endoplasmic reticulum-golgi intermediate compartment protein 3

Overview
Nameendoplasmic reticulum-golgi intermediate compartment protein 3 (AKG62102.1)
Smed IDSMED30013471
Length (bp)3722
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of endoplasmic reticulum-golgi intermediate compartment protein 3 (SMED30013471) t-SNE clustered cells

Violin plots show distribution of expression levels for endoplasmic reticulum-golgi intermediate compartment protein 3 (SMED30013471) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of endoplasmic reticulum-golgi intermediate compartment protein 3 (SMED30013471) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for endoplasmic reticulum-golgi intermediate compartment protein 3 (SMED30013471) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013471

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30013471h1SMcG0021026 Contig22889newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30013471h1SMcG0021026 dd_Smed_v4_8239_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Human
Match: ERGIC3 (ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:15927])

HSP 1 Score: 158.688 bits (400), Expect = 1.952e-41
Identity = 70/143 (48.95%), Postives = 105/143 (73.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  241 NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 383          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Human
Match: ERGIC3 (ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:15927])

HSP 1 Score: 159.073 bits (401), Expect = 2.044e-41
Identity = 70/143 (48.95%), Postives = 105/143 (73.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  246 NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 388          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Human
Match: ERGIC3 (ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:15927])

HSP 1 Score: 159.073 bits (401), Expect = 2.206e-41
Identity = 70/143 (48.95%), Postives = 105/143 (73.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  255 NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 397          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Human
Match: ERGIC3 (ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:15927])

HSP 1 Score: 127.872 bits (320), Expect = 9.869e-34
Identity = 60/127 (47.24%), Postives = 89/127 (70.08%), Query Frame = 1
Query: 3196 PLDNLKVNVEELSHMYTYYVKIVPTTYVKLNG------SVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGK 3558
            PLD+  V   + S M+ Y+VK+VPT Y+K++G       VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK
Sbjct:    2 PLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEAPLPPQVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGK 128          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Human
Match: ERGIC3 (ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:15927])

HSP 1 Score: 124.405 bits (311), Expect = 4.268e-32
Identity = 64/156 (41.03%), Postives = 90/156 (57.69%), Query Frame = 1
Query: 3145 HFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGS--------------------------------VLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIY 3516
            H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G                                 VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIY
Sbjct:    2 HYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEAQQERGRSRGGADGGWSQVLALALAQAPLPPQVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIY 157          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Celegans
Match: erv-46 (Yeast ERV (ER to Golgi transport Vesicle protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q93878])

HSP 1 Score: 125.561 bits (314), Expect = 1.380e-30
Identity = 64/147 (43.54%), Postives = 93/147 (63.27%), Query Frame = 1
Query: 3127 LQFNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSH-MYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            ++F+ SH +N ++FG  +PG   PLD  KVN +     MY YYVK+VPT Y  L+G V  ++QFSVT + K         GLPG F  Y+ +P+MV  +E  +SF  F+ +LCAIVGG+F ++ L+D  IYHSS+ +  ++  GKL+
Sbjct:  237 VKFDASHTVNHVSFGKSFPGKNYPLDG-KVNTDNRGGIMYQYYVKVVPTRYDYLDGRVDQSHQFSVTTHKKDLGFR--QSGLPGFFLQYEFSPLMVQYEEFRQSFASFLVSLCAIVGGVFAMAQLVDITIYHSSRYMKSRIAGGKLT 380          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Celegans
Match: erv-46 (Yeast ERV (ER to Golgi transport Vesicle protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q93878])

HSP 1 Score: 125.561 bits (314), Expect = 1.380e-30
Identity = 64/147 (43.54%), Postives = 93/147 (63.27%), Query Frame = 1
Query: 3127 LQFNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSH-MYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            ++F+ SH +N ++FG  +PG   PLD  KVN +     MY YYVK+VPT Y  L+G V  ++QFSVT + K         GLPG F  Y+ +P+MV  +E  +SF  F+ +LCAIVGG+F ++ L+D  IYHSS+ +  ++  GKL+
Sbjct:  237 VKFDASHTVNHVSFGKSFPGKNYPLDG-KVNTDNRGGIMYQYYVKVVPTRYDYLDGRVDQSHQFSVTTHKKDLGFR--QSGLPGFFLQYEFSPLMVQYEEFRQSFASFLVSLCAIVGGVFAMAQLVDITIYHSSRYMKSRIAGGKLT 380          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Celegans
Match: Y102A11A.6 (pep chromosome:WBcel235:X:2031963:2035245:-1 gene:WBGene00022416.1 transcript:Y102A11A.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y102A11A.6)

HSP 1 Score: 78.1814 bits (191), Expect = 2.497e-15
Identity = 46/151 (30.46%), Postives = 88/151 (58.28%), Query Frame = 1
Query: 3133 FNISHFINFLAFGD-----HYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEG--LPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            +++ H I+ + FGD     +  G  +PL     + E   + + Y +KIVP+ +   +G++L++ Q++   +   + ++  H G  +P ++F Y++ PI +   E  +SF  F+T++CA+VGG FTV+ +IDS  +  S++V +K   GKL+
Sbjct:  140 YDMRHLIHSIKFGDDVSHKNLKGSFDPLAKRNTSQENGLNTHEYILKIVPSVHEDYSGTILNSYQYT---FGHKSYITYHHSGKIIPAVWFKYELQPITLKQTEQRQSFYAFLTSICAVVGGTFTVAGIIDSTFFTISELV-KKQRLGKLT 286          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Celegans
Match: C18B12.6 (pep chromosome:WBcel235:X:15004064:15007308:-1 gene:WBGene00007668.1 transcript:C18B12.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C18B12.6)

HSP 1 Score: 62.7734 bits (151), Expect = 8.461e-10
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTN--QFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLI 3513
            NISH I    FG   PG   PL   +   E    +Y Y++KIVPT   K+ G   +T   Q+SVT ++K     G H    GI F Y+    ++ + +   + I ++  +C+I+GG++  S+++++++
Sbjct:  262 NISHRIEKFNFGPRIPGLVTPLAGAEHISESGQDIYRYFIKIVPT---KIYGYFSYTMAYQYSVT-FLKKQLKEGEH-SHGGILFEYEFTANVIEVHKTSITLISYLIRICSILGGVYATSTIVNNIL 384          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Fly
Match: CG7011 (gene:FBgn0036489 transcript:FBtr0075645)

HSP 1 Score: 129.798 bits (325), Expect = 5.690e-32
Identity = 70/146 (47.95%), Postives = 99/146 (67.81%), Query Frame = 1
Query: 3139 ISHFINFLAFGDHYP-GFTNPLDNLKVNVEEL-SHMYTYYVKIVPTTYVKLN--GSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            +SH IN L+FG+      T+PLD L+V+V E  S M+ YY+KIVPT Y++ N  G  ++TNQFSVT+Y K   LS    G+PGIFF+Y+++P+MV   E   SF  F TN C+I+GG+FTV+ ++  L+ +S + +  KLE GKLS
Sbjct:  230 LSHTINHLSFGEKIEFAKTHPLDGLRVDVAETKSEMFNYYLKIVPTLYMRGNSDGEPIYTNQFSVTRYRKD--LSDRERGMPGIFFSYELSPLMVKYAERHSSFGHFATNCCSIIGGVFTVAGILAVLLNNSWEAIQRKLEVGKLS 373          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Fly
Match: CG4293 (gene:FBgn0024983 transcript:FBtr0100475)

HSP 1 Score: 56.9954 bits (136), Expect = 6.890e-8
Identity = 28/109 (25.69%), Postives = 56/109 (51.38%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLC 3462
            N +H IN L+FG +      PL+  ++ + E +    Y++K+VPT  +    + ++  Q++VT+ ++         G PGI+F YD + + + ++ +    + F   LC
Sbjct:  242 NFTHRINRLSFGQYSGRIVQPLEGDEIVIHEEATTVQYFLKVVPTE-IHQTFTTIYAFQYAVTENVRKLDSERNSYGSPGIYFKYDWSALKIIVRNDRDHLVTFAIRLC 349          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Fly
Match: CG4293 (gene:FBgn0024983 transcript:FBtr0100476)

HSP 1 Score: 56.9954 bits (136), Expect = 6.890e-8
Identity = 28/109 (25.69%), Postives = 56/109 (51.38%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLC 3462
            N +H IN L+FG +      PL+  ++ + E +    Y++K+VPT  +    + ++  Q++VT+ ++         G PGI+F YD + + + ++ +    + F   LC
Sbjct:  242 NFTHRINRLSFGQYSGRIVQPLEGDEIVIHEEATTVQYFLKVVPTE-IHQTFTTIYAFQYAVTENVRKLDSERNSYGSPGIYFKYDWSALKIIVRNDRDHLVTFAIRLC 349          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Fly
Match: CG4293 (gene:FBgn0024983 transcript:FBtr0070089)

HSP 1 Score: 56.9954 bits (136), Expect = 6.890e-8
Identity = 28/109 (25.69%), Postives = 56/109 (51.38%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLC 3462
            N +H IN L+FG +      PL+  ++ + E +    Y++K+VPT  +    + ++  Q++VT+ ++         G PGI+F YD + + + ++ +    + F   LC
Sbjct:  242 NFTHRINRLSFGQYSGRIVQPLEGDEIVIHEEATTVQYFLKVVPTE-IHQTFTTIYAFQYAVTENVRKLDSERNSYGSPGIYFKYDWSALKIIVRNDRDHLVTFAIRLC 349          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Fly
Match: CG4293 (gene:FBgn0024983 transcript:FBtr0070090)

HSP 1 Score: 56.9954 bits (136), Expect = 6.890e-8
Identity = 28/109 (25.69%), Postives = 56/109 (51.38%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLC 3462
            N +H IN L+FG +      PL+  ++ + E +    Y++K+VPT  +    + ++  Q++VT+ ++         G PGI+F YD + + + ++ +    + F   LC
Sbjct:  242 NFTHRINRLSFGQYSGRIVQPLEGDEIVIHEEATTVQYFLKVVPTE-IHQTFTTIYAFQYAVTENVRKLDSERNSYGSPGIYFKYDWSALKIIVRNDRDHLVTFAIRLC 349          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.844e-62
Identity = 129/373 (34.58%), Postives = 206/373 (55.23%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*F---DVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRK---IGLLLANKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVM-DVVKIANFIRANPLNHRQFKILLEEYDSNF-NDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV*I-KVSLM-SQLQQSNYTHFPALSKVVQEYQDSIK--SEQFDQSREIVKLDFFTRFKDIRNLTPLLLFIDNQFSCFNKV--KLLGGDEGEVQLKIIEL 1912
            DLQLS  T  +R   + + +   +  DL++   FS+ALDE CD  D  Q  I + F   D     +ELL ++PLK+  +G  + + L   +    + +  L ++ TD A  M+G +   +GL  A+  FP    +HCIIHQ    SK  +  L ++M  V++I NF+R + LNHRQFK L++E D +  +DL+ +  VRWLSR  +L+RF +LL   K++L  K  E   +H  +P +IS LAFL+D+  +LN LN+ LQG   +LP L++ +   + K+ L  + LQ+ +YTHFP L K   +  + +K  + ++    E ++  F  RF +++     + F+ N F+  +      L  DE   QL++IEL
Sbjct:  152 DLQLSRHTVEQRISDIDNSVETHLLSDLQKCQYFSIALDESCDVQDKPQFAIFVRFVSEDCTIR-EELLDIVPLKDRTRGIDLKETLMTVVEKANLQLSKLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHWVSKKLN--LDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNPVKLFLAEKHKEYPELH--DPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPTLLKASGQKAEVVKGSTARYATLLENLEQSFEERFSNLQQKRQQITFLINPFTAESGCLKAPLVEDEAASQLEMIEL 519          

HSP 2 Score: 56.9954 bits (136), Expect = 1.844e-62
Identity = 31/94 (32.98%), Postives = 55/94 (58.51%), Query Frame = 3
Query: 1932 RIISIKRP---QLWIMHVPSDQFPNIYNCCRKILTISGCTFVCKAGFSXXXXXXXXXXXXXXD-HLENLMRAAVTQHQPQIKKIANIIQSQISH 2201
            R+ S+ R    + W + VP +++PN+     K+L++ G T+VC+  FST  +   K   +  D H++ L+R A T+++P +KKI    + Q+SH
Sbjct:  524 RLKSVLREGTVEFWKI-VPVERYPNVKQAALKLLSMFGSTYVCELLFSTLKLVKSKHRSVLTDTHVKELLRVATTEYEPDLKKIVETKECQVSH 616          

HSP 3 Score: 34.6538 bits (78), Expect = 1.844e-62
Identity = 16/45 (35.56%), Postives = 28/45 (62.22%), Query Frame = 3
Query:  681 SDCVTEASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKN 815
            S+ VT AS +++W + + +KPY +G+ VK+C  +    L  E +N
Sbjct:  101 SETVTLASYQLAWNIARAKKPYLEGEFVKKCLSDAVAILCPENEN 145          

HSP 4 Score: 26.9498 bits (58), Expect = 1.844e-62
Identity = 11/43 (25.58%), Postives = 25/43 (58.14%), Query Frame = 1
Query:  523 FVVVSKFHLSFEETQFTKRHYTSMNNNFEKNYPLGIKMREENV 651
            F ++ +  LS  +    +RH+TS+++   + +P G ++R+  V
Sbjct:   38 FCLICQTSLSHFKASNLERHFTSLHSAVAREFPKGSELRKHKV 80          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 165.622 bits (418), Expect = 1.025e-53
Identity = 110/329 (33.43%), Postives = 188/329 (57.14%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGL--LLANKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLMSQ-LQQSNYTHFPALSKVVQEYQD-SIKSEQFDQSREIVKLDFFTRFKDIR 1804
            D+ LS +T   R   ++ +I +Q   D+  A  +S+A DE CDT    + +     +     +E++ L+PLK   +G+ I +A+ +CL  NGI+  +LISV TD A  M G K G   LL      N  A+HCI+HQ ALC++    +   VM+ V+++ N I A  LNHRQF+ LL+E DS ++DL+ +  VRWLS+ ++L RF+  L+  K +L  K  + +   L++  ++ +L F++D+T HLNKLN  LQ   +    +++ + S   K+++ ++ +Q+   +HFP+L +  + +QD +I  +    +   ++  F +RF + R
Sbjct:  152 DMPLSAKTVKERAIKMAGNITEQQIKDINSAPAYSIACDESCDTALLCRYV-----NSDGPQEEIIKLIPLKGQTRGEDICEAVLKCLNENGINTNHLISVATDGAPSMRGSKRGFVTLLQKALDRNLLAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSEYSDLLLHNKVRWLSKDEVLRRFVACLEHVKTFLKSK--DLIYPQLEDTEWLEKLHFMVDMTSHLNKLNESLQVRGNTALQMLEAVLSFERKLTVFARDVQRGTLSHFPSLREFKESHQDHTINGDYLHNAIVDMQTAFESRFCEFR 473          

HSP 2 Score: 46.595 bits (109), Expect = 1.025e-53
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  419 DIGSRKRKVTEENRLFNSSWELEFWFRISGEKPVGLLLCRNSISVLKKLNLQR 577
            D   +KRK+TEENR FN SW   F F  + E     LLC   +S  KK N++R
Sbjct:    2 DARGKKRKITEENRGFNVSWTESFAFVANAEGLPECLLCSEKLSNNKKSNVER 54          

HSP 3 Score: 41.2022 bits (95), Expect = 1.025e-53
Identity = 20/56 (35.71%), Postives = 34/56 (60.71%), Query Frame = 3
Query:  672 LIASDCVTEASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNKDMIKKQI 839
            + + +  T AS   +  + K  KP+TDGD +K+ F   ++ LF++FKNK  I ++I
Sbjct:   95 IASPNSTTAASFVATREIIKRGKPFTDGDYMKESFINISEHLFSDFKNKTEIIQKI 150          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Zebrafish
Match: ergic3 (ERGIC and golgi 3 [Source:NCBI gene;Acc:393990])

HSP 1 Score: 160.999 bits (406), Expect = 2.210e-42
Identity = 75/143 (52.45%), Postives = 102/143 (71.33%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++HFI  L+FG  YPG  NPLD+  V   + S MY Y+VKIVPT YVK +G V+ TNQFSVT++ K      G +GLPG+F  Y+++P+MV   E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K+E GK S
Sbjct:  246 NMTHFIKHLSFGKDYPGIVNPLDDTNVAAPQASMMYQYFVKIVPTIYVKGDGEVVKTNQFSVTRHEKIANGLIGDQGLPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQKKIELGKAS 388          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Zebrafish
Match: ergic3 (ERGIC and golgi 3 [Source:NCBI gene;Acc:393990])

HSP 1 Score: 160.999 bits (406), Expect = 2.296e-42
Identity = 75/143 (52.45%), Postives = 102/143 (71.33%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++HFI  L+FG  YPG  NPLD+  V   + S MY Y+VKIVPT YVK +G V+ TNQFSVT++ K      G +GLPG+F  Y+++P+MV   E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K+E GK S
Sbjct:  241 NMTHFIKHLSFGKDYPGIVNPLDDTNVAAPQASMMYQYFVKIVPTIYVKGDGEVVKTNQFSVTRHEKIANGLIGDQGLPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQKKIELGKAS 383          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Zebrafish
Match: si:ch211-225b10.3 (si:ch211-225b10.3 [Source:ZFIN;Acc:ZDB-GENE-130531-53])

HSP 1 Score: 99.3673 bits (246), Expect = 1.196e-21
Identity = 50/127 (39.37%), Postives = 76/127 (59.84%), Query Frame = 1
Query: 3133 FNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLI 3513
            +N SH I+ L+FG+  PG  NPLD ++    E + ++ Y++ +VPT     N SV   +QFSVT+  +  +   G++G+ GIFF Y ++P+MV + E       F+  LC IVGGIF+ S L+  LI
Sbjct:  212 YNFSHRIDHLSFGNDVPGHINPLDGMEKTTLEQNTLFQYFITVVPTKLHTSNVSV-DMHQFSVTERERVVSNEKGNQGVSGIFFKYKLSPLMVRVSEEHMPLAAFLVRLCGIVGGIFSTSDLLHRLI 337          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 8.809e-45
Identity = 127/346 (36.71%), Postives = 185/346 (53.47%), Query Frame = 2
Query:  839 LQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANF---KELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLA-NKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVV-KIANFIRAN--PLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGG-KRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV*I-KVSLM-SQLQQSNYTHFPALSKVVQEYQDS---IKSEQFDQSREIVKLDFFTRFKDIRNLTPLLLFIDN 1837
            + LSHQT AR    ++  +  ++   LR A  FS+ALDE  D TDT QL+I +   V   F   +ELL ++PL  + KG+ IY A+K  +   G    +   + TD A  MVGR  GL     K+  +   +HCI+HQ  LC      K+ ++MDVV K+ N IR     L HR+FK  LEE D+ + DL+ + +VRWLS  K L RF  L +E  +YL   K +  L+ HL +  F++ LAFL DIT  LN LNL LQG    +  L   I+    K+ L+ S L +++ THF +  ++ QE + +   +   QF    +I+  +F TRF+D   +       +N
Sbjct:  156 ISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFV-RSVDQEFHISEELLEIVPLHGSTKGEDIYNAVKATVTKYG-GFSSCTCIVTDGARAMVGRNQGLAGRLRKEGIDCHMFHCIVHQEVLCGT--SLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHEFNTRFQDFEGMEASFKLFNN 497          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 172.94 bits (437), Expect = 1.460e-44
Identity = 126/337 (37.39%), Postives = 182/337 (54.01%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANF---KELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLA-NKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVV-KIANFIRAN--PLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGG-KRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV*I-KVSLM-SQLQQSNYTHFPALSKVVQEYQDS---IKSEQFDQSREIVKLDFFTRFKDIRN 1807
             + LSHQT AR    ++  +  ++   LR A  FS+ALDE  D TDT QL+I +   V   F   +ELL ++PL  + KG+ IY A+K  +   G    +   + TD A  MVGR  GL     K+  +   +HCI+HQ  LC      K+ ++MDVV K+ N IR     L HR+FK  LEE D+ + DL+ + +VRWLS  K L RF  L +E  +YL   K +  L+ HL +  F++ LAFL DIT  LN LNL LQG    +  L   I+    K+ L+ S L +++ THF +  ++ QE + +   +   QF    +I+  +F TRF+D   
Sbjct:  155 SISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFV-RSVDQEFHISEELLEIVPLHGSTKGEDIYNAVKATVTKYG-GFSSCTCIVTDGARAMVGRNQGLAGRLRKEGIDCHMFHCIVHQEVLCGT--SLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHEFNTRFQDFEG 487          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Xenopus
Match: washc2a (WASH complex subunit 2A [Source:Xenbase;Acc:XB-GENE-5771000])

HSP 1 Score: 155.992 bits (393), Expect = 6.733e-41
Identity = 72/143 (50.35%), Postives = 103/143 (72.03%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H I  L+FG  YPG  NPLD   V   + S M+ Y+VKIVPT YVK++G VL TNQFSVT++ K T    G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSL+Y+S++ + +K+E GK +
Sbjct:  207 NMTHEIRHLSFGRDYPGLVNPLDGSSVAAMQSSMMFQYFVKIVPTVYVKVDGEVLRTNQFSVTRHEKMTNGLIGDQGLPGVFVLYELSPMMVKLTEKHRSFSHFLTGVCAIIGGVFTVAGLIDSLVYYSTRAIQKKIELGKAT 349          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Xenopus
Match: washc2a (WASH complex subunit 2A [Source:Xenbase;Acc:XB-GENE-5771000])

HSP 1 Score: 155.606 bits (392), Expect = 1.217e-40
Identity = 72/143 (50.35%), Postives = 103/143 (72.03%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H I  L+FG  YPG  NPLD   V   + S M+ Y+VKIVPT YVK++G VL TNQFSVT++ K T    G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSL+Y+S++ + +K+E GK +
Sbjct:  220 NMTHEIRHLSFGRDYPGLVNPLDGSSVAAMQSSMMFQYFVKIVPTVYVKVDGEVLRTNQFSVTRHEKMTNGLIGDQGLPGVFVLYELSPMMVKLTEKHRSFSHFLTGVCAIIGGVFTVAGLIDSLVYYSTRAIQKKIELGKAT 362          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Xenopus
Match: washc2a (WASH complex subunit 2A [Source:Xenbase;Acc:XB-GENE-5771000])

HSP 1 Score: 155.606 bits (392), Expect = 1.988e-40
Identity = 72/143 (50.35%), Postives = 103/143 (72.03%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H I  L+FG  YPG  NPLD   V   + S M+ Y+VKIVPT YVK++G VL TNQFSVT++ K T    G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSL+Y+S++ + +K+E GK +
Sbjct:  242 NMTHEIRHLSFGRDYPGLVNPLDGSSVAAMQSSMMFQYFVKIVPTVYVKVDGEVLRTNQFSVTRHEKMTNGLIGDQGLPGVFVLYELSPMMVKLTEKHRSFSHFLTGVCAIIGGVFTVAGLIDSLVYYSTRAIQKKIELGKAT 384          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Mouse
Match: Ergic3 (ERGIC and golgi 3 [Source:MGI Symbol;Acc:MGI:1913616])

HSP 1 Score: 162.155 bits (409), Expect = 1.329e-42
Identity = 72/146 (49.32%), Postives = 107/146 (73.29%), Query Frame = 1
Query: 3127 LQFNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            LQ N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  249 LQINMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 394          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Mouse
Match: Ergic3 (ERGIC and golgi 3 [Source:MGI Symbol;Acc:MGI:1913616])

HSP 1 Score: 158.688 bits (400), Expect = 1.731e-41
Identity = 70/143 (48.95%), Postives = 105/143 (73.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  241 NMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 383          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Mouse
Match: Ergic3 (ERGIC and golgi 3 [Source:MGI Symbol;Acc:MGI:1913616])

HSP 1 Score: 130.183 bits (326), Expect = 2.455e-33
Identity = 58/119 (48.74%), Postives = 85/119 (71.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVS 3492
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV 
Sbjct:  117 NMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVR 235          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 118.242 bits (295), Expect = 2.563e-26
Identity = 106/375 (28.27%), Postives = 181/375 (48.27%), Query Frame = 2
Query:  872 TEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANF---KELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANKDFPNS-------QAYHCIIHQ*ALCS-KLKDDKLKNVMDVV-KIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV*I-KVSLM-SQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKL--DFFTRFKDIRNLTPLLLFIDNQFSCFNKVKLLGGDEGEVQLKIIELKHSVAVQDNLNK 1948
             E ++  +++++   +R    +S+A+DE  D  DT QL I I   V  NF   +ELL  +P+     G  I+  +++ L    ID   L+SV +     M+    GL+   +    S       ++  CIIH   LC+ KL+   + +VMDVV    N+I +  LNH  F  LL E DS +  L+ +  ++WL R  +L RF + L+E   ++  +     +  L +  +I  LAFL+D+T HLN L+  LQG   I+  +   I   + K+ L  + L ++N  HFP L  V +   D +     +   +IV+L  +F  R  D ++    L    + FS       +     E+Q+++I+L+ +  ++   +K
Sbjct:  520 AEEVAGSLWEKLRQKIRSFVAYSIAIDEITDINDTTQLAIFI-RGVDDNFDVSEELLDTVPMTGAKSGNEIFLRVEKSLKKFSIDWSKLVSVASTGTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKLR---MGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKP--VPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTLKSVSRSESDGL-----NYIPKIVELKAEFQRRLSDFKSCESELTLFSSPFS-----TTIDSVREELQMEVIDLQCNTVLRTKYDK 878          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 107.071 bits (266), Expect = 5.073e-23
Identity = 89/304 (29.28%), Postives = 151/304 (49.67%), Query Frame = 2
Query:  833 TDLQLSHQTFARRTEMLSSDIYKQIYGDLREAS--GFSLALDEFCDTTDTEQLII*I*FDVKANFK-ELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGL--LLANKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVM-DVVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLMS-QLQQSNYTHFPALSKVVQEY 1720
            + + LS+ T  RR   +S+DI  Q+  +++ A     S+ LDE  D  +  QL++ + +    +FK E L   PL+ T     +++A+   L  + I  K++  V TD A   +G + G   L+ N+  P +   HC++H   L  K      + VM  V+   NF++A+ LN R F  L  + D     L+ + + RWLSR K+L R  +L  E K++   K   +      +   + ++A+L+DI   LN+LNL LQG       L ++I S  +K+ L   +L ++ +   P LS   +E+
Sbjct:  298 SAVSLSNDTVRRRIHDMSADILDQVVQEIKSAPLPICSIQLDESTDVANCLQLMVYVRYINDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEISWKSICGVCTDGAPATLGCQSGFQRLVLNES-PKAIGAHCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDENKFYMLPTLSAFFEEH 600          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. UniProt/SwissProt
Match: sp|Q803I2|ERGI3_DANRE (Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Danio rerio OX=7955 GN=ergic3 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.733e-41
Identity = 75/143 (52.45%), Postives = 102/143 (71.33%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++HFI  L+FG  YPG  NPLD+  V   + S MY Y+VKIVPT YVK +G V+ TNQFSVT++ K      G +GLPG+F  Y+++P+MV   E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K+E GK S
Sbjct:  241 NMTHFIKHLSFGKDYPGIVNPLDDTNVAAPQASMMYQYFVKIVPTIYVKGDGEVVKTNQFSVTRHEKIANGLIGDQGLPGVFVLYELSPMMVKFTEKQRSFTHFLTGVCAIIGGVFTVAGLIDSLIYHSARAIQKKIELGKAS 383          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. UniProt/SwissProt
Match: sp|Q5EAE0|ERGI3_BOVIN (Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Bos taurus OX=9913 GN=ERGIC3 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 6.855e-41
Identity = 70/143 (48.95%), Postives = 105/143 (73.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  241 NMTHYIRHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLMGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 383          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. UniProt/SwissProt
Match: sp|Q4R8X1|ERGI3_MACFA (Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Macaca fascicularis OX=9541 GN=ERGIC3 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 7.799e-41
Identity = 70/143 (48.95%), Postives = 105/143 (73.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  240 NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 382          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. UniProt/SwissProt
Match: sp|Q9Y282|ERGI3_HUMAN (Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens OX=9606 GN=ERGIC3 PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 9.372e-41
Identity = 70/143 (48.95%), Postives = 105/143 (73.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  241 NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 383          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. UniProt/SwissProt
Match: sp|Q5R8G3|ERGI3_PONAB (Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Pongo abelii OX=9601 GN=ERGIC3 PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.021e-40
Identity = 70/143 (48.95%), Postives = 105/143 (73.43%), Query Frame = 1
Query: 3136 NISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            N++H+I  L+FG+ YPG  NPLD+  V   + S M+ Y+VK+VPT Y+K++G VL TNQFSVT++ K      G +GLPG+F  Y+++P+MV + E  +SF  F+T +CAI+GG+FTV+ LIDSLIYHS++ + +K++ GK +
Sbjct:  241 NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 383          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. TrEMBL
Match: A0A0F7GXQ0 (Endoplasmic reticulum-golgi intermediate compartment protein 3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 9.485e-85
Identity = 139/140 (99.29%), Postives = 140/140 (100.00%), Query Frame = 1
Query: 3145 HFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            +FINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS
Sbjct:   44 YFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 183          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. TrEMBL
Match: A0A1A8U9C8 (Dimer_Tnp_hAT domain-containing protein (Fragment) OS=Nothobranchius furzeri OX=105023 GN=Nfu_g_1_025840 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.418e-66
Identity = 125/396 (31.57%), Postives = 218/396 (55.05%), Query Frame = 2
Query:  839 LQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*F---DVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLL-ANKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVVKIANFIRA-NPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLG---GKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLMSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKLD-----FFTRFKDIRNLTPLLLFIDNQF-----SCFNKVK---LLGGDEGEVQLKIIELKHSVAVQDNLNKTTPT 1960
            + +S  +  +++E+L+ D+  Q+ G +++A    LA+DE  D  D  QL++ + F   + KA +++LL + PL+ +  G+ IY A+ E L   G++   +IS+TTD A  M+GR+ G +    KD P+   YHCIIHQ  LC+ L D+  + +  V+K+ NF+RA +   HR  +  L+E D+N +DL+ + +VRWLS+ ++LARF  + +E   +L      +  +L   L+N   +  +AFL+DIT HLN+LNL+LQG  + +  L+  + +   K+ +  +  Q +  HFPA+ + VQ         Q D S  +V +D     F  RF        L +FI N F       F+K         +  ++Q+++++L+ ++A+ +   +T P+
Sbjct:  164 IPISASSATKKSEILTQDVVAQLDGAIQKAPCVGLAVDESTDVCDNAQLLVYVRFYYTEQKAFYEDLLGITPLQTSTTGEDIYLAIMEMLAKRGMEPSKVISITTDGAPAMIGREKGAVTRMKKDNPDLLTYHCIIHQSVLCASLSDEHAEVMTSVMKMINFLRASSSYQHRMLREFLKEVDANADDLLLHNNVRWLSKGRVLARFWAIRREVASFLAELKHHKATQLSTFLENEKQMDNVAFLVDITSHLNELNLRLQGKDNSICELMTAVCAFQRKIEMFKEDLQEDCVHFPAVQEQVQ--------GQRDVSSFVVFIDKLIANFSNRFDSFSIGQQLTMFIQNPFLITDVRSFSKEATQHFKWVNARDLQMELVDLQANLAMNELSARTDPS 551          

HSP 2 Score: 45.4394 bits (106), Expect = 1.418e-66
Identity = 17/35 (48.57%), Postives = 27/35 (77.14%), Query Frame = 3
Query:  696 EASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLF 800
            E+SL+VSW+L + +KP+TDG+ VK+C     ++LF
Sbjct:  115 ESSLRVSWILGQHKKPFTDGEVVKECMTAVAETLF 149          

HSP 3 Score: 44.2838 bits (103), Expect = 1.418e-66
Identity = 22/53 (41.51%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  425 GSRKRKVTEENRLFNSSWELEFWFRI--SGEKPVGLLLCRNSISVLKKLNLQR 577
             S+KRKV  ENR FN  W   F F +   G KPV  L+C  +++++K  N++R
Sbjct:   14 ASKKRKVDSENRAFNPEWTESFLFVLPTGGTKPV-CLICSETVALIKSGNVKR 65          

HSP 4 Score: 42.3578 bits (98), Expect = 1.418e-66
Identity = 30/82 (36.59%), Postives = 44/82 (53.66%), Query Frame = 3
Query: 1959 LWIMHVPSDQFPNIYNCCRKILTISGCTFVCKAGFSXXXXXXXX-XXXXXXDHLENLMRAAVTQHQPQIKKIANIIQSQISH 2201
             W+  VP   F  +      ILT+ G T  C+A FST NI   K ++ LTN+HL   MR A++  +P+ K +A   ++  SH
Sbjct:  553 FWLQMVPETAFSRLKKVALYILTMFGSTHNCEAAFSTMNIIKNKYRSRLTNEHLHTCMRMALSPFKPRFKMLAGQARAHFSH 634          

HSP 5 Score: 30.0314 bits (66), Expect = 1.418e-66
Identity = 12/34 (35.29%), Postives = 19/34 (55.88%), Query Frame = 1
Query:  571 TKRHYTSMNNNFEKNYPLGIKMREENVVSFSDDF 672
             KRHY + +  FE+ YPL  ++R E + S    +
Sbjct:   63 VKRHYETKHKCFEETYPLRSEVRSEKIRSLKAQY 96          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. TrEMBL
Match: A0A1A8AR98 (Uncharacterized protein OS=Nothobranchius furzeri OX=105023 GN=Nfu_g_1_025840 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 9.170e-66
Identity = 125/396 (31.57%), Postives = 217/396 (54.80%), Query Frame = 2
Query:  839 LQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*F---DVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLL-ANKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVVKIANFIRA-NPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLG---GKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLMSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKLD-----FFTRFKDIRNLTPLLLFIDNQF-----SCFNKVK---LLGGDEGEVQLKIIELKHSVAVQDNLNKTTPT 1960
            + +S  +  +++E L+ D+  Q+ G +++A    LA+DE  D  D  QL++ + F   + KA +++LL + PL+ +  G+ IY A+ E L   G++   +IS+TTD A  M+GR+ G +    KD P+   YHCIIHQ  LC+ L D+  + +  V+K+ NF+RA +   HR  +  L+E D+N +DL+ + +VRWLS+ ++LARF  + +E   +L      +  +L   L+N   +  +AFL+DIT HLN+LNL+LQG  + +  L+  + +   K+ +  +  Q +  HFPA+ + VQ         Q D S  +V +D     F  RF        L +FI N F       F+K         +  ++Q+++++L+ ++A+ +   +T P+
Sbjct:  224 IPISASSATKKSETLTQDVVAQLDGAIQKAPCVGLAVDESTDVCDNAQLLVYVRFYYTEQKAFYEDLLGITPLQTSTTGEDIYLAIMEMLAKRGMEPSKVISITTDGAPAMIGREKGAVTRMKKDNPDLLTYHCIIHQSVLCASLSDEHAEVMTSVMKMINFLRASSSYQHRMLREFLKEVDANADDLLLHNNVRWLSKGRVLARFWAIRREVASFLAELKHHKATQLSTFLENEKQMDNVAFLVDITSHLNELNLRLQGKDNSICELMTAVCAFQRKIEMFKEDLQEDCVHFPAVQEQVQ--------GQRDVSSFVVFIDKLIANFSNRFDSFSIGQQLTMFIQNPFLITDVRSFSKEATQHFKWVNARDLQMELVDLQANLAMNELSARTDPS 611          

HSP 2 Score: 45.0542 bits (105), Expect = 9.170e-66
Identity = 17/35 (48.57%), Postives = 27/35 (77.14%), Query Frame = 3
Query:  696 EASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLF 800
            E+SL+VSW+L + +KP+TDG+ VK+C     ++LF
Sbjct:  175 ESSLRVSWILGQHKKPFTDGEVVKECMTAVAETLF 209          

HSP 3 Score: 44.2838 bits (103), Expect = 9.170e-66
Identity = 22/53 (41.51%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  425 GSRKRKVTEENRLFNSSWELEFWFRI--SGEKPVGLLLCRNSISVLKKLNLQR 577
             S+KRKV  ENR FN  W   F F +   G KPV  L+C  +++++K  N++R
Sbjct:   74 ASKKRKVDSENRAFNPEWTESFLFVLPTGGTKPV-CLICSETVALIKSGNVKR 125          

HSP 4 Score: 40.0466 bits (92), Expect = 9.170e-66
Identity = 29/82 (35.37%), Postives = 43/82 (52.44%), Query Frame = 3
Query: 1959 LWIMHVPSDQFPNIYNCCRKILTISGCTFVCKAGFSXXXXXXXX-XXXXXXDHLENLMRAAVTQHQPQIKKIANIIQSQISH 2201
             W+  VP   F  +      ILT+ G T  C+A FST NI   K ++ LTN+HL   MR  ++  +P+ K +A   ++  SH
Sbjct:  613 FWLQMVPETAFSRLKKVALYILTMFGSTHNCEAAFSTINIIKNKYRSRLTNEHLHTCMRMTLSPFKPRFKMLAGQARAHFSH 694          

HSP 5 Score: 30.0314 bits (66), Expect = 9.170e-66
Identity = 12/34 (35.29%), Postives = 19/34 (55.88%), Query Frame = 1
Query:  571 TKRHYTSMNNNFEKNYPLGIKMREENVVSFSDDF 672
             KRHY + +  FE+ YPL  ++R E + S    +
Sbjct:  123 VKRHYETKHKCFEETYPLRSEVRSEKIRSLKAQY 156          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. TrEMBL
Match: A0A3B1K1Z5 (Uncharacterized protein OS=Astyanax mexicanus OX=7994 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.876e-63
Identity = 136/394 (34.52%), Postives = 212/394 (53.81%), Query Frame = 2
Query:  839 LQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*F--DVKANFKE-LLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLA-NKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVVKIANFIRA-NPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIY---LGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLMSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKL--DFFTRFKDIRNLTPLLLFIDNQFSCFNKVKLLGGD---------EGEVQLKIIELKHSVAVQDNLNKTTPT 1960
            + LS  T  RR+E+L+ D   Q+   + +A    LA+DE  D +D  QL++ I F    K  F E LL + PL+ T KG+ IY A+KE L   GI+ K +IS+TTD A  M+GR  G +    +D  +  +YHCIIHQ  LCS L D+  + +  ++KI NF+RA +   HR  +  L+E D+N +DL+ + +VRWLS+ ++L RF  + +E   +   L  ++     + L++   +  +AFL DI  HLN LNL+LQG  + +  L+  + S   K+ +  +  Q +YTHFP + K VQ ++D     +F     + KL  +F  RF        L LFI N F     V+    D          G +Q+++I+L+  VA+++   +T  T
Sbjct:  153 IPLSACTATRRSEILAQDSLSQLEEAICKAPCVGLAVDESTDVSDNAQLLVYIRFLNREKNEFCEDLLGVTPLQTTTKGEDIYLAIKEMLSKRGIEPKKVISITTDGAPAMIGRGKGAVARLKEDNADLISYHCIIHQAVLCSALSDEYAEVMKTMMKIINFLRASSSCQHRMLREFLKETDANSDDLLLHNNVRWLSKGRVLERFWSIRREVTAFLEKLESQKAANFSVFLNDEKNMGIIAFLADIMSHLNGLNLQLQGKNNSICDLMTAVRSFQRKLQVFKEDLQGDYTHFPKV-KQVQGHRDVSSFVEF-----VDKLIENFSKRFDSFSIGEELKLFIQNPF-LITDVRAFTNDVTHHFKWANTGPLQMQMIDLQADVALKEQFARTEST 539          

HSP 2 Score: 46.9802 bits (110), Expect = 1.876e-63
Identity = 33/82 (40.24%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 1959 LWIMHVPSDQFPNIYNCCRKILTISGCTFVCKAGFSXXX-XXXXXXXXXXXDHLENLMRAAVTQHQPQIKKIANIIQSQISH 2201
             W+  V    FP++      ILT+ G T+ C+A FST N IK K ++ LTN+HL   MR A+T  +P+ K +A   ++Q SH
Sbjct:  541 FWLQMVSETAFPDLKKVALFILTMFGSTYSCEAAFSTMNIIKTKYRSKLTNEHLHMCMRMALTSFKPRFKMLAGQAKAQFSH 622          

HSP 3 Score: 41.9726 bits (97), Expect = 1.876e-63
Identity = 20/44 (45.45%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  696 EASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNKDMI 827
            E SL+V+WVL K +KP+TD   VK+C  E  ++L  + K KD +
Sbjct:  104 ECSLRVAWVLGKHKKPFTDTSVVKECMTEIAEALL-DGKEKDEL 146          

HSP 4 Score: 41.2022 bits (95), Expect = 1.876e-63
Identity = 20/52 (38.46%), Postives = 33/52 (63.46%), Query Frame = 2
Query:  428 SRKRKVTEENRLFNSSWELEFWFRI--SGEKPVGLLLCRNSISVLKKLNLQR 577
            S+KRKV  ENR FN+ W   + F +  +  KPV  L+C  +++++K  N++R
Sbjct:    4 SKKRKVDAENRAFNTEWTDAYMFILPPASTKPV-CLICSETVALIKSANVKR 54          

HSP 5 Score: 26.1794 bits (56), Expect = 1.876e-63
Identity = 9/34 (26.47%), Postives = 20/34 (58.82%), Query Frame = 1
Query:  571 TKRHYTSMNNNFEKNYPLGIKMREENVVSFSDDF 672
             KRHY + +  F+++YP   ++R + + S +  +
Sbjct:   52 VKRHYETKHKAFDQSYPPKSELRTQKIRSLTAQY 85          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. TrEMBL
Match: A0A3P8QWL9 (Dimer_Tnp_hAT domain-containing protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.044e-60
Identity = 123/391 (31.46%), Postives = 211/391 (53.96%), Query Frame = 2
Query:  839 LQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*F---DVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANK-DFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVVKIANFIRA-NPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIY---LGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV-*IKVSLMSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKLDFFTRFKDIRNLTPLLLFIDNQFSC-----FNK---VKLLGGDEGEVQLKIIELKHSVAVQDNLNKTTPT 1960
            + +S  T  +R+E+L+ D+  Q+   + +     LA+DE  D +D  QL++ + F   D K   ++LL +  L +T +G+ IY A+KE L   GI+   ++S+TTD A  M+GR+ G +   K D P   +YHCIIHQ  LCS L D+  + +  ++K+ NF+RA +   HR  +  L E D++ +DL+ + +VRWLS+ + L RF  +  E   +   L  ++     + L++   +  +AFL+DIT HLN+LNLKLQG  + +  L+  +     K+ +  +  Q +Y HFP + +  Q  +D   S   D   ++++ +F  RF        L +FI N F+      F+K         + G +Q+++I+L+  VA+++   +T P 
Sbjct:  153 IPMSASTATKRSELLAQDVLSQLEEAIHKTPCVGLAVDESTDVSDNAQLLVYVRFFNNDKKEFCEDLLGVTSLHSTTRGEDIYLAIKEMLTKRGIEPNQVVSITTDGAPAMMGREKGAVARMKEDNPELISYHCIIHQSVLCSTLSDEYAEVMKTMMKMINFLRASSSCQHRMLREFLREVDAHADDLLLHNNVRWLSKGRALERFWSIRSEVAAFLEELESQKATNFSLFLNDGKNMDIVAFLVDITSHLNELNLKLQGKDNSICELMTAVHCFQRKLEVFKEDLQGDYAHFPTVKEQAQGQRDV--SSFVDFVDKLIE-NFSKRFDSFSFGQQLTMFIKNPFAITDVRGFSKEVTQHFKWANAGPLQMQLIDLQADVALKEQFGRTEPA 540          

HSP 2 Score: 45.4394 bits (106), Expect = 1.044e-60
Identity = 33/82 (40.24%), Postives = 46/82 (56.10%), Query Frame = 3
Query: 1959 LWIMHVPSDQFPNIYNCCRKILTISGCTFVCKAGFSXXX-XXXXXXXXXXXDHLENLMRAAVTQHQPQIKKIANIIQSQISH 2201
             W   V    FPN+      ILT+ G T+ C+A FST N IK K ++ +TN+HL   MR A+T  QP+ K +    ++Q SH
Sbjct:  542 FWPQLVSETAFPNLRKVALYILTMFGSTYSCEAAFSTMNIIKTKYRSRITNEHLHMCMRMALTPFQPRFKILVERTKAQFSH 623          

HSP 3 Score: 38.1206 bits (87), Expect = 1.044e-60
Identity = 19/52 (36.54%), Postives = 32/52 (61.54%), Query Frame = 2
Query:  428 SRKRKVTEENRLFNSSWELEFWFRI--SGEKPVGLLLCRNSISVLKKLNLQR 577
            S+KRKV  ENR F + W   + F +  +  KPV  L+C  +++++K  N++R
Sbjct:    4 SKKRKVDTENRTFKTEWTDAYMFILPAASSKPV-CLICSETVALIKSGNVKR 54          

HSP 4 Score: 36.965 bits (84), Expect = 1.044e-60
Identity = 17/48 (35.42%), Postives = 29/48 (60.42%), Query Frame = 3
Query:  696 EASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNKDMIKKQI 839
            E SL+V+W+L + +KP+ D   VK+C     ++L  E K K+ +  +I
Sbjct:  104 ECSLRVAWILGQHKKPFADAGVVKECMSSVAETLL-EGKQKEELHDKI 150          

HSP 5 Score: 27.335 bits (59), Expect = 1.044e-60
Identity = 10/29 (34.48%), Postives = 18/29 (62.07%), Query Frame = 1
Query:  574 KRHYTSMNNNFEKNYPLGIKMREENVVSF 660
            KRHY + +  FE++YP   ++R + + S 
Sbjct:   53 KRHYETKHKAFEQSYPPKSELRSQKISSL 81          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000050151.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:23214084:23215952:-1 gene:ENSAMXG00000029603.1 transcript:ENSAMXT00000050151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 1.172e-66
Identity = 136/394 (34.52%), Postives = 212/394 (53.81%), Query Frame = 2
Query:  839 LQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*F--DVKANFKE-LLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLA-NKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVVKIANFIRA-NPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIY---LGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLMSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKL--DFFTRFKDIRNLTPLLLFIDNQFSCFNKVKLLGGD---------EGEVQLKIIELKHSVAVQDNLNKTTPT 1960
            + LS  T  RR+E+L+ D   Q+   + +A    LA+DE  D +D  QL++ I F    K  F E LL + PL+ T KG+ IY A+KE L   GI+ K +IS+TTD A  M+GR  G +    +D  +  +YHCIIHQ  LCS L D+  + +  ++KI NF+RA +   HR  +  L+E D+N +DL+ + +VRWLS+ ++L RF  + +E   +   L  ++     + L++   +  +AFL DI  HLN LNL+LQG  + +  L+  + S   K+ +  +  Q +YTHFP + K VQ ++D     +F     + KL  +F  RF        L LFI N F     V+    D          G +Q+++I+L+  VA+++   +T  T
Sbjct:  153 IPLSACTATRRSEILAQDSLSQLEEAICKAPCVGLAVDESTDVSDNAQLLVYIRFLNREKNEFCEDLLGVTPLQTTTKGEDIYLAIKEMLSKRGIEPKKVISITTDGAPAMIGRGKGAVARLKEDNADLISYHCIIHQAVLCSALSDEYAEVMKTMMKIINFLRASSSCQHRMLREFLKETDANSDDLLLHNNVRWLSKGRVLERFWSIRREVTAFLEKLESQKAANFSVFLNDEKNMGIIAFLADIMSHLNGLNLQLQGKNNSICDLMTAVRSFQRKLQVFKEDLQGDYTHFPKV-KQVQGHRDVSSFVEF-----VDKLIENFSKRFDSFSIGEELKLFIQNPF-LITDVRAFTNDVTHHFKWANTGPLQMQMIDLQADVALKEQFARTEST 539          

HSP 2 Score: 46.9802 bits (110), Expect = 1.172e-66
Identity = 33/82 (40.24%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 1959 LWIMHVPSDQFPNIYNCCRKILTISGCTFVCKAGFSXXX-XXXXXXXXXXXDHLENLMRAAVTQHQPQIKKIANIIQSQISH 2201
             W+  V    FP++      ILT+ G T+ C+A FST N IK K ++ LTN+HL   MR A+T  +P+ K +A   ++Q SH
Sbjct:  541 FWLQMVSETAFPDLKKVALFILTMFGSTYSCEAAFSTMNIIKTKYRSKLTNEHLHMCMRMALTSFKPRFKMLAGQAKAQFSH 622          

HSP 3 Score: 41.9726 bits (97), Expect = 1.172e-66
Identity = 20/44 (45.45%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  696 EASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNKDMI 827
            E SL+V+WVL K +KP+TD   VK+C  E  ++L  + K KD +
Sbjct:  104 ECSLRVAWVLGKHKKPFTDTSVVKECMTEIAEALL-DGKEKDEL 146          

HSP 4 Score: 41.2022 bits (95), Expect = 1.172e-66
Identity = 20/52 (38.46%), Postives = 33/52 (63.46%), Query Frame = 2
Query:  428 SRKRKVTEENRLFNSSWELEFWFRI--SGEKPVGLLLCRNSISVLKKLNLQR 577
            S+KRKV  ENR FN+ W   + F +  +  KPV  L+C  +++++K  N++R
Sbjct:    4 SKKRKVDAENRAFNTEWTDAYMFILPPASTKPV-CLICSETVALIKSANVKR 54          

HSP 5 Score: 26.1794 bits (56), Expect = 1.172e-66
Identity = 9/34 (26.47%), Postives = 20/34 (58.82%), Query Frame = 1
Query:  571 TKRHYTSMNNNFEKNYPLGIKMREENVVSFSDDF 672
             KRHY + +  F+++YP   ++R + + S +  +
Sbjct:   52 VKRHYETKHKAFDQSYPPKSELRTQKIRSLTAQY 85          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.274 bits (482), Expect = 1.945e-55
Identity = 130/334 (38.92%), Postives = 185/334 (55.39%), Query Frame = 2
Query:  833 TDLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVK-ANFKE-LLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLL-LANKD--FPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVV-KIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV*IKVSL---MSQLQQSNYTHFPALSKVVQEY--QDSIKSEQFDQSREIVKLDFFTRFKDI 1801
            +++ L   T  RR E+LS DI KQ+  DL     FSL  DE  D TDT QL++ +      A+ KE  L LLPL    +G+ IY+A +     N +  + L+S+T D A  M G   G + L  KD  FP   +YHC+IHQ AL SK+ D    +VM VV KI N IRA  L HR FK LL+E D+ + DL+ + DVRWLSR K+L RF++LL E   +L  ++ E     L +  ++  LAFL D+T  LN+LN +LQG    +P ++  ++   KV L    SQL+    THF  + K++     +DS   E F      ++ +F  RF+++
Sbjct:  143 SNMSLGPATVVRRVELLSEDISKQVLSDLSRCEYFSLQFDESVDITDTAQLVVFVRMTFSDASVKEDFLTLLPLNERTRGEDIYRAFRTYATENDLPFQKLVSITRDGAPAMCGIHAGFIALCRKDPIFPAFVSYHCVIHQQALASKVVD--FSHVMTVVVKIVNSIRAKALQHRLFKSLLDELDAEYGDLILHADVRWLSRGKVLQRFINLLPEIISFLKSRKEE--YRELADDTWLLDLAFLTDLTSKLNELNCELQGKDCDVPHMVSAVNA-FKVKLALWTSQLKCKKLTHFQNVDKMLNNISNKDSFHPENFCIHLNRLEEEFSKRFEEL 471          

HSP 2 Score: 47.7506 bits (112), Expect = 1.945e-55
Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 3
Query:  681 SDCVTEASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNKDMIKKQI 839
            ++  TEAS +VS +L K +K +TDG+  K+     +DSLF +FKNKD I+  I
Sbjct:   90 ANANTEASFRVSHLLAKHKKTFTDGELFKEAMLFASDSLFRDFKNKDEIRTAI 142          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.652 bits (470), Expect = 9.749e-55
Identity = 125/345 (36.23%), Postives = 185/345 (53.62%), Query Frame = 2
Query:  833 TDLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANFK---ELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVV-KIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV*IKVSLM---SQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKLDFFTRFKDIRNLTPLLLFIDNQFS 1846
            +++ LS  T A R   LSSDIY Q+    +  S +S+ALDE  D TDT QL I +   V  NF+   ELL ++P+      + I+  L + +   G+  K  + +TTD A  M GRK GL    +    + A HCIIHQ ALCSK    K  NVM VV K  N IR+  L HR+F+ LLEE +S + D++ + +VRWLSR  +L RF +L  E K ++  +++   +  L +P ++  LAFL+DIT  LN LN KLQG   ++ +    +       LM   +QL Q+N+ HFPA  K + +       E++  +  +++ +F  RF D +          + FS
Sbjct:  197 SNISLSANTVAERISDLSSDIYDQLCEKAKRFSVYSVALDESTDITDTAQLAIYV-RGVDDNFEVTEELLTVIPMHGQTTAQEIFHQLCDAIENAGLPWKRFVGITTDGAPSMTGRKNGL--EEESVEEAIALHCIIHQQALCSKCL--KFDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESEYGDVLYFTEVRWLSRGNILKRFFELRAEVKAFM--EKDGVAVTVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSAAYDNVRA-FSAKLMLWKAQLSQTNFCHFPAC-KALMDAGTPFSGEKYVDAILMLQEEFDHRFADFKTHRATFQIFADPFS 532          

HSP 2 Score: 39.2762 bits (90), Expect = 9.749e-55
Identity = 21/53 (39.62%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  434 KRKVTEENRLFNSSWELEFWFRISGEKPVGLLLCRNSISVLKKLNLQRD-TTR 589
            KRK+ +E+R F   WE++F+F      P   L+C   ++V K+ NL+R  TTR
Sbjct:   61 KRKICDEHRQFQEKWEVQFFFVEHRGIPT-CLICTEKVAVHKEYNLKRHYTTR 112          

HSP 3 Score: 31.5722 bits (70), Expect = 9.749e-55
Identity = 14/31 (45.16%), Postives = 21/31 (67.74%), Query Frame = 3
Query:  681 SDCVTEASLKVSWVLTK*QKPYTDGDTVKQC 773
            +D   EAS  VS ++ K  KP+T+G+ VK+C
Sbjct:  150 NDAAVEASYVVSEMIAKAGKPFTEGEFVKKC 180          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 5.799e-52
Identity = 142/383 (37.08%), Postives = 202/383 (52.74%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKAN---FKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLL--LANKDFPNSQA----YHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLM-SQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSR-----EIVKLDFFTRFKDIRNLTPLLLFIDNQFSCFNKVKLLGGDEGEVQLKIIELKHSVAVQ 1933
            ++ LS  T   R   LSS+ Y Q+   + + + FS ALDE  D TDT QL I I   V      ++EL AL+PL     G  I+ A K  +    +    L +VTTD AL +VG   G +  L     P+  A    YHCIIHQ ALC K      K +MD VV   NFIRA  L HR+F   LE+  + + D++ + +VRWLSR  +L RF  L  E K++L  K  + L+M  +N  +I+ LAFL D+T  LN+LNLKLQG   ++  L + + +  +K++L  +QL++ N THFP         Q++   + ++ SR     E +KL F  RF   RN    L  + + FS   +        GE+Q +IIELK S A++
Sbjct:  331 NISLSRTTIQLRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFI-RGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENLNLPWSKLSAVTTDGALSVVGETNGFIGHLKRHLGPDQAAELKHYHCIIHQEALCGK--HLHFKEIMDFVVSAVNFIRARSLKHREFPSFLEDISAAYGDVIYHTEVRWLSRGNVLKRFFALRNEIKLFLEQKGKDTLVM--ENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTC-------QEAFAHKNYNWSRHSCVLEDLKLAFSARFGQFRNEQATLQLLADPFSVDTETV-----PGELQPEIIELKCSTAMR 696          

HSP 2 Score: 39.2762 bits (90), Expect = 5.799e-52
Identity = 20/77 (25.97%), Postives = 41/77 (53.25%), Query Frame = 3
Query: 1974 VPSDQFPNIYNCCRKILTISGCTFVCKAGFSXXXXXXXXXXXXXXD-HLENLMRAAVTQHQPQIKKIANIIQSQISH 2201
            +  +QFPN++   +K +++ G T++C+  FS   +          D +L+ ++R A T  +P I ++ +  +  ISH
Sbjct:  711 LDREQFPNLFANAQKWISMFGSTYICEQMFSLMKLNKSPLRTRLTDENLQAVLRLATTSLEPDINQLVSERRCNISH 787          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000052542.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000549.1:35642:40620:1 gene:ENSAMXG00000033785.1 transcript:ENSAMXT00000052542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.43 bits (485), Expect = 1.367e-51
Identity = 144/383 (37.60%), Postives = 205/383 (53.52%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKAN---FKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLL--LANKDFPNSQA----YHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLM-SQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSR-----EIVKLDFFTRFKDIRNLTPLLLFIDNQFSCFNKVKLLGGDEGEVQLKIIELKHSVAVQ 1933
            ++ LS  T  RR   LSS+ Y Q+   + + + FS ALDE  D TDT QL I I   V      ++EL AL+PL     G  I+ A K  +    +    L +VTTD A  MVG   G +  L     P+  A    YHCIIHQ ALC K    + K +MD VV   NFIRA  LNHR+F+  LE+  + + D++ + +VRWLSR  +L  F  L  E K++L  K  + L+M  +N  +I+ LAFL D+T  LN+LNLKLQG   ++  L + + +  +K++L  +QL++ N THFP         Q++   + ++ SR     E +KL F  RF   RN    L  + + FS   +        GE+QL+IIELK S A++
Sbjct:  143 NISLSRTTIQRRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFI-RGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENLNLPWSKLSAVTTDGAPSMVGETNGFIGHLKRHLGPDQAAELKHYHCIIHQEALCGK--HLQFKQIMDFVVSAVNFIRARSLNHREFQSFLEDISAAYGDVIYHTEVRWLSRGNVLKIFFALRNEIKLFLEQKGKDTLVM--ENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTC-------QEAFAHKNYNWSRHSCVLEDLKLAFSARFGQFRNEQATLQLLADPFSVDTETV-----PGELQLEIIELKCSTAMR 508          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Sea Lamprey
Match: ergic3 (ERGIC and golgi 3 [Source:NCBI gene;Acc:393990])

HSP 1 Score: 159.458 bits (402), Expect = 1.729e-45
Identity = 74/144 (51.39%), Postives = 101/144 (70.14%), Query Frame = 1
Query: 3133 FNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            FN++H I  L+FG  YPG  NPLD  K    E   M+ Y+VKIVPT YVKLNG  L TNQFSVTK+ K      G +GLPG+F +Y+++P+MV   E  +SF  F+T +CAI+GG+FTV+ LIDS+IYHS++ + +K++ GK +
Sbjct:    1 FNLTHHIAHLSFGRDYPGIVNPLDGTKSVSNEDFMMFQYFVKIVPTVYVKLNGEELRTNQFSVTKHEKVANGLAGDQGLPGVFVSYELSPMMVRFTEKQRSFTHFLTGVCAIIGGVFTVAGLIDSMIYHSARAIQKKIDLGKTT 144          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Sea Lamprey
Match: ergic3 (ERGIC and golgi 3 [Source:NCBI gene;Acc:393990])

HSP 1 Score: 127.487 bits (319), Expect = 6.200e-32
Identity = 55/119 (46.22%), Postives = 81/119 (68.07%), Query Frame = 1
Query: 3130 QFNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFT 3486
            +FN++H I  L+FG  YPG  NPLD       E++ ++  +V IVPT YV++NG V+ TNQFSVT+++K         GLPG+F  Y+++P+MV + E  +SF+ F+T +CAIVGG+FT
Sbjct:  241 KFNLTHHIKHLSFGQEYPGIVNPLDGTSAAAVEVTMLFLNHVIIVPTVYVRVNGEVVRTNQFSVTQHVKAIGSGSVESGLPGVFVQYELSPMMVRLTEKHRSFLHFLTGVCAIVGGVFT 359          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Sea Lamprey
Match: si:ch211-225b10.3 (si:ch211-225b10.3 [Source:ZFIN;Acc:ZDB-GENE-130531-53])

HSP 1 Score: 80.1073 bits (196), Expect = 5.172e-17
Identity = 46/121 (38.02%), Postives = 68/121 (56.20%), Query Frame = 1
Query: 3133 FNISHFINFLAFGDHYPGFTNPLD-NLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVS 3492
            +N SH I+  +FG+   G  NPLD + KV++   SHM+ Y++ IVPT       +   T+Q+SVT+  +    + G  G+ GIF  YD++ +MV + E      QF   LC IVGGIF  +
Sbjct:  100 YNFSHRIDHFSFGEPISGIINPLDGSEKVSISH-SHMFQYFLTIVPTKLHTYKFTT-DTHQYSVTEKERVIDHAAGSHGVSGIFMKYDLSSLMVTVTEESMPLGQFFVRLCGIVGGIFATT 218          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Yeast
Match: ERV41 (Protein localized to COPII-coated vesicles; forms a complex with Erv46p; involved in the membrane fusion stage of transport; has homology to human ERGIC2 (PTX1) protein [Source:SGD;Acc:S000004532])

HSP 1 Score: 83.1889 bits (204), Expect = 2.304e-17
Identity = 54/133 (40.60%), Postives = 75/133 (56.39%), Query Frame = 1
Query: 3127 LQFNISHFINFLAFGDHYPGFTNPLDN-LKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKY---IKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLI 3513
            L+FN  H IN  +FGD YP   NPLDN  + N +E    Y YY  +VPT + KL G+ + TNQ+SV  Y    K  A  G  + +PGIFF Y+  P+ + + +   SFIQF+  L AI   +   +S I +L+
Sbjct:  197 LKFN--HVINEFSFGDFYPYIDNPLDNTAQFNQDEPLTTYVYYTSVVPTLFKKL-GAEVDTNQYSVNDYRYLYKDVAAKG--DKMPGIFFKYNFEPLSIVVSDVRLSFIQFLVRLVAICSFLVYCASWIFTLL 324          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Yeast
Match: ERV46 (Protein localized to COPII-coated vesicles; forms a complex with Erv41p; involved in the membrane fusion stage of transport [Source:SGD;Acc:S000000040])

HSP 1 Score: 73.1738 bits (178), Expect = 7.752e-14
Identity = 51/167 (30.54%), Postives = 84/167 (50.30%), Query Frame = 1
Query: 3133 FNISHFINFLAFG------------DHYPG----FTNPLDNLKVNVEELSH--MYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHE-----------GLPGIFFNYDINPIMVWIKEN-DKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEK 3543
             N +H IN L+FG            D   G     T+PLD  +V  +  +H   ++Y+ KIVPT Y  L+  V+ T QFS T + +P  L+GG +           G+PG+F  ++++P+ V  KE   +++  FI N    +GG+  V +++D L Y + + +  K
Sbjct:  248 LNFNHIINHLSFGKPIQSHSKLLGNDKRHGGAVVATSPLDGRQVFPDRNTHFHQFSYFAKIVPTRYEYLDNVVIETAQFSATFHSRP--LAGGRDKDHPNTLHVRGGIPGMFVFFEMSPLKVINKEQHGQTWSGFILNCITSIGGVLAVGTVMDKLFYKAQRSIWGK 412          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Nematostella
Match: EDO42835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0G7])

HSP 1 Score: 162.54 bits (410), Expect = 2.415e-43
Identity = 77/143 (53.85%), Postives = 103/143 (72.03%), Query Frame = 1
Query: 3130 QFNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGK 3558
            QFN++H I  L+FG  YPG T PLDN  V   E   MY Y+VKIVPTTY KL+G +LHT+QFSVTK+ +      G  GLPG+F  Y+ +P+MV   E+ +SF+ F+T +CAIVGGIFTV+ L+DS+IYHSS+ + +K++ GK
Sbjct:  242 QFNLTHNIKHLSFGHDYPGKTYPLDNTFVPAMEAGSMYQYFVKIVPTTYRKLSGEILHTHQFSVTKHKRVIRQMSGEHGLPGVFVLYEFSPMMVQYTESRRSFMHFLTGVCAIVGGIFTVAGLVDSMIYHSSRALQKKIDLGK 384          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Nematostella
Match: EDO47728 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLP6])

HSP 1 Score: 111.694 bits (278), Expect = 6.157e-26
Identity = 51/127 (40.16%), Postives = 74/127 (58.27%), Query Frame = 1
Query: 3133 FNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLI 3513
             N SH I+ L+FG   PG  +PLD      E+   MY YY+++VPT+   LN   + TNQ+S+T+ I+  +   G  G+ G+FF YD++ IMV +K    S + F+  LC IVGGIF  S ++   I
Sbjct:  213 LNFSHRIDMLSFGKRVPGIVHPLDGEMQITEKRRMMYQYYIQVVPTSIKSLNSEEIKTNQYSMTQRIREISHDSGSHGIAGLFFKYDMSSIMVRVKHQHHSMVGFLVRLCGIVGGIFATSGMLHDFI 339          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Nematostella
Match: EDO49249 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX6])

HSP 1 Score: 88.9669 bits (219), Expect = 3.357e-19
Identity = 55/147 (37.41%), Postives = 84/147 (57.14%), Query Frame = 1
Query: 3136 NISHFINFLAFG----DHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            +++H IN + FG    D  PG    L + K +       + Y +KIVPT Y KL+G+   + Q++   Y +  + S G + LP I+F YD++PI V   E  +    FIT +CAIVGG FTV+ +IDS ++ +S+ +  K + GKLS
Sbjct:  143 DMNHIINAVNFGSRIMDKLPGAFTALKDRKRHDTNGLASHDYILKIVPTIYQKLDGTTTFSYQYTWA-YKEYVSYSHGGQMLPAIWFRYDLSPITVKYIERRQPLYHFITTVCAIVGGTFTVAGIIDSAVFTASE-MWRKHQLGKLS 287          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Medaka
Match: ENSORLT00000017252.2 (pep primary_assembly:ASM223467v1:13:14820116:14821987:-1 gene:ENSORLG00000013757.2 transcript:ENSORLT00000017252.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.718 bits (452), Expect = 5.266e-55
Identity = 134/391 (34.27%), Postives = 216/391 (55.24%), Query Frame = 2
Query:  839 LQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*F---DVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANK-DFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMDVVKIANFIRANPLN-HRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIY---LGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLMSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKL--DFFTRFKDIRNLT-PLLLFIDNQF-----SCFNK---VKLLGGDEGEVQLKIIELKHSVAVQDNLNKT 1951
            + LS  T  R+TE+L+ D+  Q+   ++ A+  SLA+DE  D TD  QL++ + F   + K   +++L   PL+   +G+ IY+ +KE L    I++K ++SVTTD A  MVG + G +   K D P+  AYHCIIHQ  LC+ L ++  + +  ++K+ NF+RA+  + HR  +  L+E D+N NDL+ + +VRWLS+   L RF  + +E   +   L  ++  +    L +   +  +AFL+DIT HLN+LNLKLQG  + +  L+K + S  IK+ +  +  Q++  HFP + + +Q  +D      F     I KL  +F  RF D  NL   LLL I+N F       F+K           G +QL++ +L+  VA++ +   T
Sbjct:  153 IPLSATTTTRKTELLAEDVLAQLDAAVQNAACISLAIDESTDVTDNAQLLVYVRFPHKEKKEMCEDMLGSTPLETHTRGEDIYEGIKEMLTKRKINLKQVVSVTTDGAPAMVGTEKGAVARMKQDNPDLIAYHCIIHQTVLCAILSEEFAEVMNTMMKLINFLRASSSHQHRLLREFLKEMDANANDLLLHNNVRWLSKGNALERFWSIRKEIAAFLQQLKSQKATQFANFLQDQHKMDVVAFLVDITGHLNELNLKLQGQKNSICDLMKTVRSFQIKLDIFKEDLQADCEHFPQMREQIQGERDISPYVGF-----IDKLIGNFCQRF-DCFNLGHELLLLIENPFLIREIRGFSKEVTQTFKWAHPGSLQLELTDLQADVALRRHFETT 537          

HSP 2 Score: 43.1282 bits (100), Expect = 5.266e-55
Identity = 30/82 (36.59%), Postives = 45/82 (54.88%), Query Frame = 3
Query: 1959 LWIMHVPSDQFPNIYNCCRKILTISGCTFVCKAGFSXXX-XXXXXXXXXXXDHLENLMRAAVTQHQPQIKKIANIIQSQISH 2201
             W+  VP   FP +       LT+ G T+ C+  FS+ N IK K ++ LTN+HL   MR A+T  +P+ K +A  + +  SH
Sbjct:  542 FWLQIVPETMFPGLTKVALHTLTMFGSTYSCETAFSSMNIIKTKYRSRLTNEHLHMSMRLALTPFKPRFKLLAGQLHAHFSH 623          

HSP 3 Score: 34.2686 bits (77), Expect = 5.266e-55
Identity = 15/46 (32.61%), Postives = 26/46 (56.52%), Query Frame = 3
Query:  696 EASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNKDMIKK 833
            E SLK++W+L + +K ++D   VK+C     ++L       DM +K
Sbjct:  104 ECSLKIAWILAQHKKAFSDVTVVKECLNAAAETLLDGKLKDDMCEK 149          

HSP 4 Score: 21.557 bits (44), Expect = 5.266e-55
Identity = 8/34 (23.53%), Postives = 16/34 (47.06%), Query Frame = 1
Query:  571 TKRHYTSMNNNFEKNYPLGIKMREENVVSFSDDF 672
             KRHY + + +FE+ Y     +R   ++     +
Sbjct:   52 VKRHYETKHGSFEEMYLQKSAVRASKIIELKAQY 85          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Medaka
Match: ENSORLT00000046355.1 (pep primary_assembly:ASM223467v1:21:4582475:4584322:1 gene:ENSORLG00000025904.1 transcript:ENSORLT00000046355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 3.034e-51
Identity = 144/385 (37.40%), Postives = 220/385 (57.14%), Query Frame = 2
Query:  833 TDLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*--FDVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANK---DFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV*IKV---SLMSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSRE-----IVKL--DFFTRFKDIRNLTPLLLFIDNQF-----SCFNK--VKLLGGDEGEVQLKIIELKH 1918
            +D+QL   T ARR   +SS++  Q+  DL +   FSL  DE  D++ T QL++ I   F+  +  +ELL LLPLK T +G  IY  +KE  +   + ++ L++VTTD A  MVGR+ G +   K   DFP    YHCIIHQ ALC+K+      +VM  VVKI N IR+    HR FK+LLEE  + + DL+ + ++RWLSR ++L RFL LL+E K ++  K  E++ + L++  +   LAFL+DIT  LN LN +LQG    +  +I  ++   K    +  + LQ+    HFP++  V+++  ++  SE F++  E     I +L  +F  RF D+  L P + FI N F     +CF +        D G+V+++II L++
Sbjct:  145 SDVQLGASTMARRVSAMSSNLVDQLEQDLAKCKWFSLQCDESVDSSSTAQLLVFIRMVFNDFSTKEELLTLLPLKTTTRGVDIYNTVKEFFVQKKVPLEKLVAVTTDGAPAMVGRQTGFIAHCKRDPDFPKFLHYHCIIHQQALCAKVIG--FGHVMTPVVKIINNIRSKAKQHRIFKVLLEEMSAEYGDLLLHTEIRWLSRGRVLHRFLSLLREIKEFMQSK-GEDVSL-LEDTEWTLDLAFLVDITGKLNLLNCQLQGKGKTVVDMISALNA-FKAKMNAFSADLQRKKVLHFPSVQSVLKD--NASASETFEKVAEKYIEVINRLGQEFENRFCDLHQLEPCVFFISNPFMNGDTTCFAEQLSATFNLDAGQVEIEIITLQN 522          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.948 bits (450), Expect = 1.865e-49
Identity = 126/350 (36.00%), Postives = 194/350 (55.43%), Query Frame = 2
Query:  833 TDLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*--FDVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANK---DFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV-*IKVSLMS-QLQQSNYTHFPALSKVVQEYQDSIKS-----EQFDQSREIVKLDFFTRFKDIRNLTPLLLFIDNQF 1843
            +D+QL   T ARR   LS ++ +++  DL     FS+  DE  D+  T QL+I I   F+  +  +ELL LLPLK T +G  IY  +K   +   + ++ L+SVTTD A  M GR +G +   K   DFP    YHCIIHQ A+C+K+      +VM  VVKI N IR+    HR FK+L++E  + + DL+ + ++RWLSR ++L RFL LL E K ++  K  +  +  L++P ++  LAFL D+T +LN LN +LQG    +   I  ++    K+S+ S QLQ+    HFP++   + +   +  +     +++ Q    +  +F  RF D   L P + F+ N F
Sbjct:  145 SDVQLGASTIARRVTSLSENLTEKLDRDLAACRWFSVQCDESVDSASTAQLMIFIRMVFEDFSTKEELLTLLPLKTTTRGVDIYTTVKNFFVEKKVPVQKLVSVTTDGAPAMTGRHVGFIAQCKNDPDFPKFLHYHCIIHQQAICAKVTG--FDHVMTPVVKIINSIRSKAKQHRMFKMLMDELSAEYGDLLLHTEIRWLSRGRILQRFLSLLGEIKEFMKSKGEDTSL--LEDPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAALNEAVKKYSQVINRLGQEFEDRFCDFEQLEPCVSFVTNPF 490          

HSP 2 Score: 32.3426 bits (72), Expect = 1.865e-49
Identity = 14/44 (31.82%), Postives = 26/44 (59.09%), Query Frame = 3
Query:  681 SDCVTEASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFK 812
            S   TEAS + +  L K +KP++DG+ +K+      +++F + K
Sbjct:   92 SHNATEASFRAAHFLIKNKKPFSDGEVLKEAMMLVANTIFKDEK 135          

HSP 3 Score: 28.4906 bits (62), Expect = 1.865e-49
Identity = 10/25 (40.00%), Postives = 16/25 (64.00%), Query Frame = 1
Query:  571 TKRHYTSMNNNFEKNYPLGIKMREE 645
             +RH+ + + NF+ NYP G  +R E
Sbjct:   45 VERHFKTCHKNFDANYPPGSALRTE 69          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Medaka
Match: ENSORLT00000027991.1 (pep primary_assembly:ASM223467v1:15:8817619:8823815:1 gene:ENSORLG00000022420.1 transcript:ENSORLT00000027991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 3.229e-47
Identity = 121/359 (33.70%), Postives = 194/359 (54.04%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANF-------KELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANKDFPNSQ--AYHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSL-MSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKLDFFT---------RFKDIRNLTPLLLFIDNQFSC 1849
            D+ LS +T   RT M+S+ I      DL  A  FSLALDE  D ++  Q      F V A +       +E LA+LPLK T +G+ ++K+  E      + +  L+SV TD A  MVG+  G +   ++    +  ++HCI+HQ ALC+++  ++L  VM  VV++ NFI A  LN RQFK LLEE  +++  L+ + +VRWLSR K+L+RF   L E + +L  K  E     L +  ++ +  +L+D+T HLN LN+K+QG+ + + SL + + +   ++ L ++ ++     HF  L+    E++D+  +   D+   + +L  FT         RF + R  TPL  FI +   C
Sbjct:  146 DMPLSARTVHDRTIMMSNQIEATQVKDLNAAQFFSLALDESTDVSNLSQ------FSVIARYVAGDTIREESLAVLPLKGTTRGEDLFKSFNEFAKEKNLPMDKLVSVCTDGAPCMVGKNRGFVALLREHEKRRILSFHCILHQEALCAQMCGEQLGEVMSLVVRVVNFIVARALNDRQFKALLEEVGNSYPGLLLHSNVRWLSRGKVLSRFAACLSEIRTFLERKNVEH--PELADTEWLLKFYYLVDMTGHLNHLNVKMQGVGNTIFSLQQAVFAFENRLELFIADIETGRLLHFEKLA----EFKDACIASDPDRHLHLQQLAGFTSNLLQSFKARFGEFRERTPLFKFITHPHEC 492          

HSP 2 Score: 37.3502 bits (85), Expect = 3.229e-47
Identity = 18/47 (38.30%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  699 ASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNKDMIKKQI 839
            AS   +  + K  KP+TDG+  K    +  + L+A F +KD I KQI
Sbjct:   98 ASFAAALAIVKNGKPFTDGEFAKSFMLDVANELYANFSDKDKIIKQI 144          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Medaka
Match: ENSORLT00000035623.1 (pep primary_assembly:ASM223467v1:9:5067000:5069708:1 gene:ENSORLG00000026230.1 transcript:ENSORLT00000035623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 3.652e-47
Identity = 121/359 (33.70%), Postives = 194/359 (54.04%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANF-------KELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANKDFPNSQ--AYHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSL-MSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKLDFFT---------RFKDIRNLTPLLLFIDNQFSC 1849
            D+ LS +T   RT M+S+ I      DL  A  FSLALDE  D ++  Q      F V A +       +E LA+LPLK T +G+ ++K+  E      + +  L+SV TD A  MVG+  G +   ++    +  ++HCI+HQ ALC+++  ++L  VM  VV++ NFI A  LN RQFK LLEE  +++  L+ + +VRWLSR K+L+RF   L E + +L  K  E     L +  ++ +  +L+D+T HLN LN+K+QG+ + + SL + + +   ++ L ++ ++     HF  L+    E++D+  +   D+   + +L  FT         RF + R  TPL  FI +   C
Sbjct:  173 DMPLSARTVHDRTIMMSNQIEATQVKDLNAAQFFSLALDESTDVSNLSQ------FSVIARYVAGDTIREESLAVLPLKGTTRGEDLFKSFNEFAKEKNLPMDKLVSVCTDGAPCMVGKNRGFVALLREHEKRRILSFHCILHQEALCAQMCGEQLGEVMSLVVRVVNFIVARALNDRQFKALLEEVGNSYPGLLLHSNVRWLSRGKVLSRFAACLSEIRTFLERKNVEH--PELADTEWLLKFYYLVDMTGHLNHLNVKMQGVGNTIFSLQQAVFAFENRLELFIADIETGRLLHFEKLA----EFKDACIASDPDRHLHLQQLAGFTSNLLQSFKARFGEFRERTPLFKFITHPHEC 519          

HSP 2 Score: 37.3502 bits (85), Expect = 3.652e-47
Identity = 18/47 (38.30%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  699 ASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNKDMIKKQI 839
            AS   +  + K  KP+TDG+  K    +  + L+A F +KD I KQI
Sbjct:  125 ASFAAALAIVKNGKPFTDGEFAKSFMLDVANELYANFSDKDKIIKQI 171          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Planmine SMEST
Match: SMESG000016692.1 (SMESG000016692.1)

HSP 1 Score: 298.901 bits (764), Expect = 8.115e-91
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 1
Query: 3130 QFNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 3564
            QFNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS
Sbjct:  248 QFNISHFINFLAFGDHYPGFTNPLDNLKVNVEELSHMYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFNYDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVLEKLEAGKLS 392          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Planmine SMEST
Match: SMESG000045419.1 (SMESG000045419.1)

HSP 1 Score: 154.451 bits (389), Expect = 4.261e-39
Identity = 127/377 (33.69%), Postives = 194/377 (51.46%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANF---KELLALLPLKNTIKGKYIYKALKECLI*NGIDIK--NLISVTTDSALPMVGRKIGLL------LANKDFPNSQAYHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEISV-*IKVSLMSQ-LQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKLDFFTRFKDIRNLTPLLLFIDNQFSC-FNKVKLLGGDEGEVQLKIIELKHS 1921
            D+ LS +T ARR E + +++++Q+    +    +SLA+DE  D TDT QLII I   +  +F   +EL +L  LK+ I G  ++  +KE L  N ++++   L  VTTD    M G K G++      L N    N   +HCIIHQ +LC  +    +K++M+ ++   N+IR + L HRQFK  L+E DS FND++ Y  VRWLSR  +L R        K YL                 I  LAF++DIT +LN+LNL LQG   +L  L  +I+    K+ L+ + + + N THF     V  +   + K   F        +DF  +  +IR      LF+ N F+   N V        E+Q++I++L+H+
Sbjct:  119 DISLSARTCARRVEEIGTNLFEQLKCKAKSFDCYSLAMDESIDITDTAQLIIFI-RGIDGDFNVHEELTSLCSLKDAITGNDLFIKVKETL--NSLELRWEKLKCVTTDGGRNMCGSKTGVVGRICAELQNIACDNPMVFHCIIHQESLCCTILSS-MKDIMNTLISTVNYIRRHGLKHRQFKKFLKEIDSEFNDVIYYSAVRWLSRGAVLRR--------KYYLTA---------------IGSLAFMVDITTYLNELNLNLQGKGKLLADLFCDINAFEAKLCLLKKHMIEENLTHFICCKSVPADGWQTQKGTFF--------MDFHNKSSEIR------LFL-NPFNVDINDVP------NELQMEILQLQHN 447          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Planmine SMEST
Match: SMESG000037770.1 (SMESG000037770.1)

HSP 1 Score: 120.168 bits (300), Expect = 4.021e-30
Identity = 98/312 (31.41%), Postives = 161/312 (51.60%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANF---KELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANKD-----FPNSQ--AYHCIIHQ*ALCSKLKDDKLKNVMDVVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYLGGKR-NEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI-SV*IKVSLMSQ--LQQSNYTHFPALSKVVQEYQDS 1729
            ++ LS +T  RR E ++ D+  Q+   ++    FS+ALDE  D  DT QL+I I   +   F   +ELL++  LK+T  G+ ++  L + L    + +  L SVTTD A  + G+ +GL+   KD      P+      HCIIHQ +LC        K+V+D   +   +        QFK  LE+ +S+ +D++ + +VRWLS  K+L R  +L  E  ++L  K    E    +    ++S  +F +DI D LN+LN+KLQG       L  E+ S  +K+ L S+   +Q +     AL +  ++Y+++
Sbjct:  663 NISLSRRTVVRRIESIAEDLSDQLLNKIKTFQWFSIALDESTDIQDTAQLLIFI-RGIDDKFIATEELLSMEHLKDTTTGQDLFDNLIKALDKFELPLDKLASVTTDGAPSLTGKNVGLITKIKDHVKNLHPDHTIIPLHCIIHQESLC--------KSVLDFNTLLTLL--------QFKSFLEDLESDHSDVLYHTNVRWLSLGKVLKRVWNLKDEIVLFLEMKDITVEFTTQMKTSEWLSDFSFAVDILDKLNELNVKLQGKGVFAHELFAEVKSFQVKLQLFSRHLKEQKDRYETEALPEAEKDYEET 957          

HSP 2 Score: 32.3426 bits (72), Expect = 4.021e-30
Identity = 16/45 (35.56%), Postives = 26/45 (57.78%), Query Frame = 3
Query:  684 DCVTEASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNK 818
            +  T+ASL ++  + K  KP+++G+ VK C  E  D +  E K K
Sbjct:  616 EAATKASLVIAHKIVKHNKPFSEGEFVKDCVLEIADIICPENKKK 660          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Planmine SMEST
Match: SMESG000011945.1 (SMESG000011945.1)

HSP 1 Score: 110.538 bits (275), Expect = 6.760e-30
Identity = 85/270 (31.48%), Postives = 136/270 (50.37%), Query Frame = 2
Query:  836 DLQLSHQTFARRTEMLSSDIYKQIYGDLREASGFSLALDEFCDTTDTEQLII*I*FDVKANFKELLALLPLKNTIKGKYIYKALKECLI*NGIDIKNLISVTTDSALPMVGRKIGLLLANKDFPNSQ--AYHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYL--GGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQGIYHILPSLIKEI 1630
            +L LS +T   RT  + S+I  Q   DL+  SG S A+D+ CD  DT Q+ +                       +G+ I  ++ EC+    I +  ++S++TD A  M+G   G +   K+  N +   YHCI +Q  LC++   +++  VM  V+ I N I A  LNHRQ K  L E +S + D + +  ++WLSR   L R   LLQE +++L   G    EL    DN   I    F++D+  H+N+LN K Q   + + S+++++
Sbjct:   58 ELSLSAKTMKDRTIKMCSNITIQQIEDLKLVSGLSTAVDKSCDIKDTMQVSL---------------------FTRGEDIASSVVECMDKYDIPLDEIVSISTDGAKSMIGVSKGFVAILKEKINHEIFVYHCIFNQETLCAQTFPEEICKVMRLVITIINSIVAKALNHRQLKECLVEMESEYADPLLHNKIQWLSRGNALKRLASLLQEIEVFLLEKGVHYPELT---DNQR-IQNFHFVVDVMYHINQLNRKPQRNGNTIFSMLEKV 302          

HSP 2 Score: 41.2022 bits (95), Expect = 6.760e-30
Identity = 22/53 (41.51%), Postives = 33/53 (62.26%), Query Frame = 3
Query:  678 ASDCVTEASLKVSWVLTK*QKPYTDGDTVKQCFQECTDSLFAEFKNK-DMIKK 833
            +S  V  +   VS  ++K +KPYTD + +K CF   ++ LF +FKNK D +KK
Sbjct:    3 SSSNVNISGFVVSQEISKRKKPYTDKEYIKSCFINASEELFRDFKNKADNLKK 55          
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Planmine SMEST
Match: SMESG000011571.1 (SMESG000011571.1)

HSP 1 Score: 103.219 bits (256), Expect = 6.624e-25
Identity = 66/166 (39.76%), Postives = 95/166 (57.23%), Query Frame = 2
Query: 1112 IDIKNLISVTTDSALPMVGRKIGLLLANKDFPNSQ--AYHCIIHQ*ALCSKLKDDKLKNVMD-VVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLARFLDLLQEAKIYL--GGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLKLQG 1594
            I +  ++S++TD A  M G +   +   K+  N +  AYHCIIHQ ALC +   +++  VM  ++ I N I    LNHRQFK  L E +S + +L+ +  VRWLSR  +L  F  LL E +++L   G    E    L N  +I    F++D+T HLN+LNLKLQG
Sbjct:    6 IPLDKIVSISTDVAKSMSGFRKWFVAILKERINHEIFAYHCIIHQEALCEQTFPEEISKVMRLMITIINSIVVKGLNHRQFKEFLVEMESEYANLLLHNKVRWLSRRNVLKLFSSLLPEIEVFLLEKGVHYPE----LTNNQWIQYCHFVVDVTSHLNQLNLKLQG 167          
The following BLAST results are available for this feature:
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERGIC31.952e-4148.95ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:159... [more]
ERGIC32.044e-4148.95ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:159... [more]
ERGIC32.206e-4148.95ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:159... [more]
ERGIC39.869e-3447.24ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:159... [more]
ERGIC34.268e-3241.03ERGIC and golgi 3 [Source:HGNC Symbol;Acc:HGNC:159... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
erv-461.380e-3043.54Yeast ERV (ER to Golgi transport Vesicle protein) ... [more]
erv-461.380e-3043.54Yeast ERV (ER to Golgi transport Vesicle protein) ... [more]
Y102A11A.62.497e-1530.46pep chromosome:WBcel235:X:2031963:2035245:-1 gene:... [more]
C18B12.68.461e-1030.47pep chromosome:WBcel235:X:15004064:15007308:-1 gen... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG70115.690e-3247.95gene:FBgn0036489 transcript:FBtr0075645[more]
CG42936.890e-825.69gene:FBgn0024983 transcript:FBtr0100475[more]
CG42936.890e-825.69gene:FBgn0024983 transcript:FBtr0100476[more]
CG42936.890e-825.69gene:FBgn0024983 transcript:FBtr0070089[more]
CG42936.890e-825.69gene:FBgn0024983 transcript:FBtr0070090[more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL928808.11.844e-6234.58pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
CR392001.31.025e-5333.43pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
ergic32.210e-4252.45ERGIC and golgi 3 [Source:NCBI gene;Acc:393990][more]
ergic32.296e-4252.45ERGIC and golgi 3 [Source:NCBI gene;Acc:393990][more]
si:ch211-225b10.31.196e-2139.37si:ch211-225b10.3 [Source:ZFIN;Acc:ZDB-GENE-130531... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000016563.18.809e-4536.71pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
spag11.460e-4437.39sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
washc2a6.733e-4150.35WASH complex subunit 2A [Source:Xenbase;Acc:XB-GEN... [more]
washc2a1.217e-4050.35WASH complex subunit 2A [Source:Xenbase;Acc:XB-GEN... [more]
washc2a1.988e-4050.35WASH complex subunit 2A [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ergic31.329e-4249.32ERGIC and golgi 3 [Source:MGI Symbol;Acc:MGI:19136... [more]
Ergic31.731e-4148.95ERGIC and golgi 3 [Source:MGI Symbol;Acc:MGI:19136... [more]
Ergic32.455e-3348.74ERGIC and golgi 3 [Source:MGI Symbol;Acc:MGI:19136... [more]
Gtf2ird22.563e-2628.27GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
Zbed55.073e-2329.28zinc finger, BED type containing 5 [Source:MGI Sym... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q803I2|ERGI3_DANRE1.733e-4152.45Endoplasmic reticulum-Golgi intermediate compartme... [more]
sp|Q5EAE0|ERGI3_BOVIN6.855e-4148.95Endoplasmic reticulum-Golgi intermediate compartme... [more]
sp|Q4R8X1|ERGI3_MACFA7.799e-4148.95Endoplasmic reticulum-Golgi intermediate compartme... [more]
sp|Q9Y282|ERGI3_HUMAN9.372e-4148.95Endoplasmic reticulum-Golgi intermediate compartme... [more]
sp|Q5R8G3|ERGI3_PONAB1.021e-4048.95Endoplasmic reticulum-Golgi intermediate compartme... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GXQ09.485e-8599.29Endoplasmic reticulum-golgi intermediate compartme... [more]
A0A1A8U9C81.418e-6631.57Dimer_Tnp_hAT domain-containing protein (Fragment)... [more]
A0A1A8AR989.170e-6631.57Uncharacterized protein OS=Nothobranchius furzeri ... [more]
A0A3B1K1Z51.876e-6334.52Uncharacterized protein OS=Astyanax mexicanus OX=7... [more]
A0A3P8QWL91.044e-6031.46Dimer_Tnp_hAT domain-containing protein OS=Astatot... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050151.11.172e-6634.52pep primary_assembly:Astyanax_mexicanus-2.0:17:232... [more]
ENSAMXT00000039226.11.945e-5538.92pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030525.19.749e-5536.23pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
ENSAMXT00000037725.15.799e-5237.08pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
ENSAMXT00000052542.11.367e-5137.60pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ergic31.729e-4551.39ERGIC and golgi 3 [Source:NCBI gene;Acc:393990][more]
ergic36.200e-3246.22ERGIC and golgi 3 [Source:NCBI gene;Acc:393990][more]
si:ch211-225b10.35.172e-1738.02si:ch211-225b10.3 [Source:ZFIN;Acc:ZDB-GENE-130531... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ERV412.304e-1740.60Protein localized to COPII-coated vesicles; forms ... [more]
ERV467.752e-1430.54Protein localized to COPII-coated vesicles; forms ... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO428352.415e-4353.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477286.157e-2640.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492493.357e-1937.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017252.25.266e-5534.27pep primary_assembly:ASM223467v1:13:14820116:14821... [more]
ENSORLT00000046355.13.034e-5137.40pep primary_assembly:ASM223467v1:21:4582475:458432... [more]
ENSORLT00000033470.11.865e-4936.00pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000027991.13.229e-4733.70pep primary_assembly:ASM223467v1:15:8817619:882381... [more]
ENSORLT00000035623.13.652e-4733.70pep primary_assembly:ASM223467v1:9:5067000:5069708... [more]
back to top
BLAST of endoplasmic reticulum-golgi intermediate compartment protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016692.18.115e-91100.00SMESG000016692.1[more]
SMESG000045419.14.261e-3933.69SMESG000045419.1[more]
SMESG000037770.14.021e-3031.41SMESG000037770.1[more]
SMESG000011945.16.760e-3031.48SMESG000011945.1[more]
SMESG000011571.16.624e-2539.76SMESG000011571.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013471
GenBankAKG62102.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013471 ID=SMED30013471|Name=endoplasmic reticulum-golgi intermediate compartment protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=3722bp
CTCAGGTAAAAATTGCGATTCTATTAGATCAGTGCTGTCCATCCTGTGGC
CCATTGCATGATTTTAAGTGGACCACCAGAGTGCTTGCTATAATCCACCT
TATATCAAACCTCACTGCATCGTTTCGACTATACCTAATTCAACATTTTT
AATATATTAAAATTAAACTGACTAATTAAAATTATTTATAGTTTAATCAT
TTAACTTTAATGATTAAACTAAAATTTATAGTATAAATAATTTTCTTTAT
AAATTAATAATTAATTATTAATTGTATAAATTTTTCAATTACGAAAACAA
AAAAAATATATAAATTCAAACCATTATTTCTACAAACAGAAAAAGACTCC
TAAATTTGAAGTTTAAAATATGGGTTATTAAATTAACATTATTAATTTTA
TTATTATTTAGGTTTCCAGATATCGGCAGCAGAAAGCGAAAAGTTACTGA
AGAAAATCGTTTGTTCAATTCATCTTGGGAACTTGAATTCTGGTTTAGAA
TATCTGGTGAGAAGCCGGTTGGTTTGTTGTTGTGTCGAAATTCCATCTCA
GTTTTGAAGAAACTCAATTTACAAAGAGACACTACACGTCCATGAATAAT
AATTTTGAAAAGAATTATCCGCTTGGTATAAAGATGAGAGAAGAAAATGT
TGTTTCTTTTTCAGACGACTTCTGATCGCAAGTGACTGTGTAACGGAGGC
ATCCTTGAAGGTCAGCTGGGTTTTAACTAAATAACAAAAACCATATACCG
ATGGTGACACAGTTAAGCAATGTTTTCAAGAATGTACCGATTCTTTGTTT
GCTGAGTTTAAAAACAAAGATATGATTAAGAAACAGATCTTCAGTTATCT
CATCAGACTTTTGCCAGACGAACTGAGATGTTATCCAGTGACATATATAA
GCAGATTTACGGCGATTTGAGGGAAGCATCTGGATTCAGTTTAGCGTTGG
ATGAATTTTGCGATACAACTGACACGGAACAGCTCATAATTTGAATTTGA
TTTGACGTGAAGGCTAACTTTAAAGAATTGTTGGCACTGTTGCCACTGAA
AAATACAATCAAGGGGAAATATATATACAAAGCACTGAAGGAATGTTTAA
TATAAAATGGAATTGACATTAAAAATCTTATATCAGTTACCACTGATAGT
GCCCTACCAATGGTAGGAAGAAAAATTGGCTTGCTGCTGGCAAACAAGGA
TTTCCCGAACTCTCAAGCTTATCACTGCATCATTCATCAGTAAGCACTTT
GTTCGAAATTGAAAGATGATAAACTAAAAAATGTAATGGATGTTGTTAAG
ATTGCAAATTTTATTCGGGCCAATCCTTTGAATCACAGGCAGTTCAAGAT
ACTGTTAGAAGAGTATGACAGCAATTTTAACGATTTAGTCCAATATATTG
ATGTGCGTTGGCTGAGCAGAGTGAAATTACTGGCAAGATTTTTGGACTTA
TTGCAAGAAGCCAAAATTTACCTTGGTGGGAAGCGTAACGAAGAGTTAAT
GATGCATCTTGATAATCCAGTGTTTATTTCAAGACTAGCATTCTTGATTG
ACATCACAGATCACCTTAACAAGCTAAATTTGAAATTGCAAGGAATATAT
CACATTTTACCTTCTCTGATAAAGGAAATTAGTGTTTGAATCAAAGTTTC
ACTAATGAGTCAATTGCAGCAATCAAATTATACACATTTTCCAGCACTTT
CCAAGGTAGTACAAGAATACCAAGATTCAATTAAAAGTGAGCAGTTCGAC
CAATCACGGGAAATAGTGAAATTAGATTTTTTCACTCGTTTCAAGGACAT
TCGCAATTTGACTCCTCTGTTGCTTTTTATTGACAATCAATTCAGTTGTT
TCAACAAAGTGAAGTTATTAGGAGGTGATGAAGGTGAAGTTCAACTGAAA
ATTATTGAATTGAAGCATAGTGTCGCTGTTCAGGATAATCTCAATAAAAC
GACCCCAACTTTGGATAATGCATGTGCCTTCGGATCAGTTTCCAAACATT
TATAACTGTTGTAGGAAAATATTGACCATATCTGGATGCACTTTTGTATG
TAAAGCTGGATTTTCGACAACCAACATCAAATAAAAAAAGAAAAACTAGT
TGACTAACGATCATTTAGAAAACCTTATGAGAGCAGCTGTTACTCAGCAT
CAGCCACAAATTAAAAAAATTGCAAATATTATTCAAAGTCAAATTTCTCA
TTAAAATCGATAAATTTTTAAAAGTTGTAAACATATTCTGGTTTTTATTT
AAAATTTATTAAAGTTACATAACAAAATTTTAGATTAAACCCATTTGCGG
CCCTTAACATCCTGAAAATTATTTGAGTGGCTCAGCATTGAATTAAATCT
TTTACAACAAATCAATAATTTATAATCATTTTATGTAGCCAAGTGGTAAT
CGATAATATCTTACAGCTATTTGCACAATTGAATAACTTATCTGTTGTTA
ATGCACAGATGTGATTTAAGGTTTTCTAAAGTTCATTGGTTAAATAACTG
TTGGGTATCGTATCACAAAGGGACAAATGGGACACTAGGGAAGAGGTTCG
AGTGCTTAAGACATCCCCAGCAGCATTTGTCGTTTAAATGTTGTACATAA
TAGTTCAATGGATCTTTTTTATATACTATATATGTTCATGTCCCCTATGT
TCCCATTTGATCGGTTTAACTATGTGCGTATGTTTTTCTCCATTTGTCAA
CCAATATTGTGCCTTATTACACATAATGTTGTAATTAAATTTAGCCTATA
AATTATTTAAATTTCACTTTTTATGGATTTAAAACTAACTTTTTAAAAAA
TTTGATAAAGAAATAGCTGAAATCTCTAGAGTGGAACTTCAGGGCACAGT
TTGAGAACCGTTGCTGCAGAGAATTTTAATGCAATTCCAATATAATAAAA
ATCAATTATTATTAGTGTGGAATATAAATATTTTGAAAAATTTATAAAAT
ATAATTGATGAAATTAAAAATTTTAAAAATCGATAATATCGAGAGAATTT
TTTGAGGAATTTATGGGTAAATTTGTGGTATAAACGGGCTAATTTCGGAA
TTATTTTATTTATCTCGATTTATATAGAGATAAATTTTGGAAATTATTTA
GTAATTATTGATTTTGTAAAATTTACCTTCAGTTCAATATTTCACATTTT
ATCAATTTCCTGGCATTTGGTGATCATTATCCCGGATTTACAAATCCTCT
GGACAATTTGAAAGTCAATGTTGAAGAATTAAGTCATATGTATACATATT
ACGTGAAAATCGTTCCTACTACTTATGTGAAATTGAATGGTTCAGTTCTC
CATACTAATCAGTTTTCTGTTACAAAATATATCAAGCCCACTGCTCTGTC
GGGGGGCCATGAAGGATTACCGGGTATTTTTTTCAACTATGATATCAATC
CAATTATGGTGTGGATTAAAGAAAATGATAAATCATTTATTCAATTTATC
ACGAATTTATGTGCCATTGTTGGAGGGATTTTTACAGTTTCCAGTTTGAT
TGATTCATTAATCTATCATTCTTCAAAGGTTGTGTTGGAAAAACTGGAAG
CGGGAAAATTGTCATAATTTTATTTCGTTGGCATGTGATGTAGCCATAAT
CTCAAAATTCCTTATGGATGTTTGCGACGTTTGACAGTGTAATGCTGTCA
TATTTTTATGTATACAATGAAAAATAAATAATTTTTGTGTAGGTACAATG
GAAATATATTCTGAACATTTTA
back to top

protein sequence of SMED30013471-orf-1

>SMED30013471-orf-1 ID=SMED30013471-orf-1|Name=SMED30013471-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MYTYYVKIVPTTYVKLNGSVLHTNQFSVTKYIKPTALSGGHEGLPGIFFN
YDINPIMVWIKENDKSFIQFITNLCAIVGGIFTVSSLIDSLIYHSSKVVL
EKLEAGKLS*
back to top

protein sequence of SMED30013471-orf-2

>SMED30013471-orf-2 ID=SMED30013471-orf-2|Name=SMED30013471-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MSQLQQSNYTHFPALSKVVQEYQDSIKSEQFDQSREIVKLDFFTRFKDIR
NLTPLLLFIDNQFSCFNKVKLLGGDEGEVQLKIIELKHSVAVQDNLNKTT
PTLDNACAFGSVSKHL*
back to top

protein sequence of SMED30013471-orf-3

>SMED30013471-orf-3 ID=SMED30013471-orf-3|Name=SMED30013471-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MDVVKIANFIRANPLNHRQFKILLEEYDSNFNDLVQYIDVRWLSRVKLLA
RFLDLLQEAKIYLGGKRNEELMMHLDNPVFISRLAFLIDITDHLNKLNLK
LQGIYHILPSLIKEISV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000478pharynx musculature
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR026630EPM2A-int_1
IPR012936Erv_C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR45913:SF3coord: 1..117
IPR026630EPM2A-interacting protein 1PANTHERPTHR45913FAMILY NOT NAMEDcoord: 1..117