIRHGATHVFASKDSEITEEDINAILERGEKKTAEMNEKLSNMGESSLRNFTVDNES----SVYNFEGEDYREKQKVK-----WIEPPKRERKANYAVDAYFREALRVSEPKVPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPDLPNAAQAQKEEQLKIDEAEPLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAM 940          
BLAST of SWI:SNF matrix associated vs. Ensembl Xenopus
Match: mettl6 (methyltransferase like 6 [Source:Xenbase;Acc:XB-GENE-5809155])

HSP 1 Score: 1239.17 bits (3205), Expect = 0.000e+0
Identity = 608/840 (72.38%), Postives = 718/840 (85.48%), Query Frame = 2
Query:  326 IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAI 2842
            +  RFE SP +V GG +RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYR++PGPH+++ PKSTL NW+ EF RWVPS+  ICLIGD++ R+  +R+ +LP +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH VLKPFLLRRIKADVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K+DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL +LKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ERQ SI  YN PGS KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQTKTVRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+Q  N+LGK+E+L MI++GA ++F SKD++I +EDI+ +L RGE+KTAEMN+KL  +GES+LR    DN+     SVYNFEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P A   + EEQ KI EAE L + E+ E+E+LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK+NVYD LR  +R +PQFRFDWF++SRTA+
Sbjct:   36 VCTRFEDSPSYVKGGTLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRSIPGPHMVLVPKSTLHNWMAEFKRWVPSLCAICLIGDKDHRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDTNNCLGDQKLVERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWYTKILMKDIDILNSSG-KTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQDSIIAYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKLGKDEMLQMIRHGATHVFASKDSEITEEDINAILERGEKKTAEMNEKLSNMGESSLRNFTVDNES----SVYNFEGEDYREK--QKMAFTEWIEPPKRERKANYAVDAYFREALRVSEPKVPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPDLPNAAQAQKEEQLKIDEAEPLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAM 867          
BLAST of SWI:SNF matrix associated vs. Ensembl Xenopus
Match: anxa4 (annexin A4 [Source:Xenbase;Acc:XB-GENE-854498])

HSP 1 Score: 1229.93 bits (3181), Expect = 0.000e+0
Identity = 620/920 (67.39%), Postives = 755/920 (82.07%), Query Frame = 2
Query:  137 VEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSSSI-----------GDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAI 2842
            ++ D+ K  E +L + E F+       +   T+P K K     I           GD+RH +TEQEE+E+LL+E+++   +  RFE+SP ++ GG +RDYQ+RGLNW+I LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RW+PS+  +CLIGD+  R+  IR+ ++P +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH+VLKPFLLRRIKA+VEK LPPKKE+KIY+GL  +QRE YTKILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL K KEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH++R+++   +N P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQ KTVRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K+E+L MI++GA ++F SKD+++ DEDI  +L RGE+KTAEM ++L ++GES+LR    D +     S+YNFEGEDYREK   K  M  WI+PPKRERKANYAVD YF+DALR++EP+ PKAPRPPKQP++QDFQFFPPRLFELL+KEI  +RK+IGY VP+  S  P A   + EEQ KI EAE L   E  E+E+LL QGFT W KRDF QFIKANEKYGRDDI++I+ +VEGKTPEEV  YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGTNKGKNYTEEEDRFLICMLHK+GFDK+NVY+ LR  VR APQFRFDWFI+SRTA+
Sbjct:   33 IKTDRSKRFEFLLKQTELFAHFIQPAAQKSPTSPLKVKLGRPKIKKDEKQNLLSAGDYRHRRTEQEEDEELLSESRKTSNVCVRFEESPSYIKGGTLRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWIPSLCAVCLIGDKNARAAFIRDVMMPGEWDVCVTSYEMVIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDTNNCLGDQKLVERLHAVLKPFLLRRIKAEVEKSLPPKKEVKIYLGLGKMQREWYTKILMKDIDILNSAG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVYNSGKMVVLDKLLPKFKEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGQTPHEQREVNTITFNSPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKTVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKDEMLQMIRHGATHVFASKDSELTDEDITTILERGERKTAEMAERLQKMGESSLRNFSVDTET----SLYNFEGEDYREK--QKLSMMEWIEPPKRERKANYAVDAYFRDALRVSEPRVPKAPRPPKQPNIQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-SSDLPNASQIQKEEQRKIDEAEPLCSEESEEKEKLLTQGFTNWNKRDFNQFIKANEKYGRDDIDNIAREVEGKTPEEVMDYSGVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKMGFDKENVYEELRQCVRNAPQFRFDWFIKSRTAM 944          
BLAST of SWI:SNF matrix associated vs. Ensembl Mouse
Match: Smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:MGI Symbol;Acc:MGI:1935129])

HSP 1 Score: 1268.06 bits (3280), Expect = 0.000e+0
Identity = 634/883 (71.80%), Postives = 757/883 (85.73%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            S+GD+RH +TEQEE+E+LLTE+ +   +  RFE SP +V  G++RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW++EF +WVP+++ +CLIGD+E R+  +R+ +LP +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELW+LLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH VL+PFLLRRIKADVEK LPPKKE+KIY+GLS +QRE YT+ILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPHDERQ SI+ YN+P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQTKTVRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+Q  N++GK+E+L MI++GA ++F SK+++I DEDID +L RG +KTAEMN+KL ++GES+LR    D +     SVYNFEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+     P A   + EEQ KI EAE L + E+ E+E+LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK+NVYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE
Sbjct:  136 SVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKKWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTES----SVYNFEGEDYREK--QKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRSPD-LPNAAQAQKEEQLKIDEAEPLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERE 1010          
BLAST of SWI:SNF matrix associated vs. Ensembl Mouse
Match: Smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:MGI Symbol;Acc:MGI:1935127])

HSP 1 Score: 1267.29 bits (3278), Expect = 0.000e+0
Identity = 634/971 (65.29%), Postives = 785/971 (80.84%), Query Frame = 2
Query:  146 DKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSS-----------SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQLVSKNSGSHTSKHK 3004
            D+ K  E +L + E F+       +   T+P   K +             S+GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV LDKLL ++KEQGSR+L+FSQMTR+LDILEDYC+WR Y+Y RLDG TPH+ER+ +ID +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F  K++++ DEDI  +L RGE+KTAEMN+++ ++GES+LR  + D ++    S+Y FEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   + + EEQ KI  AE LT  E  E+++LL QGFT WTKRDF QFIKANEKYGRDDI++I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGT+KGKNYTEEEDRFLICMLHK+GFD++NVY+ LR  VR APQFRFDWFI+SRTA+E QRRC+TLI+LIE+E  ++EE+ R  K    A ++   Q     S + +S  K
Sbjct:   94 DRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRMDLEQ----SLYKFEGEDYREK--QKLGTVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPEIPNPAIAQREEQKKIDGAEPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEK-KKRATKTPMSQKRKAESATESSGRK 1055          
BLAST of SWI:SNF matrix associated vs. Ensembl Mouse
Match: Smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:MGI Symbol;Acc:MGI:1935127])

HSP 1 Score: 1266.14 bits (3275), Expect = 0.000e+0
Identity = 629/945 (66.56%), Postives = 776/945 (82.12%), Query Frame = 2
Query:  146 DKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSS-----------SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSK 2926
            D+ K  E +L + E F+       +   T+P   K +             S+GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV LDKLL ++KEQGSR+L+FSQMTR+LDILEDYC+WR Y+Y RLDG TPH+ER+ +ID +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F  K++++ DEDI  +L RGE+KTAEMN+++ ++GES+LR  + D ++    S+Y FEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   + + EEQ KI  AE LT  E  E+++LL QGFT WTKRDF QFIKANEKYGRDDI++I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGT+KGKNYTEEEDRFLICMLHK+GFD++NVY+ LR  VR APQFRFDWFI+SRTA+E QRRC+TLI+LIE+E  ++EE+ R  K
Sbjct:   94 DRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRMDLEQ----SLYKFEGEDYREK--QKLGTVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPEIPNPAIAQREEQKKIDGAEPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEK 1030          
BLAST of SWI:SNF matrix associated vs. Ensembl Mouse
Match: Smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:MGI Symbol;Acc:MGI:1935127])

HSP 1 Score: 1266.14 bits (3275), Expect = 0.000e+0
Identity = 629/945 (66.56%), Postives = 776/945 (82.12%), Query Frame = 2
Query:  146 DKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSS-----------SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSK 2926
            D+ K  E +L + E F+       +   T+P   K +             S+GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV LDKLL ++KEQGSR+L+FSQMTR+LDILEDYC+WR Y+Y RLDG TPH+ER+ +ID +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F  K++++ DEDI  +L RGE+KTAEMN+++ ++GES+LR  + D ++    S+Y FEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   + + EEQ KI  AE LT  E  E+++LL QGFT WTKRDF QFIKANEKYGRDDI++I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGT+KGKNYTEEEDRFLICMLHK+GFD++NVY+ LR  VR APQFRFDWFI+SRTA+E QRRC+TLI+LIE+E  ++EE+ R  K
Sbjct:   94 DRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRMDLEQ----SLYKFEGEDYREK--QKLGTVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPEIPNPAIAQREEQKKIDGAEPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEK 1030          
BLAST of SWI:SNF matrix associated vs. Ensembl Mouse
Match: Smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:MGI Symbol;Acc:MGI:1935127])

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 442/698 (63.32%), Postives = 553/698 (79.23%), Query Frame = 2
Query:  116 MEP-VKEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSS-----------SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQI------------SIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRI 2116
            M+P  +E ++ D+ K  E +L + E F+       +   T+P   K +             S+GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N + GK DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV LDKLL ++KEQGSR+L+FSQMTR+LDILEDYC+WR Y+Y RLDG TPH+ER+             +ID +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F  K++++ DEDI  +L RGE+KTAEMN+++ ++GES+LR  + D ++    S+Y FEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR+
Sbjct:   78 MDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLN-SSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREDKFLEVELLGQREAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRMDLEQ----SLYKFEGEDYREK--QKLGTVEWIEPPKRERKANYAVDAYFREALRV 768          
BLAST of SWI:SNF matrix associated vs. UniProt/SwissProt
Match: sp|Q24368|ISWI_DROME (Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 637/931 (68.42%), Postives = 765/931 (82.17%), Query Frame = 2
Query:  137 VEFDKKKTIECILSKAEQFSK-LKDGGTTPSKNK---------FSSSSIGDHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFD-NDESGVYSVYNFEGEDYREKAVSKFDMDG-WIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            +E D+ +  + +L + E F+  + +   +P+K K              + DHRH KTEQEE+E+LL E      + RF+ SP ++  GEMRDYQIRGLNW+I LY +  NGILADEMGLGKTLQTIS++GYLKH++N  GPH++I PKSTLQNW+NEF +W PS++ +CLIGDQ+TR+  IR+ ++P +WDV VTSYEMCI+EKS  KKFN+ YL IDEAHRIKNEKSKLSEI+R FK+ NRLLITGTPLQNNLHELWALLNFL+P++F SS +FD+ FN N+ L ++ L+ RLH+VLKPFLLRR+KA+VEKRL PKKE+KI++GLS +QR+ YTK+L+KDID+VNGAG K +K+RL NILMQLRKCTNHPYLFDG EPGPPYTTD HLV N GKM +LDKLL KL+EQGSR+L+FSQMTRMLDILEDYC WR Y+YCRLDG TPH++R   I E+N   S KFLFMLSTRAGGLGINLATADVVI+YDSDWNPQ+DLQA DRAHRIGQ K VRVFRLITE+TVEE+I+ RAE+KL+LD +VIQ GRLV+ ++NQL K+E+L++I++GAN +F SK+TDI DEDIDV+L RGE KTAE    LD LGES+LR    D N E+G  SVY FEGED+REK   K +  G WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP VQDFQFFPPRLFELLD+EIY FRK++GY VPK      +A   + EEQ KI EAE LTE E+ E+E LL QGFT WTKRDF QFIKANEKYGRDDI++I+ DVEGKTPEEV +Y+ VFW RC ELQD+E+ + QIERGE KIQRR++IK+ALD KM+RYRAPFHQLR+QYG NKGKNYTE EDRFL+CMLHKLGFDK+NVY+ LR A+R +PQFRFDWFI+SRTA+ELQRRC+TLITLIERE
Sbjct:   39 IEADRSRRFDFLLKQTEIFTHFMTNSAKSPTKPKGRPKKIKDKDKEKDVADHRHRKTEQEEDEELLAEDSATKEIFRFDASPAYIKSGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAG-KVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLNIIRFGANQVFSSKETDITDEDIDVILERGEAKTAEQKAALDSLGESSLRTFTMDTNGEAGTSSVYQFEGEDWREK--QKLNALGNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTELGSDATKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGKNYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLITLIERE 966          
BLAST of SWI:SNF matrix associated vs. UniProt/SwissProt
Match: sp|O60264|SMCA5_HUMAN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1)

HSP 1 Score: 1272.69 bits (3292), Expect = 0.000e+0
Identity = 636/883 (72.03%), Postives = 759/883 (85.96%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            S+GD+RH +TEQEE+E+LLTE+ +   +  RFE SP +V  G++RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW++EF RWVP+++ +CLIGD+E R+  +R+ +LP +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELW+LLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH VL+PFLLRRIKADVEK LPPKKE+KIY+GLS +QRE YT+ILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPHDERQ SI+ YN+P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQTKTVRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+Q  N++GK+E+L MI++GA ++F SK+++I DEDID +L RG +KTAEMN+KL ++GES+LR    D +     SVYNFEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P A   + EEQ KI EAESL + E+ E+E+LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK+NVYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE
Sbjct:  137 SVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTES----SVYNFEGEDYREK--QKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVPR-NPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERE 1011          
BLAST of SWI:SNF matrix associated vs. UniProt/SwissProt
Match: sp|Q91ZW3|SMCA5_MOUSE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus OX=10090 GN=Smarca5 PE=1 SV=1)

HSP 1 Score: 1268.06 bits (3280), Expect = 0.000e+0
Identity = 634/883 (71.80%), Postives = 757/883 (85.73%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            S+GD+RH +TEQEE+E+LLTE+ +   +  RFE SP +V  G++RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW++EF +WVP+++ +CLIGD+E R+  +R+ +LP +WDV VTSYEM IKEKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELW+LLNFL+P++F S+ +FD  F+ N+ L ++ LV+RLH VL+PFLLRRIKADVEK LPPKKE+KIY+GLS +QRE YT+ILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPHDERQ SI+ YN+P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQTKTVRVFR IT+NTVEERI+ RAEMKL+LD+IVIQQGRLV+Q  N++GK+E+L MI++GA ++F SK+++I DEDID +L RG +KTAEMN+KL ++GES+LR    D +     SVYNFEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+     P A   + EEQ KI EAE L + E+ E+E+LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK+NVYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE
Sbjct:  136 SVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKKWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTES----SVYNFEGEDYREK--QKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRSPD-LPNAAQAQKEEQLKIDEAEPLNDEELEEKEKLLTQGFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERE 1010          
BLAST of SWI:SNF matrix associated vs. UniProt/SwissProt
Match: sp|Q6PGB8|SMCA1_MOUSE (Probable global transcription activator SNF2L1 OS=Mus musculus OX=10090 GN=Smarca1 PE=1 SV=1)

HSP 1 Score: 1266.14 bits (3275), Expect = 0.000e+0
Identity = 629/945 (66.56%), Postives = 776/945 (82.12%), Query Frame = 2
Query:  146 DKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSS-----------SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSK 2926
            D+ K  E +L + E F+       +   T+P   K +             S+GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV LDKLL ++KEQGSR+L+FSQMTR+LDILEDYC+WR Y+Y RLDG TPH+ER+ +ID +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F  K++++ DEDI  +L RGE+KTAEMN+++ ++GES+LR  + D ++    S+Y FEGEDYREK   K     WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   + + EEQ KI  AE LT  E  E+++LL QGFT WTKRDF QFIKANEKYGRDDI++I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGT+KGKNYTEEEDRFLICMLHK+GFD++NVY+ LR  VR APQFRFDWFI+SRTA+E QRRC+TLI+LIE+E  ++EE+ R  K
Sbjct:   94 DRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLARPRVKKDDKQSLISVGDYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFRMDLEQ----SLYKFEGEDYREK--QKLGTVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPEIPNPAIAQREEQKKIDGAEPLTPQETEEKDKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEK 1030          
BLAST of SWI:SNF matrix associated vs. UniProt/SwissProt
Match: sp|P28370|SMCA1_HUMAN (Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2)

HSP 1 Score: 1248.8 bits (3230), Expect = 0.000e+0
Identity = 640/968 (66.12%), Postives = 786/968 (81.20%), Query Frame = 2
Query:  116 MEP-VKEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKF-----------SSSSIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI-NSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQI------------SIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSK 2926
            M+P  +E ++ D+ K  E +L + E F+       +   T+P   K            S  S GD+RH +TEQEE+E+LL+E+++   +  RFE SP +V GG +RDYQIRGLNWLI LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ IC +GD++ R+  IR++++P +WDV VTSYEM IKEKS  KKF++ YL IDEAHRIKNEKSKLSEIVR FKS NRLL+TGTPLQNNLHELWALLNFL+P++F S+ +FD  F+  N L ++ LV+RLH+VLKPFLLRRIK DVEK LPPKKEIKIY+GLS +QRE YTKILMKDID++N +G K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV+LDKLL KLKEQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ER+             +I+ +N P S KF+FMLSTRAGGLGINLA+ADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLIT+NTVEERI+ RAE+KL+LD+IVIQQGRL++Q++N+L K E+L MI++GA ++F SK++++ DEDI  +L RGE+KTAEMN++L ++GES+LR  + D ++S    +Y FEGEDYREK   K  M  WI+PPKRERKANYAVD YF++ALR++EPK PKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   L + EEQ KI  AE LT  E  E+E+LL QGFT WTKRDF QFIKANEKYGRDDI++I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ARY+APFHQLRIQYGT+KGKNYTEEEDRFLICMLHK+GFD++NVY+ LR  VR APQFRFDWFI+SRTA+E QRRC+TLI+LIE+E  ++EE+ R  K
Sbjct:   79 MDPEYEEKMKADRAKRFEFLLKQTELFAHFIQPSAQKSPTSPLNMKLGRPRIKKDEKQSLISAGDYRHRRTEQEEDEELLSESRKTSNVCIRFEVSPSYVKGGPLRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDARAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVLNSSG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVSNSGKMVVLDKLLAKLKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDGQTPHEEREDKFLEVEFLGQREAIEAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEEMLQMIRHGATHVFASKESELTDEDITTILERGEKKTAEMNERLQKMGESSLRNFRMDIEQS----LYKFEGEDYREK--QKLGMVEWIEPPKRERKANYAVDAYFREALRVSEPKIPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPR-NPDIPNPALAQREEQKKIDGAEPLTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAKIARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAMEFQRRCNTLISLIEKENMEIEERERAEK 1038          
BLAST of SWI:SNF matrix associated vs. TrEMBL
Match: A0A5J4P1W5 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Paragonimus westermani OX=34504 GN=DEA37_0000106 PE=4 SV=1)

HSP 1 Score: 1438.71 bits (3723), Expect = 0.000e+0
Identity = 707/940 (75.21%), Postives = 825/940 (87.77%), Query Frame = 2
Query:  161 IECILSKAEQFSKLKDGGTTPSKNKFSSSSI--------------GDHRHSXXXXXXXXXXXXXXXXX-VIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDN-DESG-VYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKG 2929
            ++ +++KAE FSK+K  G+  +K   S   I              GDHRH +TE EE+E+LL++TK   + V RFE SP+FV GGEMRDYQ+RGLNW+IQL+  + NGILADEMGLGKTLQTI+M+GY+KH R+ PGP+LII PKSTL NW+NE  RWVP+++ I L+G  E RS+ IR+ IL ++WDV+VTSYEMCIKEK+ L+KF+YIY+ IDEAHRIKNEKSKLSEIVR F+SQNRLLITGTPLQNNLHELW+LLNFLMPE+FASS  FDDLF ++S +E+ LVQRLH+VLKPFLLRRIKADVEK+LPPKKE KIYIGLS +QRELYTKILMKDID+VN  G K D+VRLLNILMQLRKC NHPYLFDG+EPGPPYTTD HLV+NCGKM+LLDKLL +LKEQGSR+L+FSQMTRMLDILEDYCLWR +DY RLDGST H++RQ+ IDE+N+PGS KF+FMLSTRAGGLGINLATADVVI++DSDWNPQVDLQA DRAHRIGQTKTVRVFRLITENTVEERII RAEMKL+LDN+VIQQGRLVEQK+NQL K ++L+MIKYGANYIFRSKD+D++DEDID++LARGEQ+TAEMN+KL  LGESNLR LKFD  +ESG  +S Y FEGEDYREK      ++GWI+PPKRERKANYAVD YF++ALR++EPKAPK PRPPKQP+VQDFQFFPPRLFELLDKEIYAFRKSIGY VP+   A P+AE ER+EEQ +I EAE L E E+ E+E LL QGFT W+KRDF QFIKANEK+GRDD+E+IS DVEGKTPEEVK+Y+RVFW+RCNELQDV+K+++QIERGEAKIQRR A+KRALDLKMARYRAPFHQLRIQYGTNKGKNY EEEDRFLICMLHKLGFD+DNVYD+LRLAVRLAPQFRFDWF+RSRTA+ELQRRCSTLITLIERE+CD++++S++ +G
Sbjct:   15 LDSLIAKAEVFSKIKSSGSADAKTLTSPLKITPELLIHSPTSDLAGDHRHRRTEHEEDEELLSDTKHGGMAVQRFETSPFFVKGGEMRDYQVRGLNWMIQLHHDNINGILADEMGLGKTLQTIAMLGYMKHCRHKPGPNLIIVPKSTLSNWMNELNRWVPTLRAISLMGSIEERSQTIRDDILTKEWDVLVTSYEMCIKEKAVLRKFHYIYVIIDEAHRIKNEKSKLSEIVRQFRSQNRLLITGTPLQNNLHELWSLLNFLMPELFASSDLFDDLFKLSSDQEQNLVQRLHAVLKPFLLRRIKADVEKKLPPKKECKIYIGLSKMQRELYTKILMKDIDIVNSTGNKVDRVRLLNILMQLRKCCNHPYLFDGLEPGPPYTTDQHLVDNCGKMMLLDKLLTRLKEQGSRVLIFSQMTRMLDILEDYCLWRAHDYFRLDGSTRHEDRQVYIDEFNRPGSTKFIFMLSTRAGGLGINLATADVVIIFDSDWNPQVDLQAMDRAHRIGQTKTVRVFRLITENTVEERIIMRAEMKLRLDNLVIQQGRLVEQKSNQLQKGDVLEMIKYGANYIFRSKDSDLKDEDIDIILARGEQRTAEMNEKLATLGESNLRALKFDTPEESGAAFSAYYFEGEDYREKHQKGSGLEGWIEPPKRERKANYAVDAYFREALRVSEPKAPKPPRPPKQPNVQDFQFFPPRLFELLDKEIYAFRKSIGYKVPRNPDAGPDAERERLEEQMRIDEAEPLNEDELMEKELLLSQGFTNWSKRDFHQFIKANEKHGRDDLEAISLDVEGKTPEEVKRYARVFWTRCNELQDVDKHMAQIERGEAKIQRRAAVKRALDLKMARYRAPFHQLRIQYGTNKGKNYVEEEDRFLICMLHKLGFDRDNVYDDLRLAVRLAPQFRFDWFLRSRTAMELQRRCSTLITLIEREMCDIDDRSKQPRG 954          
BLAST of SWI:SNF matrix associated vs. TrEMBL
Match: A0A4Z2DMP6 (Putative global transcription activator SNF2L1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_011064 PE=4 SV=1)

HSP 1 Score: 1429.08 bits (3698), Expect = 0.000e+0
Identity = 731/984 (74.29%), Postives = 849/984 (86.28%), Query Frame = 2
Query:  161 IECILSKAEQFSKLKDGG------TTPSKNKF-------SSSSIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDN-DESGV-YSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEE--KSRKSKGGNHAPESSGGQLVSKNSGSHTSKHKAG----EDELSVPNKKKK 3046
            ++ ++ KAE ++++K  G      T+P + K        +S   GDHRH +TE+EE+E+LLTETK  V  + RFE SP++V GGEMRDYQIRGLNW+IQL+ ++ NGILADEMGLGKTLQTI+++GY+KHYR+  GPH++I PKSTL NW+NEF RWVPS++ + LIG+QE RS+ I+E+IL ++WDVIVTSYEMCIKEK+ LKKF++IYL IDEAHRIKNEKSKLSEIVR F+SQNRLLITGTPLQNNLHELWALLNFLMP++F+SS  FDD+F  N+  E++LVQRLH+VL+PFLLRRIKADVEKRLPPKKE KIYIGLS +QRELYTKILMKDIDLVN  G K D+VRLLNILMQLRKC NHPYLFDG+EPGPPYTTDYHLV+NCGK++LLDKLL KLKEQGSR+LLFSQMTRM+DILEDYCLWR Y+Y RLDGST H+ERQ+SIDE+N+PGS KFLFMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQTKTVRVFRLITE+TVEERII RAEMKLKLDN+VIQQGRLVEQK+NQL K+++LDMI++GANYIFRSKD+D +DEDID++LARGEQ+TAEMN+KL +LGESNLR LKFD  DE+G   SVY +EGEDYREK      +DGWI+PPKRERKANYAVD YF++ALR++EPKAPK PRPPKQP+VQDFQFFPPRLFELLDKEIYAFRKSIGY VP+   A P+ E ER++EQ +I E+E LTE E+AE+EELL QGFT W+KRDFQQFIKANEK+GRDD+E+IS DVEGKTPEEVK+Y+RVFW+RCNELQDV+K+++QIERGEAKIQRR A+KRALDLKMARYRAPFHQLRIQYGTNKGKNY EEEDRFLICMLHKLGFD+DNVYD+LRLAVRLAPQFRFDWF+RSRTA+ELQRRCSTLITLIEREICDLE+  K R   G N+ P +      S  S     K K        E+S   KKKK
Sbjct:   23 LDLLVEKAELYTQVKLIGSGTKDLTSPPRIKSEQPISSPTSYVFGDHRHRRTEKEEDEELLTETKHGVSAIQRFEASPWYVKGGEMRDYQIRGLNWMIQLHHNNINGILADEMGLGKTLQTIALLGYIKHYRHKNGPHIVIVPKSTLSNWMNEFVRWVPSLRAVSLIGNQEERSQKIQEEILKKEWDVIVTSYEMCIKEKAVLKKFHFIYLIIDEAHRIKNEKSKLSEIVRDFRSQNRLLITGTPLQNNLHELWALLNFLMPDLFSSSEMFDDMFKTNNDHEDSLVQRLHAVLRPFLLRRIKADVEKRLPPKKECKIYIGLSKMQRELYTKILMKDIDLVNSVGNKVDRVRLLNILMQLRKCCNHPYLFDGMEPGPPYTTDYHLVDNCGKLMLLDKLLPKLKEQGSRVLLFSQMTRMMDILEDYCLWRGYEYFRLDGSTRHEERQVSIDEFNRPGSTKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRLITEHTVEERIIMRAEMKLKLDNLVIQQGRLVEQKSNQLQKDDVLDMIRHGANYIFRSKDSDFKDEDIDIILARGEQRTAEMNEKLAQLGESNLRSLKFDTADENGAPTSVYIYEGEDYREKQSRTSLLDGWIEPPKRERKANYAVDAYFREALRVSEPKAPKPPRPPKQPNVQDFQFFPPRLFELLDKEIYAFRKSIGYKVPRNPDAGPDGERERLDEQARIDESEPLTEDEIAEKEELLTQGFTNWSKRDFQQFIKANEKHGRDDLEAISVDVEGKTPEEVKRYARVFWTRCNELQDVDKHMAQIERGEAKIQRRAAVKRALDLKMARYRAPFHQLRIQYGTNKGKNYVEEEDRFLICMLHKLGFDRDNVYDDLRLAVRLAPQFRFDWFLRSRTAMELQRRCSTLITLIEREICDLEDRTKQRSGAGTNNLPATPVNSGPSNASTVSNQKRKPTPSDPTSEISGNPKKKK 1006          
BLAST of SWI:SNF matrix associated vs. TrEMBL
Match: A0A4E0RLR9 (SWI:SNF matrix associated OS=Fasciola hepatica OX=6192 GN=D915_000815 PE=4 SV=1)

HSP 1 Score: 1424.07 bits (3685), Expect = 0.000e+0
Identity = 693/924 (75.00%), Postives = 801/924 (86.69%), Query Frame = 2
Query:  329 VNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDE--SGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQLVSKNS-----------GSHTSKHKAGEDELSV-PNKKKK 3046
            V RFE SP+FV GGEMRDYQ+RGLNW+IQL+  + NGILADEMGLGKTLQTISM+GY+KH R   GP LII PKSTL NW+NE  RWVP+++P+ LIG QE R++VIR++I+ ++WDV+VTSYE+CI+EK+ L+KF+YIYL IDEAHRIKNEKSKLS+IVR F+SQNRLLITGTPLQNNLHELWALLNFLMP++FASS  FDD+F  NS +E+ L+QRLH+VLKPFLLRRIKADVEKRLPPKKEIKIYIGLS +QR+LYTKILMKDIDLVN        ++D+VRLLNILMQLRKC NHPYLFDG+EPGPPYTTD HL+ENCGKMVLLDKLL +LKEQGSR+L+FSQMTR+LDILEDYCLWR +DY RLDGST H++RQ+ IDEYN+PGS KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQTKTVRVFRLITENTVEERII RAEMKL+LDN+VIQQGRLVEQK NQL K E+LDMIK+GANYIFR+KD+D +DEDID++LARGEQ+TAEMN+KL +LGESNLR LKFD  E      S Y FEGEDYREK      ++GWI+PPKRERKANYAVD YF++ALR++EPKAPK PRPPKQP+VQDFQFFPPRLFELLDKEIYAFRKSIGY VP+   A P+AE ER+E+Q +I EAE LTE E+ E+E+LL QGFT W+KRDFQQFIKANEK+GRDD+E+IS DVEGKTPEEVK+Y+RVFW+RCNELQDV+K+++QIERGEAKIQRR AIKRALDLKMARYRAPFHQLRIQYG NKGKNY EEEDRFLICMLHKLGFD+DNVYD+LRLAVRLAPQFRFDWF+RSRTA+ELQRRCSTLITLIEREICD+++++++ +GG     +  G   + N             +   K KA E   +V PN KK+
Sbjct:   88 VQRFESSPFFVKGGEMRDYQVRGLNWMIQLHQDNINGILADEMGLGKTLQTISMLGYMKHCRQKSGPSLIIVPKSTLSNWMNEIKRWVPTLRPVALIGMQEERNQVIRDEIVGKEWDVLVTSYEICIREKAVLRKFHYIYLIIDEAHRIKNEKSKLSDIVRQFRSQNRLLITGTPLQNNLHELWALLNFLMPDLFASSELFDDMFKTNSEQEQNLIQRLHAVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSKMQRDLYTKILMKDIDLVNSMINVNANRADRVRLLNILMQLRKCCNHPYLFDGLEPGPPYTTDMHLIENCGKMVLLDKLLARLKEQGSRVLIFSQMTRLLDILEDYCLWRGHDYFRLDGSTRHEDRQVYIDEYNRPGSTKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRLITENTVEERIIMRAEMKLRLDNLVIQQGRLVEQKANQLQKGEVLDMIKFGANYIFRTKDSDFKDEDIDIILARGEQRTAEMNEKLAKLGESNLRSLKFDTPEELGPATSAYYFEGEDYREKHRGTA-LEGWIEPPKRERKANYAVDAYFREALRVSEPKAPKPPRPPKQPNVQDFQFFPPRLFELLDKEIYAFRKSIGYKVPRNPDAGPDAERERLEQQLRIDEAEPLTEEEVVEKEDLLSQGFTNWSKRDFQQFIKANEKHGRDDLEAISMDVEGKTPEEVKRYARVFWTRCNELQDVDKHMAQIERGEAKIQRRAAIKRALDLKMARYRAPFHQLRIQYGANKGKNYVEEEDRFLICMLHKLGFDRDNVYDDLRLAVRLAPQFRFDWFLRSRTAMELQRRCSTLITLIEREICDMDDRTKQQRGGGPGTNNQTGGPATTNDGSGTNSGSGGTAASAQKRKATEGGGAVEPNGKKR 1010          
BLAST of SWI:SNF matrix associated vs. TrEMBL
Match: A0A504YVC4 (SWI:SNF matrix associated OS=Fasciola gigantica OX=46835 GN=FGIG_02731 PE=4 SV=1)

HSP 1 Score: 1422.14 bits (3680), Expect = 0.000e+0
Identity = 692/924 (74.89%), Postives = 801/924 (86.69%), Query Frame = 2
Query:  329 VNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDE--SGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQLVSKNS-----------GSHTSKHKAGEDELSV-PNKKKK 3046
            V RFE SP+FV GGEMRDYQ+RGLNW+IQL+  + NGILADEMGLGKTLQTISM+GY+KH R   GP LII PKSTL NW+NE  RWVP+++P+ LIG QE R++VIR++I+ ++WDV+VTSYE+CI+EK+ L+KF+YIYL IDEAHRIKNEKSKLS+IVR F+SQNRLLITGTPLQNNLHELWALLNFLMP++FASS  FDD+F  NS +E+ L+QRLH+VLKPFLLRRIKADVEKRLPPKKEIKIYIGLS +QR+LYTKILMKDIDLVN        ++D+VRLLNILMQLRKC NHPYLFDG+EPGPPYTTD HL+ENCGKMVLLDKLL +LKEQGSR+L+FSQMTR+LDILEDYCLWR +DY RLDGST H++RQ+ IDEYN+PGS KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQTKTVRVFRLITENTVEERII RAEMKL+LDN+VIQQGRLVEQK NQL K E+LDMIK+GANYIFR+KD+D +DEDID++LARGEQ+TAEMN+KL +LGES+LR LKFD  E      S Y FEGEDYREK      ++GWI+PPKRERKANYAVD YF++ALR++EPKAPK PRPPKQP+VQDFQFFPPRLFELLDKEIYAFRKSIGY VP+   A P+AE ER+E+Q +I EAE LTE E+ E+E+LL QGFT W+KRDFQQFIKANEK+GRDD+E+IS DVEGKTPEEVK+Y+RVFW+RCNELQDV+K+++QIERGEAKIQRR AIKRALDLKMARYRAPFHQLRIQYG NKGKNY EEEDRFLICMLHKLGFD+DNVYD+LRLAVRLAPQFRFDWF+RSRTA+ELQRRCSTLITLIEREICD+++++++ +GG     +  G   + N             +   K KA E   +V PN KK+
Sbjct:   88 VQRFESSPFFVKGGEMRDYQVRGLNWMIQLHQDNINGILADEMGLGKTLQTISMLGYMKHCRQKSGPSLIIVPKSTLSNWMNEIKRWVPTLRPVALIGMQEERNQVIRDEIVGKEWDVLVTSYEICIREKAVLRKFHYIYLIIDEAHRIKNEKSKLSDIVRQFRSQNRLLITGTPLQNNLHELWALLNFLMPDLFASSELFDDMFKTNSEQEQNLIQRLHAVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSKMQRDLYTKILMKDIDLVNSMINVNANRADRVRLLNILMQLRKCCNHPYLFDGLEPGPPYTTDMHLIENCGKMVLLDKLLARLKEQGSRVLIFSQMTRLLDILEDYCLWRGHDYFRLDGSTRHEDRQVYIDEYNRPGSTKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRLITENTVEERIIMRAEMKLRLDNLVIQQGRLVEQKANQLQKGEVLDMIKFGANYIFRTKDSDFKDEDIDIILARGEQRTAEMNEKLAKLGESSLRSLKFDTPEELGPATSAYYFEGEDYREKHRGTA-LEGWIEPPKRERKANYAVDAYFREALRVSEPKAPKPPRPPKQPNVQDFQFFPPRLFELLDKEIYAFRKSIGYKVPRNPDAGPDAERERLEQQLRIDEAEPLTEEEVVEKEDLLSQGFTNWSKRDFQQFIKANEKHGRDDLEAISMDVEGKTPEEVKRYARVFWTRCNELQDVDKHMAQIERGEAKIQRRAAIKRALDLKMARYRAPFHQLRIQYGANKGKNYVEEEDRFLICMLHKLGFDRDNVYDDLRLAVRLAPQFRFDWFLRSRTAMELQRRCSTLITLIEREICDMDDRTKQQRGGGPGTNNQTGGPATANDGSGTNSGSGGTAASAQKRKATEGGGAVEPNGKKR 1010          
BLAST of SWI:SNF matrix associated vs. TrEMBL
Match: A0A5K3ETF1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1421.76 bits (3679), Expect = 0.000e+0
Identity = 703/977 (71.95%), Postives = 832/977 (85.16%), Query Frame = 2
Query:  149 KKKTIECILSKAEQFSKLKDGG-------TTPSKNKFSSSSIGDHRH--SXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKS--RKSKGGNHAPESSGGQLVSKNSGSHTSKHKAGEDELSVPNKKKK 3046
            KK+ ++ +L KA  F+ LK+ G       ++P+  + +  S  DHRH  ++ E++EE    T+   +  + RF+ +P++V GGEMRDYQIRGLNWLI L LS+TNGILADEMGLGKTLQTIS++GY+KHYR   GP L+I PKSTL NW+NE  +WVPS+ P+CLIG+ + R+RVIRE+ILP +WDV++TSYEMCIKEK+ L+++N++YL IDEAHRIKNEKSKLSE+VR F SQNRLLITGTPLQNNLHELWALLNFLMP+MFASS  FD+LFN  SL+EE+LV RLHS+L+PFLLRR+KADVEKRLPPKKEIKIYIGLS +QRELYTKILMKD+DLVN  G K+DKVRLLN+LMQLRKC NHPYLFDG+EPGPPYTTD HLV+NCGKMVLLDKLL KL+EQGSR+L+FSQMTR LDILEDYC+WR ++Y RLDG T HD+RQ+SIDE+N+PGS KF+FMLSTRAGGLGINLATADVV+LYDSDWNPQVDLQA DRAHRIGQTKTVRVFRLITENTVEERI+ RA+MKL LDN+VIQQGRLV+QK+NQL K E+LDMIK+GANYIFRSK++ I+DEDID +LARGEQKT+E+N+K  ++GESNLR L+FD +E    SVY F+GEDYR K  +   + GWI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP++QDFQFFPPRLFELLDKEIYAFRKSIGY VP+   A P+ E ER EEQ KI +A  L +AE+AE+EELL QGFT W+KRDFQQFIKANEK+GRDD+ESIS DVEGKTP+EVK+Y+RVFW+RC+ELQDV+K+++QIERGEAKIQRR A+KRALD+KMARYRAPFHQLRIQYG NKGKNYTEEEDRFLICMLHKLGFD+DNVYD+LRLA+RLAPQFRFDWFIRSRTA+ELQRRCSTLITLIERE+ D+E+KS  R    G     + GG   +  S     K K+     SVP + KK
Sbjct:   30 KKRRMQELLEKAAAFTALKETGGETSVALSSPTNQQTAPLSATDHRHRRTEKEEDEELLSETKRGSNATITRFDVTPWYVKGGEMRDYQIRGLNWLIGLGLSNTNGILADEMGLGKTLQTISLLGYVKHYRGKSGPFLVIVPKSTLSNWMNEVRKWVPSLHPVCLIGNADDRARVIREEILPGNWDVLITSYEMCIKEKALLRRYNFVYLIIDEAHRIKNEKSKLSEVVRMFNSQNRLLITGTPLQNNLHELWALLNFLMPQMFASSDTFDELFNSQSLQEESLVTRLHSILRPFLLRRVKADVEKRLPPKKEIKIYIGLSKMQRELYTKILMKDLDLVNSTGQKADKVRLLNVLMQLRKCCNHPYLFDGVEPGPPYTTDQHLVDNCGKMVLLDKLLKKLREQGSRVLIFSQMTRTLDILEDYCMWRGHEYFRLDGQTAHDDRQVSIDEFNRPGSSKFIFMLSTRAGGLGINLATADVVVLYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRLITENTVEERIVMRADMKLYLDNLVIQQGRLVDQKSNQLQKTEVLDMIKFGANYIFRSKESAIKDEDIDEILARGEQKTSELNEKYAKMGESNLRLLRFDTEEETPDSVYIFDGEDYRTKQQNSGALAGWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNIQDFQFFPPRLFELLDKEIYAFRKSIGYKVPRNPDAGPDGERERQEEQAKINDATPLDDAELAEKEELLTQGFTNWSKRDFQQFIKANEKHGRDDLESISLDVEGKTPDEVKRYARVFWARCSELQDVDKHMAQIERGEAKIQRRAAVKRALDIKMARYRAPFHQLRIQYGANKGKNYTEEEDRFLICMLHKLGFDRDNVYDDLRLAIRLAPQFRFDWFIRSRTAMELQRRCSTLITLIEREVVDMEDKSKQRGPTSGTATAGAVGGPGGALASSGVGQKRKSSSAITSVPVESKK 1006          
BLAST of SWI:SNF matrix associated vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 1259.2 bits (3257), Expect = 0.000e+0
Identity = 624/884 (70.59%), Postives = 765/884 (86.54%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGV-YSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            S+GD+RH +TEQEE+E+LL+E+++   ++ RFE+SP +V  G +RDYQIRGLNW+I LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVP++K +CLIGD++ R+  IR+ ++P +WDV VTSYEM I+EKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELW+LLNFL+P++F S+++FD  F+ N+ L ++ LV+RLH+VL+PFLLRRIK +VEK LPPKKE+KIY+GLS +QRE YT+ILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKM+ LDKLL K++EQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG+TPH++R+ +ID +N P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLITENTVEERI+ RAEMKL+LD+IVIQQGRL+EQ+ N+LGK+E+L MI++GA ++F SKD+++ +EDI  +L RG +KTAEMN+++++LGES+LR   F  D SG   S+Y FEGEDYREK   K  M  WI+PPKRERKANYAVD YF++ALR++EP+APKAPRPPKQP++QDFQFFPPRLFELL+ EI  +RK+IGY VPK       A++++ EEQ KI EAE LT  E  E+E+LL QGFT+W KRDF QFIKANEKYGRDDI+SI+ +VEGKTPEEV +YS VFW RCNELQD+E+ ++QIERGEA+IQRR++IK+ALD+K+ARY+APFHQLRIQYGTNKGKNYTEEEDRFLICMLHK+GFDK+NVY+ LR  VR APQFRFDWFI+SRTA+ELQRRC+TLI+LIE+E
Sbjct:   16 SVGDNRHRRTEQEEDEELLSESRKAANLLVRFEESPSYVKNGTLRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGDKDARAAFIRDVMMPGEWDVCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASDFDSWFDTNNCLGDQKLVERLHAVLRPFLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSAG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVTNSGKMLALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVIQQGRLIEQQ-NKLGKDEMLQMIRHGATHVFASKDSELTEEDISTILERGAKKTAEMNERMEKLGESSLRN--FTMDTSGAETSLYKFEGEDYREK--QKLSMMEWIEPPKRERKANYAVDAYFREALRVSEPRAPKAPRPPKQPNIQDFQFFPPRLFELLEMEILYYRKTIGYKVPKSPDIPNAAQVQK-EEQRKIDEAEPLTAEETEEKEKLLTQGFTSWNKRDFNQFIKANEKYGRDDIDSIAREVEGKTPEEVIEYSAVFWERCNELQDIERIMAQIERGEARIQRRISIKKALDVKIARYKAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKMGFDKENVYEELRQCVRNAPQFRFDWFIKSRTAMELQRRCNTLISLIEKE 892          
BLAST of SWI:SNF matrix associated vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 1254.2 bits (3244), Expect = 0.000e+0
Identity = 624/884 (70.59%), Postives = 765/884 (86.54%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGV-YSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            S+GD+RH +TEQEE+E+LL+E+++   ++ RFE+SP +V  G +RDYQIRGLNW+I LY +  NGILADEMGLGKTLQTI+++GYLKHYRN+PGPH+++ PKSTL NW+NEF RWVP++K +CLIGD++ R+  IR+ ++P +WDV VTSYEM I+EKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELW+LLNFL+P++F S+++FD  F+ N+ L ++ LV+RLH+VL+PFLLRRIK +VEK LPPKKE+KIY+GLS +QRE YT+ILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKM+ LDKLL K++EQGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG+TPH++R+ +ID +N P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFRLITENTVEERI+ RAEMKL+LD+IVIQQGRL+EQ+ N+LGK+E+L MI++GA ++F SKD+++ +EDI  +L RG +KTAEMN+++++LGES+LR   F  D SG   S+Y FEGEDYREK   K  M  WI+PPKRERKANYAVD YF++ALR++EP+APKAPRPPKQP++QDFQFFPPRLFELL+ EI  +RK+IGY VPK       A++++ EEQ KI EAE LT  E  E+E+LL QGFT+W KRDF QFIKANEKYGRDDI+SI+ +VEGKTPEEV +YS VFW RCNELQD+E+ ++QIERGEA+IQRR++IK+ALD+K+ARY+APFHQLRIQYGTNKGKNYTEEEDRFLICMLHK+GFDK+NVY+ LR  VR APQFRFDWFI+SRTA+ELQRRC+TLI+LIE+E
Sbjct:   16 SVGDNRHRRTEQEEDEELLSESRKAANLLVRFEESPSYVKNGTLRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGDKDARAAFIRDVMMPGEWDVCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASDFDSWFDTNNCLGDQKLVERLHAVLRPFLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSAG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVTNSGKMLALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVIQQGRLIEQQ-NKLGKDEMLQMIRHGATHVFASKDSELTEEDISTILERGAKKTAEMNERMEKLGESSLRN--FTMDTSGAETSLYKFEGEDYREK--QKLSMMEWIEPPKRERKANYAVDAYFREALRVSEPRAPKAPRPPKQPNIQDFQFFPPRLFELLEMEILYYRKTIGYKVPKSPDIPNAAQVQK-EEQRKIDEAEPLTAEETEEKEKLLTQGFTSWNKRDFNQFIKANEKYGRDDIDSIAREVEGKTPEEVIEYSAVFWERCNELQDIERIMAQIERGEARIQRRISIKKALDVKIARYKAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKMGFDKENVYEELRQCVRNAPQFRFDWFIKSRTAMELQRRCNTLISLIEKE 892          
BLAST of SWI:SNF matrix associated vs. Ensembl Cavefish
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:NCBI gene;Acc:103021645])

HSP 1 Score: 1240.71 bits (3209), Expect = 0.000e+0
Identity = 639/943 (67.76%), Postives = 769/943 (81.55%), Query Frame = 2
Query:  128 KEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSSSI-----------GDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDL 2902
            +E V+ D+    E +L + E F+       +   T+P K K     I           GD+RH +TEQEE+E+LL+E  +   +  RF+ SP +V  G++RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ +CLIGD++ R+  IR+ +LP +WDV VTSYEM I E++  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F SS +FD  F+ N+ L +  LV+RLH+VL+PFLLRRIKADVEK L PKKEIK+YIGLS +QRE YTKILMKDID++N AG K DK+RLLN+LMQLRKC NHPYLFDG EPGPPYTTD HLV N GKM +LDKLL KL EQGSR+L+FSQMTR+LDILEDYC+WR Y YCRLDG TPH+ERQISI+ +N+P S KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQ K VRVFR ITENTVEERI+ RAEMKL+LD+IVIQQGRLV+   N+LGK+E+L +I++GA ++F SK+++I DEDID +L RGE+KT EM +KL  LGES+LR    D +     SVYNFEGEDYREK   K  +  WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+       A++++ EEQ KI EAE L E E+ E+E LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK++VYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE  +L
Sbjct:   65 EEKVKTDRTNRFEYLLKQTEVFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSAGDNRHRRTEQEEDEELLSENSKASNVCTRFDDSPSYVKTGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLYNWMNEFKRWVPSLRAVCLIGDRDERTAFIRDTLLPGEWDVCVTSYEMLIIERAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFDSWFDTNNCLGDTKLVERLHTVLRPFLLRRIKADVEKSLLPKKEIKMYIGLSKMQREWYTKILMKDIDILNSAG-KMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVNSGKMAVLDKLLPKLNEQGSRVLIFSQMTRVLDILEDYCMWRNYGYCRLDGQTPHEERQISINAFNEPNSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQKKQVRVFRFITENTVEERIVERAEMKLRLDSIVIQQGRLVDPNMNKLGKDEMLSIIRHGATHVFASKESEITDEDIDAILERGEKKTMEMKEKLSNLGESSLRNFTMDTEN----SVYNFEGEDYREK---KKVITNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPELPNSAQVQK-EEQAKIDEAEPLNEEELEEKENLLSQGFTIWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDSKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKESVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMEL 998          
BLAST of SWI:SNF matrix associated vs. Ensembl Cavefish
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:NCBI gene;Acc:103021645])

HSP 1 Score: 1238.79 bits (3204), Expect = 0.000e+0
Identity = 639/943 (67.76%), Postives = 769/943 (81.55%), Query Frame = 2
Query:  128 KEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSSSI-----------GDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDL 2902
            +E V+ D+    E +L + E F+       +   T+P K K     I           GD+RH +TEQEE+E+LL+E  +   +  RF+ SP +V  G++RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ +CLIGD++ R+  IR+ +LP +WDV VTSYEM I E++  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F SS +FD  F+ N+ L +  LV+RLH+VL+PFLLRRIKADVEK L PKKEIK+YIGLS +QRE YTKILMKDID++N AG K DK+RLLN+LMQLRKC NHPYLFDG EPGPPYTTD HLV N GKM +LDKLL KL EQGSR+L+FSQMTR+LDILEDYC+WR Y YCRLDG TPH+ERQISI+ +N+P S KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQ K VRVFR ITENTVEERI+ RAEMKL+LD+IVIQQGRLV+   N+LGK+E+L +I++GA ++F SK+++I DEDID +L RGE+KT EM +KL  LGES+LR    D +     SVYNFEGEDYREK   K  +  WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+       A++++ EEQ KI EAE L E E+ E+E LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK++VYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE  +L
Sbjct:   65 EEKVKTDRTNRFEYLLKQTEVFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSAGDNRHRRTEQEEDEELLSENSKASNVCTRFDDSPSYVKTGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLYNWMNEFKRWVPSLRAVCLIGDRDERTAFIRDTLLPGEWDVCVTSYEMLIIERAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFDSWFDTNNCLGDTKLVERLHTVLRPFLLRRIKADVEKSLLPKKEIKMYIGLSKMQREWYTKILMKDIDILNSAG-KMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVNSGKMAVLDKLLPKLNEQGSRVLIFSQMTRVLDILEDYCMWRNYGYCRLDGQTPHEERQISINAFNEPNSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQKKQVRVFRFITENTVEERIVERAEMKLRLDSIVIQQGRLVDPNMNKLGKDEMLSIIRHGATHVFASKESEITDEDIDAILERGEKKTMEMKEKLSNLGESSLRNFTMDTEN----SVYNFEGEDYREK---KKVITNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPELPNSAQVQK-EEQAKIDEAEPLNEEELEEKENLLSQGFTIWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDSKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKESVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMEL 998          
BLAST of SWI:SNF matrix associated vs. Ensembl Cavefish
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:NCBI gene;Acc:103021645])

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 614/860 (71.40%), Postives = 730/860 (84.88%), Query Frame = 2
Query:  326 IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDL 2902
            +  RF+ SP +V  G++RDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ +CLIGD++ R+  IR+ +LP +WDV VTSYEM I E++  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F SS +FD  F+ N+ L +  LV+RLH+VL+PFLLRRIKADVEK L PKKEIK+YIGLS +QRE YTKILMKDID++N AG K DK+RLLN+LMQLRKC NHPYLFDG EPGPPYTTD HLV N GKM +LDKLL KL EQGSR+L+FSQMTR+LDILEDYC+WR Y YCRLDG TPH+ERQISI+ +N+P S KF+FMLSTRAGGLGINLATADVVI+YDSDWNPQVDLQA DRAHRIGQ K VRVFR ITENTVEERI+ RAEMKL+LD+IVIQQGRLV+   N+LGK+E+L +I++GA ++F SK+++I DEDID +L RGE+KT EM +KL  LGES+LR    D +     SVYNFEGEDYREK   K  +  WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+       A++++ EEQ KI EAE L E E+ E+E LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGKTPEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK++VYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE  +L
Sbjct:  132 VCTRFDDSPSYVKTGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLYNWMNEFKRWVPSLRAVCLIGDRDERTAFIRDTLLPGEWDVCVTSYEMLIIERAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFDSWFDTNNCLGDTKLVERLHTVLRPFLLRRIKADVEKSLLPKKEIKMYIGLSKMQREWYTKILMKDIDILNSAG-KMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVNSGKMAVLDKLLPKLNEQGSRVLIFSQMTRVLDILEDYCMWRNYGYCRLDGQTPHEERQISINAFNEPNSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQKKQVRVFRFITENTVEERIVERAEMKLRLDSIVIQQGRLVDPNMNKLGKDEMLSIIRHGATHVFASKESEITDEDIDAILERGEKKTMEMKEKLSNLGESSLRNFTMDTEN----SVYNFEGEDYREK---KKVITNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPELPNSAQVQK-EEQAKIDEAEPLNEEELEEKENLLSQGFTIWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDSKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKESVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMEL 982          
BLAST of SWI:SNF matrix associated vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 408/595 (68.57%), Postives = 490/595 (82.35%), Query Frame = 2
Query:  197 KLKDG-GTTPSKNKFSSSSIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQ--GRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDES 1966
            KLK G     +  K S  S+GD+RH +TEQEE+E+LL+E+++    + RFE+SP +V  G MRDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KHYRN+PGPH+++ PKSTL NW+ EF RWVPS++ +CLIGD++ R    +  + P +WDV VTSYEM I+EKS  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELW+LLNFL+P++F S+  F   F+ N+   ++ LV+RLH VL+PFLLRRIKADVEK LPPKKE KIYIGLS +QRE YTKILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD H+V N GKMV+LDKLL KL EQGSR+L+FSQMTRM+DILEDYC+WR Y+YCRLDG TPH++RQ+SI  +N P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFR ITE+TVE+RI+ RAEMKL+LD+IVIQQ  GRLV+Q  N+LGK+E+L MI+YGA  +F SK++ I DEDIDV+L RG +KTAEMN+K+ +LGE+ LR    D + S
Sbjct:   51 KLKPGRPRVKTDEKQSLLSVGDYRHRRTEQEEDEELLSESRKSANALLRFEESPSYVKCGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRVSASQPIVPPIEWDVCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWFDTNNCFGDQQLVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDILNSAG-KMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHIVINSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQGPGRLVDQVANKLGKDEMLQMIRYGATQVFSSKESQITDEDIDVILERGAKKTAEMNEKMSQLGENTLRTFTMDTESS 644          
BLAST of SWI:SNF matrix associated vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 391/553 (70.71%), Postives = 470/553 (84.99%), Query Frame = 2
Query:  248 SIGDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQ---GRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKT 1891
            S+GD RH +TEQEE+E+LL+E+K+   I  RFE+SP +V GG MRDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+KH+RN+ GPH+++ PKSTL NW+NEF RWVPS++ +CLIG+++ R          ++WDV VTSYE+ I+EKS  KKFN+ YL IDEAHRIKNEKSKLS+IVR FKS NRLL+TGTPLQNNLHELW+LLNFL+P++F SS +FD  F+ N+ L ++ LV+RLH VL+PFLLRRIKADVEK L PKKE+KIYIGLS +QRE YTKILMKDID++N AG K DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL KL+EQGSR+LLFSQMTRMLDILEDYC+W+ Y YCRLDG TPH++RQ +I  YN P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQTK VRVFR +TENTVEERI+ RAEMKL+LD+IVIQQ   GRL++Q+ N+LGK+E+L MI++GA ++F S+D++I DE+IDV+L RGE++ 
Sbjct:   94 SVGDFRHRRTEQEEDEELLSESKKATNICTRFEESPTYVKGGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIGNKDQRVATDENVYTKREWDVCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSDIVREFKSTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSEDFDSWFDTNNCLGDQELVERLHMVLRPFLLRRIKADVEKSLQPKKEVKIYIGLSKMQREWYTKILMKDIDILNSAG-KMDKLRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVNNSGKMVVLDKLLPKLQEQGSRVLLFSQMTRMLDILEDYCMWKGYGYCRLDGQTPHEDRQEAIAAYNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKRVRVFRFLTENTVEERIVERAEMKLRLDSIVIQQVCAGRLIDQQANKLGKDEMLQMIRHGATHVFASRDSEITDEEIDVVLERGEKRV 645          

HSP 2 Score: 224.557 bits (571), Expect = 9.039e-61
Identity = 99/126 (78.57%), Postives = 118/126 (93.65%), Query Frame = 2
Query: 2513 VFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE 2890
            VFW RCNELQD+E+ ++QIERGEA+IQRRV+IK+ALD K+ARYRAPF+QLRI YGTNKGKNYTEEEDRFL+CM+H+LGF+K++VYD LR  +R APQFRFDWFI+SRTA+ELQRRC+TLITLIERE
Sbjct:  817 VFWERCNELQDIERIMAQIERGEARIQRRVSIKKALDAKIARYRAPFYQLRISYGTNKGKNYTEEEDRFLVCMVHRLGFEKESVYDELRQCIRNAPQFRFDWFIKSRTAMELQRRCNTLITLIERE 942          
BLAST of SWI:SNF matrix associated vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004254.1 (pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 gene:ENSPMAG00000003871.1 transcript:ENSPMAT00000004254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 414.846 bits (1065), Expect = 4.454e-134
Identity = 228/527 (43.26%), Postives = 333/527 (63.19%), Query Frame = 2
Query:  440 ILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRV-----IREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYH-----LVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQ----GRLVEQKNNQ------LGKNEILDMIKYGANYIFRSKDTDIRDE----DIDVLLARGEQKTAEMNKKLDELGESNLRQLK 1948
            ILADEMGLGKT+QTIS + Y+ H   + GP L++ P ST+ +W  EF  W P +  +  +GD  +R+ +     I +Q     ++ +VT+YE+ +K+K+ L   N+ +L +DEAHR+KN+ S L + +  FK+  RLLITGTPLQN+L ELW+LL+F+MP+ F++  +FD +    S   +     LH  L+PFLLRR+K DVE+ LP K E  + + ++  Q+  Y  IL ++   ++  G +      LNI+M+L+KC NH YL   I+       D H     LV + GK++LLDKLL +L+E G R+L+FSQM RMLDIL DY   + + + RLDGS  +++R+ ++D +N  GS+ F F+LSTRAGGLGINLA+AD V+++DSDWNPQ DLQAQ RAHRIGQ K V ++RL+T  TVEE II RA+ K+ LD++VIQ+    G+ V QK +         K E+  ++K+GA  +F+  + + ++     DID +L R E +  + +  L   GE  L Q K
Sbjct:    7 ILADEMGLGKTIQTISFLSYMFHSHQVYGPFLLVVPLSTVTSWQREFATWAPEMNVVVYLGDMSSRNVIREYEWIHQQTKKLKFNALVTTYEILLKDKTVLGAVNWAFLGVDEAHRLKNDDSLLYKSLIEFKTNVRLLITGTPLQNSLKELWSLLHFIMPDKFSAWEDFDAVHGSGS---DNGYVSLHKELEPFLLRRVKKDVERSLPAKVEQILRVEMTPQQKHYYKWILTRNFKALS-KGTRGSTSGFLNIMMELKKCCNHCYL---IKLPEDENVDKHDALQSLVRSSGKLILLDKLLCRLRETGHRVLIFSQMVRMLDILADYLAMKHFPFQRLDGSIKNEQRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGKTVLQKGSAPSSSTPFNKEELASILKFGAEELFKEGEAEEQESQQEMDIDEILRRAETREND-DSLLPTAGEELLSQFK 525          
BLAST of SWI:SNF matrix associated vs. Ensembl Sea Lamprey
Match: SMARCA2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:HGNC Symbol;Acc:HGNC:11098])

HSP 1 Score: 433.721 bits (1114), Expect = 5.863e-131
Identity = 237/520 (45.58%), Postives = 328/520 (63.08%), Query Frame = 2
Query:  323 VIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQ----DWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN---------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFDGIEP------GPPYT--TDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMI 1798
             +  R E     ++ G ++ YQ++GL WL+ LY ++ NGILADEMGLGKT+QTI++I YL  ++ L GP LII P STL NW+ EF +W PSV  I   G     S + R   +PQ     ++V++T+YE  IK+K  L K  + Y+ +DE HR+KN   KL++++ T + +  RLL+TGTPLQN L ELWALLNFL+P +F S + F+  FN         ++  EEET+  ++RLH VL+PFLLRR+K +VE +LP K E  I   +S LQ+ LY  +  K + L +G+     GK     L+N ++QLRK  NHPY+F  IE       G P +      L    GK  LLD++L KL+    R+LLF QMT ++ I+EDY  +R + Y RLDG+T  ++R   +  +N+P S  F+F+LSTRAGGLG+NL  AD VI++DSDWNP  DLQAQDRAHRIGQ   VRV RL T N+VEE+I+A A+ KL +D  VIQ G + +QK++   +   L  +
Sbjct:  719 AVSERVECQSSLLVNGSLKMYQVQGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPFLIIVPLSTLSNWMMEFDKWGPSVVKISYKG-----SPIARRAFMPQLRSGKFNVLLTTYEYIIKDKHVLAKLRWKYMIVDEGHRMKNHHCKLTQVLNTHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFALTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKGGAKTLMNTIVQLRKIANHPYMFQHIEESFAEHLGFPNSIVQGADLFRASGKFELLDRILPKLRVSNHRVLLFCQMTSLMTIMEDYFAFRSFRYLRLDGTTKSEDRSNLLKTFNEPNSPYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAG-MFDQKSSGHERRAFLQAV 1232          
BLAST of SWI:SNF matrix associated vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008242.1 (pep scaffold:Pmarinus_7.0:GL480216:41002:47501:-1 gene:ENSPMAG00000007461.1 transcript:ENSPMAT00000008242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 377.867 bits (969), Expect = 1.211e-122
Identity = 205/323 (63.47%), Postives = 257/323 (79.57%), Query Frame = 2
Query: 1994 GEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQ 2962
            GEDY  KA  K +M  WI+PPKRERKANYAVD YF++ALR+ EPKAPKAPRPPKQPS+QDFQFFPPRLFELL+KEI  +RK+IGY VP+ +   P   + + EEQ KI  AESL E E+ E+E+LL QGFT W+KRDF QFIKANEK+GRDDI++I+ +VEGKTPE+V +YS +FW RCNELQD+E+ ++QIERGEA+IQRR+ IK+ALD K+ARY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHK+GFD+++VYD LR  +R APQF+FDWF++SRTA  + R  S ++ ++   +      + K++     P+SS  Q
Sbjct:    1 GEDY--KAKQKLNMTEWIEPPKRERKANYAVDAYFREALRVTEPKAPKAPRPPKQPSIQDFQFFPPRLFELLEKEILHYRKTIGYKVPR-NPDVPNPAVTQKEEQGKIDTAESLNEEELEEKEKLLTQGFTDWSKRDFNQFIKANEKWGRDDIDNIAQEVEGKTPEDVIEYSALFWDRCNELQDIERIMAQIERGEARIQRRIGIKKALDAKIARYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKMGFDRESVYDELRQCIRNAPQFKFDWFLKSRTA--MVRLPSFVVVMVTSHLPSPTSVAMKAERKRRGPKSSSAQ 318          
BLAST of SWI:SNF matrix associated vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 458/917 (49.95%), Postives = 614/917 (66.96%), Query Frame = 2
Query:  344 QSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEE--ETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSD-KVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLG--KNEILDMIKYGANYIFRSKDTDIR-DEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPP---KRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSV------QDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCD---------------------SATPEA-----ELERI--EEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKG-KNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREI----CDLEEKSRKSKGGNHAPES 2950
            +SP FV  G++RDYQ++GLNWLI L+ +  +GILADEMGLGKTLQTIS +GYL++ + + GP LII PKSTL NW  EF +W P+V  + L GD++TR+ ++R  IL   +DV++TSYEM I+EK+ LK+  + Y+ IDEAHRIKNE+S LS+I+R F S+NRLLITGTPLQNNLHELWALLNFL+P++F  S  FD+ F  N+ E+  E ++Q+LHSVL PFLLRR+KADVEK L PK E  +Y+G++ +Q + Y  +L KDID VNGA GK + K RLLNI+MQLRKC NHPYLF+G EPGPPYTTD HL+ N GKM++LDKLL +LKE+GSR+L+FSQM+R+LDILEDYC +R ++YCR+DGST H+ER  +IDEYNKP S+KF+F+L+TRAGGLGINL TAD VIL+DSDWNPQ DLQA DRAHRIGQ K V V+R +TEN +EE++I RA  KL+LD +VIQQG    +K   LG  K+++LDMI++GA  +F  K + +  D DID +L +GEQKT E+N K   LG  +L+  KF+  E+   S Y + G+ +++K+  K  +  WI P    +R  +  Y+VD Y+K+ +      A K    PK P        QDFQFFP  L  L +KE   F+K + Y V   D                     +A  E      EL+R   EEQ KI  A   T+ +   ++EL+ + FT W KRDF  FI A  KYGRDD+E+I   ++ KTPEEV+ Y+++FW R  E+   EKYL  +E GE K ++    +  L  K+ + + P H+L IQY  N   + Y   ED+FL+  ++K G   D +Y+ L+  + ++  F FDWFI++RT  EL +R  TL+TLI RE      + +++SR S      P S
Sbjct:  174 ESPSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIILEARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLIFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQG--TGKKTASLGNSKDDLLDMIQFGAKNMFEKKASKVTVDADIDDILKKGEQKTQELNAKYQSLGLDDLQ--KFNGIENQ--SAYEWNGKSFQKKSNDK--VVEWINPSRRERRREQTTYSVDDYYKEIIGGGSKSASKQTPQPKAPRAPKVIHGQDFQFFPKELDALQEKEQLYFKKKVNYKVTSYDITGDIRNEGSDAEEEEGEYKNAANTEGHKGHEELKRRIEEEQEKINSAPDFTQEDELRKQELISKAFTNWNKRDFMAFINACAKYGRDDMENIKKSIDSKTPEEVEVYAKIFWERLKEINGWEKYLHNVELGEKKNEKLKFQETLLRQKIEQCKHPLHELIIQYPPNNARRTYNTLEDKFLLLAVNKYGLRADKLYEKLKQEIMMSDLFTFDWFIKTRTVHELSKRVHTLLTLIVREYEQPDANKKKRSRTSATREDTPLS 1082          
BLAST of SWI:SNF matrix associated vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 452/938 (48.19%), Postives = 622/938 (66.31%), Query Frame = 2
Query:  335 RFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEET--LVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA-GGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGR--LVEQKNNQLGKNEILDMIKYGANYIFRSKDT-------------DIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELE--------RIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVE-GKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQY--GTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIERE-----ICDLEEKSRKSKGGNHAPESSGGQLVSKNSGSHTSKHKAGEDELSVPNKKKK 3046
            +F +SP +V  G++R YQI+G+NWL+ L+ +   GILADEMGLGKTLQTIS +GYL++   +PGP L+I PKSTL NW+ E  RW P V    L GD+E R+ +I++++L  D+DV++ SYE+ I+EKS LKK N+ Y+ IDEAHRIKNE+S LS+++R F S+NRLLITGTPLQNNLHELWALLNFL+P++F+ + +FDD F+  S EE+   +V++LH+VL+PFLLRRIK+DVE  L PKKE+ +Y+G+S +Q++ Y KIL KD+D VNG+ G K  K RLLNI+MQLRKC NHPYLFDG EPGPPYTTD HLV N  K+ +LDKLL KLKE+GSR+L+FSQM+R+LDILEDYC +R Y+YCR+DGST H++R  +ID+YN P SKKF+F+L+TRAGGLGINL +ADVV+LYDSDWNPQ DLQA DRAHRIGQ K V+VFRL+T+N+VEE+I+ RA  KL+LD +VIQQ R  L +++N    K+ +L MI++GA  +F+S  +                D D+D LL + E KT  +N K + LG  +L+  KF+ D     S Y + G+D+++K          + P KRERK NY++D Y+KD L       P  PR PK       Q  PP+L  L +KE     K  GYV    D      ++             +  +  ++ LTE E   + +   +GFT W K +F++FI  + KYGR+ I++I+ ++  GKT EEV+ Y++ FWS    ++D EKYL  IE  E KI+R    + AL  K++ Y+ PF  L++++   +N  + Y+EEEDRF++ ML K G D+D+VY+ +R  +R  P F  D++ RSRT +EL RR +TL+  +E+E     + D   K R  K      E   G+ + +     T+  K   D   V +KK K
Sbjct:  184 QFRESPAYV-NGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQNRTSLKKKENKADSKDALLSMIQHGAADVFKSGTSTGSAGTPEPGSGEKGDDIDLDELLLKSENKTKSLNAKYETLGLDDLQ--KFNQD-----SAYEWNGQDFKKKIQRDIISPLLLNPTKRERKENYSIDNYYKDVLNTGRSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKK------EDENGKRIREEFADQTANEKENVD--GVESKKAK 1105          
BLAST of SWI:SNF matrix associated vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 458.373 bits (1178), Expect = 7.094e-141
Identity = 255/587 (43.44%), Postives = 358/587 (60.99%), Query Frame = 2
Query:  335 RFEQ---SPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQIL----------PQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEP------GPPYTTDYH----LVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQ---KNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDI---DVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYR 2008
            RFE+    P F+ GGE+RD+Q+ G+NW+  L+    NGILADEMGLGKT+QT++ I +L   R   GPH+I+ P ST+  W++ F +W P +  IC +G+Q++R   IRE                ++V++T+YE  +K+++ L    + ++A+DEAHR+KN +S L E + +FK  NR+LITGTPLQNN+ EL AL+NFLMP  F      D  F     E+E  +  LH  ++PF+LRR+K DVEK LP K E  + + LS +Q E Y  IL K+   +  AG K     LLNI+ +L+K +NHPYLFD  E       G    T  +    L+ + GKMVLLD+LL +LK+ G R+L+FSQM RMLDIL DY   +  ++ RLDG+ P  +R+ISID +N P S  F+F+LSTRAGGLGINL TAD V+++DSDWNPQ DLQA  RAHRIGQ   V V+RL++++TVEE ++ RA  K+ L+  +I  G        K N+    E+  ++K+GA  +F + D   + ED+   DVL        AE +    +LGES+L   +F         +  FE  DY+
Sbjct:  360 RFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRD-TIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEID--FENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALT-AGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVL------NHAEDHVTTPDLGESHLGGEEF---------LKQFEVTDYK 927          
BLAST of SWI:SNF matrix associated vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 442.195 bits (1136), Expect = 8.771e-134
Identity = 256/619 (41.36%), Postives = 378/619 (61.07%), Query Frame = 2
Query:  338 FEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN-----------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLL---NILMQLRKCTNHPYLFDGIEP--GPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDI------RDEDIDVLLARGEQKTA-------EMNKKLDELG-------ESNLRQL-------KFDNDESGVYSVYNFEGEDYREKAVSKFDM--DGWIQ 2050
             ++ P  ++GG ++DYQI+GL W++ L+ +  NGILADEMGLGKT+QTIS++ YL   +N+ GP+L+I P STL NW +EF +W P+++ I   G    R +  + +I   ++DV++T++E  IKE++ L K  ++++ IDE HR+KN +SKLS  + T + +  RL++TGTPLQNNL ELWALLNF++P++F S  +FD+ FN           I   EEETL  ++RLH VL+PFLLRR+K DVEK LP K E  +   +S LQ+ +Y ++L K   L  G       V L    N +MQL+K  NHP++F+ +E    P   T+  +    GK  LLD++L KLK  G R+L+F QMT+++DI+ED+  +    Y RLDG T  DER   +  +N P S+   F+LSTRAGGLG+NL TAD VI++D+DWNP  DLQAQDRAHRIGQ   VR+ RLIT N+VEE I+ RA  KL +D  VIQ G+  + K+    +  +L  +        + +++ +      +D +I+ +LAR +++ A       + +KK +ELG       +S L  +       +   +ES   +VYN  G   R+ A    +M  + W++
Sbjct:  755 IKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNER-KAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQML-KYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKF-DNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRSKKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLR 1370          
BLAST of SWI:SNF matrix associated vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 432.95 bits (1112), Expect = 2.881e-132
Identity = 235/494 (47.57%), Postives = 323/494 (65.38%), Query Frame = 2
Query:  326 IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLS-EIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNI---NSLEEE----------TLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGG----KSDKVRLLNILMQLRKCTNHPYLFDGIEP--GPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRL 1747
            I  + ++ P  ++GG +++YQ+RGL W++ LY +  NGILADEMGLGKT+Q+IS+I YL   +   GP L+I P ST+ NW  EF +W PS+  I   G    R   ++ QI   ++DV++T+YE  IK+KS L K ++ ++ IDE HR+KN +SKLS  I   ++++NRL++TGTPLQNNL ELWALLNF++P++F S+  F+D FN    N+  +E           +++RLH VL+PFLLRR+K +VEK LP K E  I   LS LQ++LY ++ +K   L  GAG     K     L N +MQLRK  NHP++FD +E    P       L    GK  LLD++L K K  G R+L+F QMT+++DI+ED+   +   Y RLDGST  +ER   ++ +N P S  F F+LSTRAGGLG+NL TAD VI++D+DWNP  DLQAQDRAHRIGQ   VR+ RLIT ++VEE I+ RA  KL +D  VIQ G+ 
Sbjct:  454 IKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQR-HSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQM-LKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDLLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKF 945          
BLAST of SWI:SNF matrix associated vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 1229.54 bits (3180), Expect = 0.000e+0
Identity = 630/928 (67.89%), Postives = 764/928 (82.33%), Query Frame = 2
Query:  146 DKKKTIECILSKAEQFSKLKD--GG----TTPSKNK---FSS-----SSIGDHRHSXXXXXXXXXXXXXXX-XXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSL-EEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLI 2881
            D+      +L K E F+   +  GG    T+P K K   F S     S  GDHRH +TEQEE+E+LL +TK     +  FE+SP ++ GGEMRDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTIS++GY+K++RN+PGPH++I PKSTL NW+ EF RW PS++ +CLIG+QE R+  IR+ +LP +WDV VTSYEM I+EK+  KKF + Y+ IDEAHRIKNEKSKLSEIVR  +S NRLL+TGTPLQNNLHELWALLNFL+P++F+SS +FD  FN N+L EE+ LV+RLHSVL+PFLLRR+K+DVEKRL PKKE K+Y GL+ +QR  YTKILMKDID+VNGAG K+DK+RLLNILMQLRKC NHPYLFDG EPGPPYTTD HL+EN GKM +LDKLL +LK++GSR+L+FSQMTR+LDILEDYCLWR+YDYCRLDG TPH+ERQ  I+ +N PGS KF+FMLSTRAGGLGINLATAD+VILYDSDWNPQVDLQA DRAHRIGQ K V+VFR I+E+TVEERII RAEMKL+LD +VIQQGRLV+  N ++GK E+L MI++GA  +F SKD DI DEDID +LA+GE+KTAEM +K+   GE  LR+L  D   +   S+++FEGEDY+EK  S      WI+PPKRERKANYAVDQYF++ALR++EPKAP+APRPPKQP+VQD+QFFP RLFELLDKEIYAFRKSIGY VP  D   PE   ++ E Q  I E+E LTE E +E+++LL +GFT W+KR+F QFIKA EKYGRDD+++I  +VEGKTP+EV++Y+ VFW R +ELQD+E+ ++QIERGE+KIQRR++IK+ALD KMARYR+PFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGF+K+NVYD LR+A R APQFRFDWF++SRTA ELQRRC+TLITLI
Sbjct:   53 DRATRFNFLLEKTEIFAHFMNPSGGRKQPTSPLKMKAPAFPSRQRKVSECGDHRHRRTEQEEDEELLNQTKGAQTSILHFEESPNYIKGGEMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRTAFIRDTMLPGEWDVCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWFNSNNLVEEKQLVERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKILMKDIDVVNGAG-KTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDVHLIENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQGRLVD-PNLKVGKEEMLSMIRHGAEAVFASKDEDITDEDIDAILAKGEKKTAEMEEKMKTYGEGALRKLTLD---APTESIFHFEGEDYKEKQKSGSSFPRWIEPPKRERKANYAVDQYFREALRVSEPKAPRAPRPPKQPNVQDYQFFPTRLFELLDKEIYAFRKSIGYKVP-LDIEDPEGPDKQKEAQKLIDESEPLTEEEQSEKDQLLQEGFTNWSKREFNQFIKACEKYGRDDMDNICQEVEGKTPQEVREYAAVFWERNDELQDLERIMAQIERGESKIQRRISIKKALDAKMARYRSPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFEKENVYDELRMACRSAPQFRFDWFLKSRTAQELQRRCNTLITLI 974          
BLAST of SWI:SNF matrix associated vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 421.009 bits (1081), Expect = 2.416e-132
Identity = 227/527 (43.07%), Postives = 330/527 (62.62%), Query Frame = 2
Query:  335 RFEQSPYFV--IGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRV---------------IREQILPQD----WDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDG--IEPGPPYTTDYH---LVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDT 1837
            R+E+ P ++   GG++ +YQ  GLNWL   +   TN ILADEMGLGKT+QTIS +  L    +  GP L+  P STL NW  EF  W P +  +   GD+E+R+ +               ++   L +D    + V++TSYE+   + ++L+  ++  L +DEAHR+KN +SK    +  +    +LL+TGTPLQNNL ELW LL FL P  F +  NF  L   +++ +E  +++LH +L P +LRR+KADV K +P K E+ + + LS +Q++ Y  IL ++ + +N  G +  +V LLN++M+L+KC NHPYLF    +E     +  Y    L E  GK++LL K+L KL+EQG R+L+FSQMTRMLD+LED+     Y Y R+DGS     RQ +ID +N P S+ F F+LSTRAGGLGINLATAD V +YDSDWNP  D+QA  RAHRIGQ   V ++R +T ++VEERI   A+ K+ L ++V++ G L   K   + K+E+ D++K+G + +F+  DT
Sbjct:  243 RYEKQPAYLDETGGKLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIGYKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNF--LTEFDNVAKEDQIKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTRNFEALNTKGAQ--QVSLLNVMMELKKCCNHPYLFHAAALEAKRTQSGGYEPNSLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVRPG-LGSNKATIMSKSELDDILKFGTSELFKDDDT 764          
BLAST of SWI:SNF matrix associated vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 431.795 bits (1109), Expect = 3.020e-130
Identity = 223/490 (45.51%), Postives = 313/490 (63.88%), Query Frame = 2
Query:  344 QSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN---------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYH--------LVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQG 1741
            + P  ++GG +++YQ+ GL W++ L+ ++ NGILADEMGLGKT+QTI++  YL   + L GP L+I P STL NW  EF +W PS   +   G    R R     +    ++V++T+YE  +++K+ L K  + Y+ +DE HR+KN   KL++++ T + +Q+R+L+TGTPLQN L ELWALLNFL+P +F S + F+  FN         +   EEET+  ++RLH VL+PFLLRR+K +VE +LP K E  +   +SILQR LY  +  K + L +G+     GK     L+N +MQLRK  NHP++F  IE        +H        +    GK  LLD++L KLK    R+L+F QMT ++ ILEDY  W+ + Y RLDG+T  ++R   +  +N   S  F+F+LSTRAGGLG+NL  AD V+++DSDWNP  DLQAQDRAHRIGQ K VRV RL+T N+VEE+I+A A  KL +D  VIQ G
Sbjct:  636 EQPSMLVGGRLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLNGPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPNMR-RSAGAVLRTGKFNVVLTTYEYVMRDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESIAEHLGFHGGIVTGPDIYRASGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVIQAG 1124          
BLAST of SWI:SNF matrix associated vs. Ensembl Nematostella
Match: EDO31943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF7])

HSP 1 Score: 404.445 bits (1038), Expect = 1.072e-125
Identity = 234/571 (40.98%), Postives = 348/571 (60.95%), Query Frame = 2
Query:  365 GGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDW---DVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMF--ASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEIL--DMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVY----SVYNFEGEDYREKA----VSKFD 2032
            G  +R YQ+ G+ W+    L+    IL DEMGLGKT+QTIS++  LK      G  L+++P S + NW NE  R+  S+K + LIG +E R   I +  L QD    DV++TSYE+C++E S L++F++  +A+DEAHR+KN +S L   +  FK    +L+TGTP+QNNL EL++LL+F+ P +F       F+  F   +   +     L  +L PFLLRR+K++V   LP K E+ +Y G+S LQ++ Y  ILMKD D+ +  G   +K+   +IL  LRKC NHPYLFDG+EP  P+    HL+   GK+  +D+LL+ L ++G ++L+FSQMTRMLDI++DY  +R Y Y RLDGS   +ER I+I  +N+     F+F+LST+AGG G+NL +AD VI  DSD+NPQ DLQA  RAHRIGQT+ V++ RL+  NTVEE I+  A+ K++L N VI+ G++ +          +L  +++K+G   +F S++  +      + L  G  +      + D+  + +L  L  + +  G      S+Y +EG DY + A    V+ FD
Sbjct:   13 GITLRPYQLEGVGWMRDCALTGHGCILGDEMGLGKTIQTISVLLLLKRTIKHTGLFLVLSPLSVMANWKNEIKRFTKSLKVLSLIGSKEERE--ITKNKLFQDIKNIDVLLTSYEICLRETSFLQRFHWSAVAVDEAHRLKNSQSLLYTELIQFKYDFSILLTGTPVQNNLKELYSLLSFIAPSIFDLEYVEEFETAFKNLATGRDNTNSDLPQLLSPFLLRRVKSEVMVDLPEKSEVILYAGMSELQKKYYKAILMKDYDIFSTDGPSRNKLN--SILTNLRKCVNHPYLFDGVEP-EPFALGEHLITASGKLHAIDQLLSYLYKRGHKVLMFSQMTRMLDIVQDYLGYRGYAYERLDGSVRGEERYIAIKNFNEE-QDNFIFLLSTKAGGQGLNLMSADTVIFVDSDYNPQNDLQAAARAHRIGQTRPVKIIRLVGRNTVEEIILKHADDKMRLTNNVIEGGQVYDSSKIVASYRTLLLANILKFGLEKLFESEERYV------IYLILGASRNGRWIVE-DKTPKPDLETLSTNQELQGTVNHFTSMYVYEGRDYSKGASDEDVAAFD 570          
BLAST of SWI:SNF matrix associated vs. Ensembl Nematostella
Match: EDO47298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN4])

HSP 1 Score: 413.69 bits (1062), Expect = 7.643e-125
Identity = 234/544 (43.01%), Postives = 328/544 (60.29%), Query Frame = 2
Query:  332 NRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRW--------VPSVKPICLIGDQETRSRVIREQILPQ--DWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDID-LVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEP------GPPYTTDYH---LVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQ--KNNQLGKNEILDMIKYGANYIFRSKDTD----IRDEDIDVLLARGEQ 1885
            ++ E SP +     +R+YQ+ G+NWL+  + +  N ILADEMGLGKT+Q+I+ +  ++ Y  + GP+L+I P ST+ NW  EF  W          S     LI + E   R    Q +P    + V++T+YE+ I +   L    +  + IDEAHR+KN   KL E +   + ++R+L+TGTPLQNN+ EL++LLNFL P  F S   F  L     L+ E+ V +L  +LKP +LRR+K DVEK + PK+E  I + L+ +Q++ Y  IL ++   L  G    ++   L+N +M+LRKC NHP+L  G E       G  +  D H   ++E  GK+VL+ KLL KLK  G ++L+FSQM R LDILEDY +  KY Y R+DG    + RQ +ID ++KP S +F+F+L TRAGGLGINL  AD VI++DSDWNPQ DLQAQ R HRIGQ+++V+V+RLIT N+ E  +  RA MKL LD  V+Q     E    N Q+ K EI D++K GA      +D D      +EDID +L R  Q
Sbjct:  215 HKLETSPVYKDENTLREYQLEGVNWLMFCWCNRQNSILADEMGLGKTIQSIAFLFEMQRY-GIRGPNLVIAPLSTISNWQREFESWNDINAVVYHGSASSRHLIQEYEFYYRDEHGQPIPNIFKFQVLITTYEIIIADNMQLSTVPWRAVIIDEAHRLKNRNCKLLEGLNNLQMEHRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAF--LMEFGDLKTESQVDKLKQLLKPMMLRRLKEDVEKNIAPKEETIIEVELTTVQKKFYRAILERNFAFLAKGTSSTANVPNLMNTMMELRKCCNHPFLITGAEEKILQEYGREHV-DRHTHAMIEASGKLVLIHKLLPKLKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQSRSVKVYRLITRNSYEREMFDRASMKLGLDKAVLQSMNTKENAGNNGQMSKREIEDLLKRGAYGAIMEEDNDDASKFCEEDIDQILERRTQ 754          
BLAST of SWI:SNF matrix associated vs. Ensembl Medaka
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:NCBI gene;Acc:101161213])

HSP 1 Score: 1244.57 bits (3219), Expect = 0.000e+0
Identity = 640/943 (67.87%), Postives = 774/943 (82.08%), Query Frame = 2
Query:  128 KEIVEFDKKKTIECILSKAEQFSKL-----KDGGTTPSKNKFSSSSI-----------GDHRHSXXXXXXXXXXXXXXXXXV-IVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINS-LEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDL 2902
            +E V+ D+    E +L + E F+       +   T+P K K     I           GD+RH +TEQEE+E+LL E+ +   +  RF+ SP +V  G+MRDYQ+RGLNWLI LY +  NGILADEMGLGKTLQTI+++GY+KHYRN+PGPH+++ PKSTL NW+NEF RWVPS++ +CLIGD+  R+ +IR+ +LP +WDV VTSYEM I EK+  KKFN+ YL IDEAHRIKNEKSKLSEIVR FK+ NRLL+TGTPLQNNLHELWALLNFL+P++F SS +FD  F+ N+ L ++ LV+RLH+VL+PFLLRRIKADVEK L PKKE+KIY+GLS +QRE YTKILMKDID++N AG K DK+RLLN+LMQLRKC NHPYLFDG EPGPPYTTD HLV N GKMV+LDKLL K+K QGSR+L+FSQMTR+LDILEDYC+WR Y+YCRLDG TPH+ERQISI+ YN+P S KF+FMLSTRAGGLGINLATADVVILYDSDWNPQVDLQA DRAHRIGQ K VRVFR ITENTVEERI+ RAEMKL+LD+IVIQQGRLV+   N+LGK+E+L +I++GA ++F SKD++I D+DID +L RGE+KT EM +KL  LGES+LR    D + S   SVY FEGEDYREK   K  +  WI+PPKRERKANYAVD YF++ALR++EPKAPKAPRPPKQP+VQDFQFFPPRLFELL+KEI  +RK+IGY VP+       A++++ EEQ KI EAE+L+E E+ E+E LL QGFT W KRDF QFIKANEK+GRDDIE+I+ +VEGK+PEEV +YS VFW RCNELQD+EK ++QIERGEA+IQRR++IK+ALD K+ RY+APFHQLRI YGTNKGKNYTEEEDRFLICMLHKLGFDK++VYD LR  +R +PQFRFDWF++SRTA+ELQRRC+TLITLIERE  +L
Sbjct:   67 EEKVQTDRTNRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSAGDNRHRRTEQEEDEELLNESTKTTNVCTRFDDSPSYVKAGKMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTIALLGYMKHYRNIPGPHMVLVPKSTLYNWMNEFKRWVPSLRAVCLIGDRNERTALIRDVLLPGEWDVCVTSYEMLIIEKAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFDSWFDTNNCLGDQKLVERLHTVLRPFLLRRIKADVEKTLLPKKEVKIYVGLSKMQREWYTKILMKDIDILNSAG-KMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVNSGKMVVLDKLLPKMKVQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQISINAYNEPNSTKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQQKQVRVFRFITENTVEERIVERAEMKLRLDSIVIQQGRLVDPSANKLGKDEMLSIIRHGATHVFASKDSEITDDDIDAILERGERKTMEMKEKLSSLGESSLRNFTMDTENS---SVYTFEGEDYREK---KKVITNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPDLPNSAQVQK-EEQAKIDEAEALSEEELEEKENLLQQGFTIWNKRDFNQFIKANEKWGRDDIENIAREVEGKSPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDSKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKESVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMEL 1001          
BLAST of SWI:SNF matrix associated vs. Ensembl Medaka
Match: chd1l (chromodomain helicase DNA binding protein 1 like [Source:NCBI gene;Acc:101159810])

HSP 1 Score: 439.113 bits (1128), Expect = 5.910e-138
Identity = 236/553 (42.68%), Postives = 353/553 (63.83%), Query Frame = 2
Query:  365 GGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSA--NFDDLFN--INSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGR--LVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDY 2005
            G ++R YQ+ G+ WLIQ   +    IL DEMGLGKT QTI ++ Y+       GP ++++P S L+NW  E   + PS+  +C  GD++ R+  ++ Q   QD+ V++T+YE+C+K+ S L+++ +  L +DEAHR+KN  S L + +  F    R+L+TGTP+QN+L EL++LL+F+ P +FA++   +F D ++  I+ L + T    L SVL+PFLLRRIK++V   LP K E+ +Y G+S LQ++ Y  ILM+D+D      G   K RLLNILM LRKC +HPYLFDG+EP  P+    HL+E  GK+ LLD +L  L + G R+LLFSQMTRMLDIL+DY  +R Y Y RLDGS   +ER +S+  ++      F+F+LST+AGG+GINL  AD VI  DSD+NPQ DLQA  R HRIGQ + V+  RL+  +TVEE + +RA  KL+L N VIQ GR  L++Q ++     ++ +++K+G + +  S ++ ++D ++  +           ++ L  + E    + + ++DE  +  +Y FEG DY
Sbjct:   32 GIQLRGYQLDGVQWLIQNLQNQQGCILGDEMGLGKTCQTIGLLVYVSGALGKKGPFMVLSPLSVLENWRKELESFAPSLTVLCYQGDKDRRAE-MQLQASSQDFQVLLTTYELCLKDASFLRRWRWEVLVVDEAHRLKNPNSLLHQTLSEFSVDFRVLLTGTPIQNSLQELYSLLSFIQPSIFAANDVDSFVDYYSRVISLLSKAT---ELQSVLEPFLLRRIKSEVAVDLPKKTELVVYHGMSALQKKYYKAILMRDLDAFGNEQGS--KNRLLNILMNLRKCVDHPYLFDGVEP-EPFEIGEHLIEASGKLCLLDNMLAYLHKGGHRVLLFSQMTRMLDILQDYMEYRGYSYERLDGSVRGEERNLSVKNFST--KDIFVFLLSTKAGGVGINLTAADTVIFVDSDFNPQNDLQAAARCHRIGQNRPVKQIRLLARDTVEEIMYSRAASKLQLTNTVIQDGRFSLLDQAHSAAAGVQLSEILKFGVDKLLSSDESSVQDVNLQNIFGSSRGGQWVDDEDLKAVAEEEEEEERPESDE--LNHMYIFEGVDY 573          
BLAST of SWI:SNF matrix associated vs. Ensembl Medaka
Match: ENSORLT00000004949.2 (transcription activator BRG1 [Source:NCBI gene;Acc:101162023])

HSP 1 Score: 443.736 bits (1140), Expect = 2.603e-135
Identity = 235/522 (45.02%), Postives = 330/522 (63.22%), Query Frame = 2
Query:  323 VIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRT-FKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFN---------INSLEEETL--VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGA----GGKSDKVRLLNILMQLRKCTNHPYLFD--------------GIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMI 1798
             +  + E+    +I G+++ YQI+GL WL+ LY ++ NGILADEMGLGKT+QTI++I YL  ++ L GP+LII P STL NW+ EF +W PSV  +   G    R R    Q+    ++V++T+YE  IK+K  L K  + Y+ +DE HR+KN   KL++++ T + +  R+L+TGTPLQN L ELWALLNFL+P +F S + F+  FN         ++  EEET+  ++RLH VL+PFLLRR+K +VE +LP K E  I   +S LQR LY  +  K + L +G+     GK     L+N +MQLRK  NHPY+F               GI  GP       L    GK  +LD++L KL+    ++LLF QMT ++ I+EDY  +R + Y RLDG+T  ++R + +  +N P S+ F+F+LSTRAGGLG+NL +AD V+++DSDWNP  DLQAQDRAHRIGQ   VRV RL T N+VEE+I+A A+ KL +D  VIQ G + +QK++   +   L  I
Sbjct:  640 AVTEKVEKQSTLLINGQLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYEFDKWAPSVVKVSYKGSPAAR-RAFVPQLRSGKFNVLLTTYEYIIKDKQVLAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYLAPRRVLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSSLQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQQIEESFSEHLGFSGGIVQGP------DLYRASGKFEVLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRTFKYLRLDGTTKAEDRGMLLKTFNSPESEYFIFLLSTRAGGLGLNLQSADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAG-MFDQKSSSHERRAFLQAI 1153          
BLAST of SWI:SNF matrix associated vs. Ensembl Medaka
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:101160654])

HSP 1 Score: 446.432 bits (1147), Expect = 4.239e-134
Identity = 253/590 (42.88%), Postives = 364/590 (61.69%), Query Frame = 2
Query:  371 EMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRV-----IREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTD---YHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQ----GRLVEQKN------NQLGKNEILDMIKYGANYIFR---SKDTDIRDEDIDVLLARGEQKTAEM-NKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKA 2074
            E+RDYQ+ GLNWL   +    + ILADEMGLGKT+QTIS + YL H   L GP L++ P STL +W  EF  W P +  +  IGD  +R  +     +  Q     ++ ++T+YE+ +K+K  L   N+ +L +DEAHR+KN+ S L + +  F+S +RLLITGTPLQN+L ELW+LL+FLMP+ F S  +F+D         +   Q LH VL+PFLLRR+K DVEK LP K E  + + ++  Q++ Y  IL ++   ++  G +      LNI+M+L+KC NH +L    E G           +V   GK+VLLDKLL +L+E+G+R+L+FSQM RMLDIL  Y   +++ + RLDGS   + R+ ++D +N  GS+ F F+LSTRAGGLGINLA+AD V+++DSDWNPQ DLQAQ RAHRIGQ K V ++RL+T+ TVEE II RA+ K+ LD++VIQ+    GR V   N      N   K E+  ++K+GA  +F+    ++++ ++ DID +L   E + ++  +   DEL    L Q K  N  S   + + FE     E+ V ++D    I P ++ RKA
Sbjct:  461 ELRDYQLDGLNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFETWAPDMNVVVYIGDVMSRKTIRDYEWVNHQTKRIRFNALITTYEILLKDKGVLGNINWAFLGVDEAHRLKNDDSLLYKTLMEFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFDSWEDFEDEHGKG---RDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMTAQQKQFYKWILTRNYKALS-KGTRGSSSGFLNIVMELKKCCNHCFLIKQPEDGDGEVQQDVLQGVVRGSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAKYLTKKRFPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDSNSGNTNSNPFNKEELTAILKFGAEDLFKEAEGEESEPQEMDIDEILRLAETRESDQGSSATDEL----LSQFKVANFSSMEETTHEFE-----ERPVREWDD---IIPEEQRRKA 1034          
BLAST of SWI:SNF matrix associated vs. Ensembl Medaka
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:101160654])

HSP 1 Score: 446.817 bits (1148), Expect = 5.652e-134
Identity = 253/590 (42.88%), Postives = 364/590 (61.69%), Query Frame = 2
Query:  371 EMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRV-----IREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTD---YHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQ----GRLVEQKN------NQLGKNEILDMIKYGANYIFR---SKDTDIRDEDIDVLLARGEQKTAEM-NKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKA 2074
            E+RDYQ+ GLNWL   +    + ILADEMGLGKT+QTIS + YL H   L GP L++ P STL +W  EF  W P +  +  IGD  +R  +     +  Q     ++ ++T+YE+ +K+K  L   N+ +L +DEAHR+KN+ S L + +  F+S +RLLITGTPLQN+L ELW+LL+FLMP+ F S  +F+D         +   Q LH VL+PFLLRR+K DVEK LP K E  + + ++  Q++ Y  IL ++   ++  G +      LNI+M+L+KC NH +L    E G           +V   GK+VLLDKLL +L+E+G+R+L+FSQM RMLDIL  Y   +++ + RLDGS   + R+ ++D +N  GS+ F F+LSTRAGGLGINLA+AD V+++DSDWNPQ DLQAQ RAHRIGQ K V ++RL+T+ TVEE II RA+ K+ LD++VIQ+    GR V   N      N   K E+  ++K+GA  +F+    ++++ ++ DID +L   E + ++  +   DEL    L Q K  N  S   + + FE     E+ V ++D    I P ++ RKA
Sbjct:  502 ELRDYQLDGLNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFETWAPDMNVVVYIGDVMSRKTIRDYEWVNHQTKRIRFNALITTYEILLKDKGVLGNINWAFLGVDEAHRLKNDDSLLYKTLMEFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFDSWEDFEDEHGKG---RDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMTAQQKQFYKWILTRNYKALS-KGTRGSSSGFLNIVMELKKCCNHCFLIKQPEDGDGEVQQDVLQGVVRGSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAKYLTKKRFPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDSNSGNTNSNPFNKEELTAILKFGAEDLFKEAEGEESEPQEMDIDEILRLAETRESDQGSSATDEL----LSQFKVANFSSMEETTHEFE-----ERPVREWDD---IIPEEQRRKA 1075          
BLAST of SWI:SNF matrix associated vs. Planmine SMEST
Match: SMESG000013560.1 (SMESG000013560.1)

HSP 1 Score: 1944.47 bits (5036), Expect = 0.000e+0
Identity = 975/979 (99.59%), Postives = 977/979 (99.80%), Query Frame = 2
Query:  116 MEPVKEIVEFDKKKTIECILSKAEQFSKLKDGGTTPSKNKFSSSSIGDHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQLVSKNSGSHTSKHKAGEDELSVPNKKKKSV 3052
            ME VKEIVEFDKKKTIECILSKAEQFSKLKDGGTTPSKNKFSSSSIGDHRHSKTEQEE+EDLLTETKQDVIVNRFEQSPYFVIGGEMRDYQ+RGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRW PSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEPKAPKAPRPPKQPSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQLVSKNSGSHTSKHKAGEDELSVPNKKKKSV
Sbjct:    1 MESVKEIVEFDKKKTIECILSKAEQFSKLKDGGTTPSKNKFSSSSIGDHRHSKTEQEEDEDLLTETKQDVIVNRFEQSPYFVIGGEMRDYQVRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWAPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEPKAPKAPRPPKQPSVQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQLVSKNSGSHTSKHKAGEDELSVPNKKKKSV 979          
BLAST of SWI:SNF matrix associated vs. Planmine SMEST
Match: SMESG000017699.1 (SMESG000017699.1)

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 628/912 (68.86%), Postives = 751/912 (82.35%), Query Frame = 2
Query:  227 KNKFSSSSIGDHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKF---DNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXS-VQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPES 2950
            KN   + S  D+RH KTE+EE+++LL +  ++  V RFE +P++V GGEMRDYQIRGLNW+IQLYLS+ NGILADEMGLGKTLQTISMIGYLKH+    G  ++ITPKSTLQNW+NE  RW PS+  I LIGDQ+ R  +I  Q+  + WDV+VT+YEMCIKEKS +KK+NY+YLAIDEAHRIKNE SKLSEIVR F S++RLLITGTPLQNNLHELWALLNFLMP+ F+SS NFD+LFN + + E+  VQ+LHS+LKP+LLRR+K DVEK+LPPKKEIK+YIGLS +QRELYTKILMKD+D +N    K +K RL NILMQLRKCTNHPYLFDGIEPGPPYTTDYHLV NCGKM+LLDKLL++LK +GSR+L+F+QMTRMLDILEDYC WR ++YCRLDG T H +RQISID+YN P S KFLFMLSTRAGGLGINL +ADVVI+YDSDWNPQVDLQAQDRAHRIGQ KTVRVFRLITENTVEERII RAEMKLKLDNIVIQQGRLVE KNNQLGKN++L+MIK+GANYIFRSKD+DI+DEDIDVLLAR E KTAE++KK+DELGES+L  LKF    +D    YSVYNFEGE+Y++KA +K  +  WI+PPKRERKANYAVD YF+DA + ++ K+      P +   V DFQFFP RL ELLDKEIY FR+S+GY VPK DS   EA+ +R  EQ KI +AE LTE E+ E+++LL +GF  W K+DF  FIKANEK+GR++I  I   V GKTPEEVK+YS VFW R  E+ D EKYL QIE+GE K++R+   +RALDLK+A+Y  PFHQL+IQY  NKGK Y+E+EDRFLICMLHK G D ++VY+NLRLAVRLAPQFRF+WF+++RT+IELQRRC+TLI LIE+EIC+++    K    N + +S
Sbjct:    3 KNDEPTLSTEDNRHRKTEEEEDKELLNDNAKEDQVFRFESTPWYVSGGEMRDYQIRGLNWMIQLYLSNNNGILADEMGLGKTLQTISMIGYLKHFSGKKGHFIVITPKSTLQNWVNEINRWAPSLTSISLIGDQQARHEIIH-QLQTKQWDVLVTTYEMCIKEKSAIKKYNYVYLAIDEAHRIKNENSKLSEIVREFNSEHRLLITGTPLQNNLHELWALLNFLMPDEFSSSDNFDELFNNDKMAEQNQVQKLHSILKPYLLRRLKIDVEKKLPPKKEIKVYIGLSAIQRELYTKILMKDLDTLNSTAKKVEKTRLQNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVANCGKMILLDKLLSRLKAEGSRVLVFTQMTRMLDILEDYCRWRGHEYCRLDGQTQHSDRQISIDDYNSPNSTKFLFMLSTRAGGLGINLTSADVVIIYDSDWNPQVDLQAQDRAHRIGQKKTVRVFRLITENTVEERIIGRAEMKLKLDNIVIQQGRLVEHKNNQLGKNDLLEMIKHGANYIFRSKDSDIKDEDIDVLLARAEVKTAELSKKIDELGESSLSALKFDTAADDAGAAYSVYNFEGENYKDKANNKEPLINWIEPPKRERKANYAVDLYFQDAFKASDSKSSIRAPRPPKQPIVHDFQFFPSRLIELLDKEIYFFRQSVGYKVPKVDSDDKEAKKQRNAEQAKINKAEPLTEKEIVEKDQLLTEGFINWMKKDFLAFIKANEKWGRNNIIEICEQVPGKTPEEVKEYSLVFWKRFREINDYEKYLLQIEKGEMKLERKNMTRRALDLKVAQYEYPFHQLKIQYNGNKGKYYSEDEDRFLICMLHKFGIDNEDVYENLRLAVRLAPQFRFNWFVKARTSIELQRRCTTLINLIEKEICEIDNSRAKDVNNNKSRKS 913          
BLAST of SWI:SNF matrix associated vs. Planmine SMEST
Match: SMESG000017699.1 (SMESG000017699.1)

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 628/912 (68.86%), Postives = 751/912 (82.35%), Query Frame = 2
Query:  227 KNKFSSSSIGDHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKF---DNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXS-VQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPES 2950
            KN   + S  D+RH KTE+EE+++LL +  ++  V RFE +P++V GGEMRDYQIRGLNW+IQLYLS+ NGILADEMGLGKTLQTISMIGYLKH+    G  ++ITPKSTLQNW+NE  RW PS+  I LIGDQ+ R  +I  Q+  + WDV+VT+YEMCIKEKS +KK+NY+YLAIDEAHRIKNE SKLSEIVR F S++RLLITGTPLQNNLHELWALLNFLMP+ F+SS NFD+LFN + + E+  VQ+LHS+LKP+LLRR+K DVEK+LPPKKEIK+YIGLS +QRELYTKILMKD+D +N    K +K RL NILMQLRKCTNHPYLFDGIEPGPPYTTDYHLV NCGKM+LLDKLL++LK +GSR+L+F+QMTRMLDILEDYC WR ++YCRLDG T H +RQISID+YN P S KFLFMLSTRAGGLGINL +ADVVI+YDSDWNPQVDLQAQDRAHRIGQ KTVRVFRLITENTVEERII RAEMKLKLDNIVIQQGRLVE KNNQLGKN++L+MIK+GANYIFRSKD+DI+DEDIDVLLAR E KTAE++KK+DELGES+L  LKF    +D    YSVYNFEGE+Y++KA +K  +  WI+PPKRERKANYAVD YF+DA + ++ K+      P +   V DFQFFP RL ELLDKEIY FR+S+GY VPK DS   EA+ +R  EQ KI +AE LTE E+ E+++LL +GF  W K+DF  FIKANEK+GR++I  I   V GKTPEEVK+YS VFW R  E+ D EKYL QIE+GE K++R+   +RALDLK+A+Y  PFHQL+IQY  NKGK Y+E+EDRFLICMLHK G D ++VY+NLRLAVRLAPQFRF+WF+++RT+IELQRRC+TLI LIE+EIC+++    K    N + +S
Sbjct:   26 KNDEPTLSTEDNRHRKTEEEEDKELLNDNAKEDQVFRFESTPWYVSGGEMRDYQIRGLNWMIQLYLSNNNGILADEMGLGKTLQTISMIGYLKHFSGKKGHFIVITPKSTLQNWVNEINRWAPSLTSISLIGDQQARHEIIH-QLQTKQWDVLVTTYEMCIKEKSAIKKYNYVYLAIDEAHRIKNENSKLSEIVREFNSEHRLLITGTPLQNNLHELWALLNFLMPDEFSSSDNFDELFNNDKMAEQNQVQKLHSILKPYLLRRLKIDVEKKLPPKKEIKVYIGLSAIQRELYTKILMKDLDTLNSTAKKVEKTRLQNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVANCGKMILLDKLLSRLKAEGSRVLVFTQMTRMLDILEDYCRWRGHEYCRLDGQTQHSDRQISIDDYNSPNSTKFLFMLSTRAGGLGINLTSADVVIIYDSDWNPQVDLQAQDRAHRIGQKKTVRVFRLITENTVEERIIGRAEMKLKLDNIVIQQGRLVEHKNNQLGKNDLLEMIKHGANYIFRSKDSDIKDEDIDVLLARAEVKTAELSKKIDELGESSLSALKFDTAADDAGAAYSVYNFEGENYKDKANNKEPLINWIEPPKRERKANYAVDLYFQDAFKASDSKSSIRAPRPPKQPIVHDFQFFPSRLIELLDKEIYFFRQSVGYKVPKVDSDDKEAKKQRNAEQAKINKAEPLTEKEIVEKDQLLTEGFINWMKKDFLAFIKANEKWGRNNIIEICEQVPGKTPEEVKEYSLVFWKRFREINDYEKYLLQIEKGEMKLERKNMTRRALDLKVAQYEYPFHQLKIQYNGNKGKYYSEDEDRFLICMLHKFGIDNEDVYENLRLAVRLAPQFRFNWFVKARTSIELQRRCTTLINLIEKEICEIDNSRAKDVNNNKSRKS 936          
BLAST of SWI:SNF matrix associated vs. Planmine SMEST
Match: SMESG000017689.1 (SMESG000017689.1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 337/487 (69.20%), Postives = 398/487 (81.72%), Query Frame = 2
Query: 1502 MLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNNQLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFD---NDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRERKANYAVDQYFKDALRINEXXXXXXXXXXXXXS-VQDFQFFPPRLFELLDKEIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREELLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRVFWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFDWFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPES 2950
            MLSTRAGGLGINL +ADVVI+YDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERII RAEMKLKLDNIVIQQGRLVE KNNQLGKN++L+MIK+GANYIFRSKD+DI+DEDIDVLLAR E KTAE++KK+D LGES+L  LKFD   +D S  YSVYNFEGE+YR+KA +K  +  WI+PPKRERKANYAVD YFKDAL+ N+PK+      P +   V DFQFFP RL ELLDKEIY FRK+IGY VPK DS   EA+  R  EQ KI  AE +TE E+ E+++LL +GFT W K+DF  FIKANEK GR+++  I   V GKT +EVK+YS VFW R  E+ D EKYL QIERGE K++R+  I+RALDLKMA+Y++PFHQL+IQYG NKGKNY+EEEDRFL+CMLHK G D ++VY+NLRLAVRLAPQFRF+WF++SRT++ELQRRC+TLI LIE+EIC+++    K    N   +S
Sbjct:    1 MLSTRAGGLGINLTSADVVIIYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIGRAEMKLKLDNIVIQQGRLVEHKNNQLGKNDLLEMIKHGANYIFRSKDSDIKDEDIDVLLARAEVKTAELSKKIDALGESSLSALKFDTAADDGSAAYSVYNFEGENYRDKANNKEPLLNWIEPPKRERKANYAVDLYFKDALKQNDPKSSHKAPRPPKQPIVHDFQFFPSRLIELLDKEIYIFRKNIGYKVPKVDSDEKEAKKLRAIEQAKINRAEPMTEEEIVEKDQLLTEGFTNWAKKDFLAFIKANEKCGRNNMNEICEQVPGKTSKEVKEYSLVFWKRFREINDYEKYLLQIERGETKLERKNIIRRALDLKMAQYKSPFHQLKIQYGGNKGKNYSEEEDRFLMCMLHKFGIDNEDVYENLRLAVRLAPQFRFNWFVKSRTSLELQRRCTTLINLIEKEICEMDNSRPKDVNNNKLKKS 487          
BLAST of SWI:SNF matrix associated vs. Planmine SMEST
Match: SMESG000017691.1 (SMESG000017691.1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 287/400 (71.75%), Postives = 343/400 (85.75%), Query Frame = 2
Query:  257 DHRHSXXXXXXXXXXXXXXXXXVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQI 1456
            DHRH KTE+EE+++LL  + +   + RFE++P+++  GEMRDYQIRGLNWLIQLYLS+ NGILADEMGLGKTLQTISMIGYLKH+    G  L+ITPKSTLQNW+NE  RW PS+  I LIGDQ+ R  +I  Q+  + WDV+VT+YEMCIKEKST+KK++Y YLAIDEAHRIKNE SKLSEIVR F S+NRLLITGTPLQNNLHELWALLNFLMP+ F+SS NFD+LFN + + E+  VQ+LHS+LKP+LLRR+K DVEK+LPPKKEIK+YIGLS +QRELYTKILMKD+D +N A  K++K RL NILMQLRKCTNHPYLFDG+EPGPPYTTDYHLV NCGKM+LLDKLL++LK +GSR+L+F+QMTRMLDILEDYC WR ++YCRLDG T H +RQ+
Sbjct:   36 DHRHRKTEEEEDKELLNASAETDKLFRFEKTPWYIASGEMRDYQIRGLNWLIQLYLSNNNGILADEMGLGKTLQTISMIGYLKHHTEKKGHFLVITPKSTLQNWVNEINRWAPSLTSISLIGDQQARHEIIH-QLQTKQWDVLVTTYEMCIKEKSTIKKYSYAYLAIDEAHRIKNENSKLSEIVRQFNSENRLLITGTPLQNNLHELWALLNFLMPDEFSSSYNFDELFNTDKMAEQNQVQKLHSILKPYLLRRLKIDVEKKLPPKKEIKVYIGLSAIQRELYTKILMKDLDTLNSAANKAEKTRLQNILMQLRKCTNHPYLFDGVEPGPPYTTDYHLVANCGKMILLDKLLSRLKAEGSRVLVFTQMTRMLDILEDYCRWRGHEYCRLDGQTQHSDRQV 434          
The following BLAST results are available for this feature:
BLAST of SWI:SNF matrix associated vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA50.000e+072.03SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA10.000e+065.69SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA10.000e+064.89SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA10.000e+066.12SWI/SNF related, matrix associated, actin dependen... [more]
CHD22.038e-14243.77chromodomain helicase DNA binding protein 2 [Sourc... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
isw-10.000e+060.31Chromatin-remodeling complex ATPase chain isw-1 [... [more]
swsn-41.809e-13846.96SWI/SNF nucleosome remodeling complex component; S... [more]
pqn-152.280e-13344.74Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
chd-19.887e-13143.66Chromodomain and Helicase Domain protein [Source:... [more]
chd-39.748e-12641.71Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iswi0.000e+068.42gene:FBgn0011604 transcript:FBtr0087841[more]
Iswi0.000e+068.42gene:FBgn0011604 transcript:FBtr0087842[more]
Iswi0.000e+068.42gene:FBgn0011604 transcript:FBtr0087843[more]
brm1.788e-13545.12gene:FBgn0000212 transcript:FBtr0333580[more]
brm2.068e-13545.12gene:FBgn0000212 transcript:FBtr0075524[more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarca10.000e+063.77SWI/SNF related, matrix associated, actin dependen... [more]
smarca50.000e+068.19SWI/SNF related, matrix associated, actin dependen... [more]
chd1l1.857e-14144.12chromodomain helicase DNA binding protein 1-like [... [more]
SMARCA44.708e-13545.58transcription activator BRG1-like [Source:NCBI gen... [more]
smarca27.214e-13444.67SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mettl60.000e+072.16methyltransferase like 6 [Source:Xenbase;Acc:XB-GE... [more]
mettl60.000e+071.51methyltransferase like 6 [Source:Xenbase;Acc:XB-GE... [more]
mettl60.000e+071.86methyltransferase like 6 [Source:Xenbase;Acc:XB-GE... [more]
mettl60.000e+072.38methyltransferase like 6 [Source:Xenbase;Acc:XB-GE... [more]
anxa40.000e+067.39annexin A4 [Source:Xenbase;Acc:XB-GENE-854498][more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smarca50.000e+071.80SWI/SNF related, matrix associated, actin dependen... [more]
Smarca10.000e+065.29SWI/SNF related, matrix associated, actin dependen... [more]
Smarca10.000e+066.56SWI/SNF related, matrix associated, actin dependen... [more]
Smarca10.000e+066.56SWI/SNF related, matrix associated, actin dependen... [more]
Smarca10.000e+063.32SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI:SNF matrix associated vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24368|ISWI_DROME0.000e+068.42Chromatin-remodeling complex ATPase chain Iswi OS=... [more]
sp|O60264|SMCA5_HUMAN0.000e+072.03SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q91ZW3|SMCA5_MOUSE0.000e+071.80SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q6PGB8|SMCA1_MOUSE0.000e+066.56Probable global transcription activator SNF2L1 OS=... [more]
sp|P28370|SMCA1_HUMAN0.000e+066.12Probable global transcription activator SNF2L1 OS=... [more]
back to top
BLAST of SWI:SNF matrix associated vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P1W50.000e+075.21SWI/SNF-related matrix-associated actin-dependent ... [more]
A0A4Z2DMP60.000e+074.29Putative global transcription activator SNF2L1 iso... [more]
A0A4E0RLR90.000e+075.00SWI:SNF matrix associated OS=Fasciola hepatica OX=... [more]
A0A504YVC40.000e+074.89SWI:SNF matrix associated OS=Fasciola gigantica OX... [more]
A0A5K3ETF10.000e+071.95Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarca10.000e+070.59SWI/SNF-related matrix-associated actin-dependent ... [more]
smarca10.000e+070.59SWI/SNF-related matrix-associated actin-dependent ... [more]
smarca50.000e+067.76SWI/SNF related, matrix associated, actin dependen... [more]
smarca50.000e+067.76SWI/SNF related, matrix associated, actin dependen... [more]
smarca50.000e+071.40SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA50.000e+068.57SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA59.039e-6170.71SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000004254.14.454e-13443.26pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 ge... [more]
SMARCA25.863e-13145.58SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000008242.11.211e-12263.47pep scaffold:Pmarinus_7.0:GL480216:41002:47501:-1 ... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ISW20.000e+049.95ATP-dependent DNA translocase involved in chromati... [more]
ISW10.000e+048.19ATPase subunit of imitation-switch (ISWI) class ch... [more]
CHD17.094e-14143.44Chromatin remodeler that regulates various aspects... [more]
SNF28.771e-13441.36Catalytic subunit of the SWI/SNF chromatin remodel... [more]
STH12.881e-13247.57ATPase component of the RSC chromatin remodeling c... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407610.000e+067.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395852.416e-13243.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481163.020e-13045.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319431.072e-12540.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472987.643e-12543.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarca50.000e+067.87SWI/SNF related, matrix associated, actin dependen... [more]
chd1l5.910e-13842.68chromodomain helicase DNA binding protein 1 like [... [more]
ENSORLT00000004949.22.603e-13545.02transcription activator BRG1 [Source:NCBI gene;Acc... [more]
chd24.239e-13442.88chromodomain helicase DNA binding protein 2 [Sourc... [more]
chd25.652e-13442.88chromodomain helicase DNA binding protein 2 [Sourc... [more]
back to top
BLAST of SWI:SNF matrix associated vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013560.10.000e+099.59SMESG000013560.1[more]
SMESG000017699.10.000e+068.86SMESG000017699.1[more]
SMESG000017699.10.000e+068.86SMESG000017699.1[more]
SMESG000017689.10.000e+069.20SMESG000017689.1[more]
SMESG000017691.10.000e+071.75SMESG000017691.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013475 ID=SMED30013475|Name=SWI:SNF matrix associated|organism=Schmidtea mediterranea sexual|type=transcript|length=3208bp
CTTCACTGACAAAGAAAAACATTCAAAACATAGTACATTATTGTTTAAAC
GTATTAAACGTATTTCTATTTGACCGCATTATTATAAACGCTATTTTTGT
TTTTGAGTTATTGCAATGGAACCTGTTAAAGAAATAGTTGAATTTGATAA
AAAAAAAACAATTGAATGTATCTTATCTAAAGCAGAACAATTTAGCAAAT
TGAAAGATGGTGGAACAACTCCAAGTAAAAATAAATTCAGTTCTTCAAGT
ATTGGCGACCATCGTCACAGTAAGACCGAACAAGAAGAAGAGGAAGATTT
ATTGACAGAAACTAAGCAAGACGTTATTGTCAATAGATTTGAGCAGTCTC
CGTATTTTGTCATTGGCGGTGAAATGAGAGACTATCAAATTAGAGGATTA
AATTGGCTTATTCAACTATATTTATCTTCAACTAATGGAATATTAGCTGA
TGAAATGGGTCTCGGAAAAACCTTACAAACAATCTCAATGATTGGTTATT
TAAAACACTATCGTAATCTCCCGGGGCCTCATTTAATTATTACTCCGAAA
TCAACTTTACAAAATTGGATCAACGAATTTACTCGTTGGGTGCCGTCTGT
TAAACCAATATGTTTAATAGGCGATCAAGAAACTCGTAGTCGAGTAATAC
GTGAACAGATTTTGCCCCAAGATTGGGATGTAATTGTAACTAGTTATGAA
ATGTGCATTAAAGAAAAGAGTACATTAAAGAAATTTAATTATATATATTT
GGCAATCGATGAAGCTCATAGAATCAAAAACGAAAAGAGTAAATTATCGG
AAATTGTTCGCACTTTCAAATCGCAAAATCGTCTTCTTATTACTGGTACT
CCTTTACAAAACAATCTTCATGAACTATGGGCTCTTTTGAATTTTTTAAT
GCCTGAAATGTTTGCTTCGTCTGCAAATTTCGATGATCTTTTCAATATCA
ATTCTTTGGAGGAAGAAACACTGGTTCAACGTTTACATTCGGTTCTAAAA
CCATTTTTACTCCGAAGAATTAAAGCAGATGTTGAAAAGCGATTACCTCC
AAAAAAAGAAATTAAAATCTATATTGGATTAAGCATATTGCAAAGAGAAT
TATATACGAAAATTTTAATGAAAGATATAGATTTGGTTAACGGAGCTGGG
GGGAAATCAGATAAAGTGCGATTACTTAATATTTTGATGCAGCTTCGGAA
GTGTACAAATCATCCGTATTTGTTTGATGGAATTGAACCGGGACCACCGT
ATACCACAGATTATCATTTAGTAGAAAACTGTGGCAAAATGGTCCTTTTG
GATAAATTACTAAATAAATTGAAAGAACAAGGCTCACGAATTCTTCTTTT
CAGTCAAATGACAAGAATGCTGGATATTTTAGAAGATTATTGTTTATGGA
GGAAATATGATTATTGTCGTCTTGATGGCTCAACGCCACATGATGAAAGA
CAGATTTCTATAGATGAATACAATAAGCCTGGATCAAAAAAGTTTCTTTT
TATGTTATCAACTCGAGCCGGCGGTCTTGGAATCAACTTGGCAACTGCTG
ACGTTGTTATTTTATACGACAGTGATTGGAATCCCCAGGTTGATCTACAA
GCTCAAGACAGGGCTCATAGAATCGGTCAGACGAAAACCGTTCGTGTTTT
TCGTTTGATTACCGAAAATACGGTCGAAGAGCGAATAATTGCTCGCGCTG
AAATGAAACTCAAACTTGATAATATTGTTATTCAACAGGGACGACTTGTA
GAGCAGAAAAATAATCAATTAGGGAAAAATGAAATTTTGGATATGATTAA
ATATGGAGCTAATTATATATTCCGATCTAAAGACACCGACATTAGAGATG
AGGATATTGATGTTCTGCTTGCTAGAGGAGAACAAAAAACTGCTGAAATG
AACAAAAAATTAGATGAGCTCGGTGAGTCTAACTTACGCCAACTTAAATT
CGACAATGATGAAAGTGGAGTTTATTCGGTTTATAATTTTGAAGGCGAAG
ATTATCGAGAGAAAGCTGTTTCTAAATTTGACATGGATGGATGGATTCAA
CCTCCGAAAAGAGAACGTAAAGCCAATTATGCAGTTGATCAATACTTCAA
GGATGCATTACGCATCAATGAACCAAAAGCTCCAAAAGCTCCTCGACCAC
CTAAGCAACCAAGTGTTCAGGATTTTCAATTCTTTCCTCCACGCTTGTTT
GAACTGCTAGATAAAGAAATTTATGCATTTAGAAAAAGTATAGGCTATGT
TGTTCCTAAGTGTGACTCTGCCACTCCGGAAGCTGAATTGGAAAGAATTG
AAGAACAAAATAAAATATTTGAAGCAGAATCATTAACCGAAGCTGAAATG
GCGGAAAGAGAAGAACTATTAGTTCAAGGATTTACTACTTGGACCAAAAG
AGATTTCCAGCAGTTTATAAAAGCCAATGAAAAATATGGTCGAGATGACA
TTGAATCCATTTCAGGCGATGTCGAAGGAAAAACTCCAGAAGAAGTAAAG
AAATATTCTCGTGTTTTTTGGAGTCGTTGCAACGAGTTACAAGATGTGGA
AAAATATCTCTCGCAGATTGAACGAGGAGAAGCTAAAATTCAACGCAGAG
TAGCTATAAAACGAGCTTTGGATTTAAAAATGGCTCGATATAGGGCTCCT
TTTCATCAACTTCGAATACAATATGGAACAAATAAAGGAAAAAATTACAC
AGAAGAAGAAGATAGGTTTTTGATTTGTATGCTTCATAAATTAGGATTCG
ACAAGGACAATGTTTATGATAATTTGAGATTGGCTGTTCGATTAGCTCCT
CAATTTCGTTTTGATTGGTTTATACGCTCTCGAACTGCTATAGAACTTCA
GCGTCGCTGTTCAACACTCATTACATTGATCGAAAGGGAAATCTGTGATC
TGGAGGAAAAAAGTCGCAAATCGAAAGGTGGAAATCACGCACCAGAATCG
TCTGGCGGCCAACTCGTGTCTAAAAATAGTGGAAGTCATACTTCGAAGCA
TAAAGCTGGAGAAGATGAATTGTCGGTTCCAAATAAAAAAAAGAAAAGTG
TCTGATATATGTTTTCAATTTTTAAAGCATTTATTCTCTATTTTTACTGT
AACATTTGTAAATTAAATTCATATTATCTTGGTCTTTTTTAAATAGTTTA
TAAATTATTTCAATTCAAATGTGTAATGTTTTTTTAATATAAAATTCTGA
GAATTAAA
back to top

protein sequence of SMED30013475-orf-1

>SMED30013475-orf-1 ID=SMED30013475-orf-1|Name=SMED30013475-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=980bp
MEPVKEIVEFDKKKTIECILSKAEQFSKLKDGGTTPSKNKFSSSSIGDHR
HSKTEQEEEEDLLTETKQDVIVNRFEQSPYFVIGGEMRDYQIRGLNWLIQ
LYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQN
WINEFTRWVPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKE
KSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNN
LHELWALLNFLMPEMFASSANFDDLFNINSLEEETLVQRLHSVLKPFLLR
RIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDK
VRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLN
KLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISID
EYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRA
HRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVIQQGRLVEQKNN
QLGKNEILDMIKYGANYIFRSKDTDIRDEDIDVLLARGEQKTAEMNKKLD
ELGESNLRQLKFDNDESGVYSVYNFEGEDYREKAVSKFDMDGWIQPPKRE
RKANYAVDQYFKDALRINEPKAPKAPRPPKQPSVQDFQFFPPRLFELLDK
EIYAFRKSIGYVVPKCDSATPEAELERIEEQNKIFEAESLTEAEMAEREE
LLVQGFTTWTKRDFQQFIKANEKYGRDDIESISGDVEGKTPEEVKKYSRV
FWSRCNELQDVEKYLSQIERGEAKIQRRVAIKRALDLKMARYRAPFHQLR
IQYGTNKGKNYTEEEDRFLICMLHKLGFDKDNVYDNLRLAVRLAPQFRFD
WFIRSRTAIELQRRCSTLITLIEREICDLEEKSRKSKGGNHAPESSGGQL
VSKNSGSHTSKHKAGEDELSVPNKKKKSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038718SNF2-like_sf
IPR036306ISWI_HAND-dom_sf
IPR029915ISWI_metazoa
IPR001005SANT/Myb
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR009057Homeobox-like_sf
IPR015195SLIDE
IPR000330SNF2_N
IPR015194ISWI_HAND-dom
IPR017884SANT_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0016818hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0031491nucleosome binding
GO:0008324cation transmembrane transporter activity
GO:0016887ATPase activity
Vocabulary: biological process
TermDefinition
GO:0006338chromatin remodeling
GO:0043044ATP-dependent chromatin remodeling
GO:0006812cation transport
GO:0055085transmembrane transport
GO:0098655cation transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016589NURF complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001005SANT/Myb domainSMARTSM00717santcoord: 755..804
e-value: 3.6E-6
score: 36.5
coord: 857..921
e-value: 0.0055
score: 25.9
IPR001005SANT/Myb domainCDDcd00167SANTcoord: 758..797
e-value: 7.17491E-7
score: 44.4886
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 83..279
e-value: 6.2E-38
score: 142.0
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 99..264
score: 24.706
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 420..504
e-value: 7.1E-24
score: 95.3
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 392..504
e-value: 1.2E-18
score: 67.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 394..545
score: 19.935
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 755..809
e-value: 2.0E-24
score: 87.6
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 843..948
e-value: 1.1E-42
score: 146.2
NoneNo IPR availableGENE3DG3DSA:1.20.5.1190coord: 810..842
e-value: 1.2E-15
score: 59.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 307..604
e-value: 4.9E-123
score: 412.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 932..979
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 44..60
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 959..979
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 31..63
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 940..958
NoneNo IPR availablePANTHERPTHR10799SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY-RELATEDcoord: 34..920
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 389..515
e-value: 7.61581E-53
score: 178.824
NoneNo IPR availableCDDcd17997DEXHc_SMARCA1_SMARCA5coord: 84..303
e-value: 3.95656E-135
score: 402.856
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 88..302
e-value: 7.8E-70
score: 236.2
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 102..369
e-value: 1.5E-71
score: 241.0
IPR015194ISWI, HAND domainPFAMPF09110HANDcoord: 656..755
e-value: 4.8E-28
score: 98.1
IPR015195SLIDE domainPFAMPF09111SLIDEcoord: 812..925
e-value: 3.2E-40
score: 136.7
IPR036306ISWI, HAND domain superfamilyGENE3DG3DSA:1.10.1040.30coord: 647..754
e-value: 4.3E-39
score: 135.5
IPR036306ISWI, HAND domain superfamilySUPERFAMILYSSF101224HAND domain of the nucleosome remodeling ATPase ISWIcoord: 657..757
IPR029915ISWI family, metazoaPANTHERPTHR10799:SF819GLOBAL TRANSCRIPTION ACTIVATOR SNF2L1-RELATEDcoord: 34..920
IPR017884SANT domainPROSITEPS51293SANTcoord: 754..806
score: 17.856
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 759..808
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 810..935
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 303..586
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 70..301