Tigger transposable element-derived protein 1

Overview
NameTigger transposable element-derived protein 1
Smed IDSMED30013450
Length (bp)2667
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tigger transposable element-derived protein 1 (SMED30013450) t-SNE clustered cells

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30013450) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tigger transposable element-derived protein 1 (SMED30013450) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30013450) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013450

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013450h1SMcG0004181 SmedASXL_008779SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: SPOUT1 (SPOUT domain containing methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:26933])

HSP 1 Score: 242.662 bits (618), Expect = 1.158e-71
Identity = 137/331 (41.39%), Postives = 193/331 (58.31%), Query Frame = 2
Query:  236 GRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQ---PIC-----EVVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK 1204
            GR YT+S+A+PGSILDNAQS E +  + GQIARA AI+ VDEIVV+DE+G+    +  + +    +G+              CV +A IL+Y++ P+YLRK+ FP+   L+ +  L PL  P H+R  +   +REGIV++ P        + V+ G+ + V+ID       R+TV+ NQ   P C     +VV+   PRTK G YWGY VR+A+CLS V            + P    YDL IGTSE+G++V   ++P F H L+VFG  QGLE     D  L + ++P  +F  Y+NTCP Q S+TIRTEEA+ ISL AL+  +   G +
Sbjct:   70 GRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQA-------------CVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPG--HGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVF----------AEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNL-EVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGAR 374          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 161.384 bits (407), Expect = 5.620e-41
Identity = 102/251 (40.64%), Postives = 137/251 (54.58%), Query Frame = 2
Query: 1895 KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASY----ICTWCARIFTGK*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDIT-------LTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPLV 2614
            +   + I   GY  QQ+FN +ET  +WK+MP+RTFI +EEKS+ G K  K+RLTLLL +NA GDFKLKPML YHSENPR    KN  KS LPV++K ++K ++    LF      Y    + T+C+     K I   +      A SH    L++    I V+ +P NTT ++QPM Q VI  FK  Y++  F K      D+D++       L  FWK  F IL  I  I  +W  V   TL   W+ L+
Sbjct:  167 EALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRAL--KNYTKSTLPVLYKWNSKARMT-AHLFTAWFTEYFKPTVETYCSE----KKIPFKILLLIDNAPSHPRA-LMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKAL-AAMDSDVSDGSGQSKLKTFWK-GFTILDAIKNIRDSWEEVKLSTLTGVWKKLI 407          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 109.768 bits (273), Expect = 2.721e-24
Identity = 78/245 (31.84%), Postives = 117/245 (47.76%), Query Frame = 2
Query: 1883 KYF*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVY--AHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            + F   F EF+  E    +Q++  ++TGLFWK +P+RT   + ++S SG +  +ER+ ++ C+NA G  KL   +   ++ PR FK  +L  S LPV + S     +  QS+F      Y      +    K +         +  A  + E+   D+   I V  LPPN T LIQPM Q V+   K+ Y   L  K  +  ND  I    FWK    +L  I  + +AW  V   T+ KAW+ L
Sbjct:  153 REFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIE-QSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRII-VKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEGNDPKI----FWKN-LTVLDAIYEVSRAWNMVKSSTITKAWKKL 388          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 109.768 bits (273), Expect = 2.721e-24
Identity = 78/245 (31.84%), Postives = 117/245 (47.76%), Query Frame = 2
Query: 1883 KYF*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVY--AHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            + F   F EF+  E    +Q++  ++TGLFWK +P+RT   + ++S SG +  +ER+ ++ C+NA G  KL   +   ++ PR FK  +L  S LPV + S     +  QS+F      Y      +    K +         +  A  + E+   D+   I V  LPPN T LIQPM Q V+   K+ Y   L  K  +  ND  I    FWK    +L  I  + +AW  V   T+ KAW+ L
Sbjct:  153 REFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIE-QSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRII-VKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEGNDPKI----FWKN-LTVLDAIYEVSRAWNMVKSSTITKAWKKL 388          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 95.1301 bits (235), Expect = 1.313e-19
Identity = 75/252 (29.76%), Postives = 120/252 (47.62%), Query Frame = 2
Query: 1889 F*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHIEVD----------LIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPLV 2614
            F   F +FI  E    +Q++N +ETGLFWK +P+R  + + + ++ GHK ++ER+T++ C+NA G  KLK  +   ++ PR FK  + +   LPV + S        +  +  L  S    W  +IF  + +   + S  +   + + +D          L  +   I    LPPN   LIQP  Q VI   K+ Y   L     E  ND    L  FWK+   +L  +  I  AW  V   T+++AW+ ++
Sbjct:  155 FCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTL--NLPVSYFSQ-------KGAWMDL--SIFRQWFDKIFVPQ-VREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLEEGND----LKSFWKK-LTLLDALYEIAMAWNLVKPVTISRAWKKIL 389          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Celegans
Match: B0361.6 (Putative methyltransferase B0361.6 [Source:UniProtKB/Swiss-Prot;Acc:Q10950])

HSP 1 Score: 142.895 bits (359), Expect = 1.159e-36
Identity = 102/320 (31.87%), Postives = 159/320 (49.69%), Query Frame = 2
Query:  245 YTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDH-FPYREGIVLENPQDKSCLKSNLVDIGLNELVEID-----IPQNVDSRITVKYNQPICE-----VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEM-----PKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCP-NQASKTIRTEEAV 1153
            +TISIAVPG  L+NAQS E +  M GQIARAA +Y VDEI++YDE      ++ D+  N    G     L+  E ++  C  +A IL+Y++ P+YLRK LFP    LKN+  L PL    HL+  +    +REG+VL+        +  + +IGL +  EID     +P      + +K     C+     + +  T   + G YWGY VR+   L  V+Q                ++D++ G S +G    + ++     PK   +LLVFG   G++ A+  ++ L +  + +  F   + T   +  S++ R EE V
Sbjct:   66 FTISIAVPGQFLNNAQSAELRTYMAGQIARAATLYRVDEIIIYDES----CRMTDEAVNAYYNGTWQGNLIPAETNYEGCFYLAKILEYLECPQYLRKDLFPIQKPLKNAGLLNPLDAQHHLKYDEKTLRFREGVVLKKRSKDG--RGPICNIGLEKEFEIDSDAVQLPPYTRVTVEIKNLTEQCKLYRGSITSGATVTRETGLYWGYSVRLMTGLQKVLQAK--------------KFDIVAGVSPRGKLASQMDVCILNKPK---ILLVFGGVAGVDAAVESEE-LAEWRRAEDAFDVLIRTTSLSNGSRSERVEENV 361          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Match: CG12128 (gene:FBgn0033473 transcript:FBtr0088393)

HSP 1 Score: 203.371 bits (516), Expect = 1.646e-56
Identity = 138/364 (37.91%), Postives = 199/364 (54.67%), Query Frame = 2
Query:   92 SKKKLKARDSEQRRQRKEERALKFLQNTNTDIKPFYKKGFNNICGVAEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE--------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMP----KFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEE 1147
            S KK+       +RQRK+++ LK LQ    + +    K  N +    +    T+SIAVPGSIL+NAQS E +  + GQIARAA I+ V+E++V+D+ G + T      S E D      E  ST    +  + +A IL+Y++ P+YLRK  FP    LK S  L PL  P HLR    F YREG++ +    K+    +  ++GL   V +D       R+TVK  +P  E        +V+ D PR + G YWGY+VR+A+ +S +  +S          P    YD+ +GTS++GTNV  +E+P     F H+L+VFG  QGLE A++ D+ L  D  P+ +F  Y+N  P Q S+TIRTEE
Sbjct:   22 SWKKVNEERKALKRQRKQDKLLKELQQAK-EAESQAGKAANEVQAKDKPNPSTLSIAVPGSILENAQSNELRAYVAGQIARAACIFRVNEVIVFDDVG-IATARETKRSYEADG-----EGSSTGTVRSSSLQLARILQYLECPQYLRKYFFPLHKDLKYSGLLNPLDTPHHLRQQSKFRYREGVICDK---KAKEGHSYANVGLLNDVLVDKAIEPGVRVTVKM-EPQSESCRKQRGTLVSPDEPRRETGVYWGYQVRIAHSMSEIFTKS----------PYATGYDVTVGTSDRGTNV--HEVPNRSYNFNHMLIVFGGLQGLESALANDEKLTVDD-PELLFDHYVNVLPRQGSRTIRTEE 361          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Match: CG12128 (gene:FBgn0033473 transcript:FBtr0088394)

HSP 1 Score: 98.9821 bits (245), Expect = 1.006e-22
Identity = 53/125 (42.40%), Postives = 77/125 (61.60%), Query Frame = 2
Query:  785 VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPK----FLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEE 1147
            +V+ D PR + G YWGY+VR+A+ +S +  +S          P    YD+ +GTS++GTNV  +E+P     F H+L+VFG  QGLE A++ D+ L  D  P+ +F  Y+N  P Q S+TIRTEE
Sbjct:   15 LVSPDEPRRETGVYWGYQVRIAHSMSEIFTKS----------PYATGYDVTVGTSDRGTNV--HEVPNRSYNFNHMLIVFGGLQGLESALANDEKLTVDD-PELLFDHYVNVLPRQGSRTIRTEE 126          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Match: spout1 (SPOUT domain containing methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-53])

HSP 1 Score: 238.039 bits (606), Expect = 4.270e-70
Identity = 135/329 (41.03%), Postives = 190/329 (57.75%), Query Frame = 2
Query:  230 AEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE--------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICN 1192
            ++GR YT+S+A+PGS++DNAQS E +  + GQIARA A++ VDE+V++DE G+    +  +      +G+              CV +A IL+Y++ P+YLRK  FP+   L+ +  L PL  P H+R  +   +REG+VL+ P      K + V+ G+ + V+ID       R+TV+ N+   +        VV    PRT+ G YWGY VR+A+CLS V         +C   P    YDL IGTSEKG N D   +P F H+L+VFG  QGLE ++  D+ L   S P  +F  YLNTCP Q S+TIRTEEA+ ISL  LR KI +
Sbjct:   71 SKGRLYTVSVALPGSVMDNAQSPELRTYLAGQIARACAVFCVDEVVIFDELGEDAKSVEGEFKGVGKKGQS-------------CVQLARILQYLECPQYLRKFFFPKHQDLQFAGLLNPLDSPHHMRIDEEAEFREGVVLDRPVKAG--KGSFVNCGMRKEVQIDKQLKTGLRVTVQLNESQNKDGRVYKGVVVAPHIPRTEAGLYWGYSVRLASCLSAVF-------SEC---PYKEGYDLTIGTSEKGQNTDHVTLPAFRHMLVVFGGLQGLEASVDADENL-TISDPSVLFDLYLNTCPAQGSRTIRTEEALLISLSGLRQKIAS 373          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Match: spout1 (SPOUT domain containing methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-53])

HSP 1 Score: 150.984 bits (380), Expect = 2.640e-40
Identity = 82/222 (36.94%), Postives = 127/222 (57.21%), Query Frame = 2
Query:  230 AEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE--------VVNRDTPRTKIGAYWGYRVRMANCLSGVM 871
            ++GR YT+S+A+PGS++DNAQS E +  + GQIARA A++ VDE+V++DE G+    +  +      +G+              CV +A IL+Y++ P+YLRK  FP+   L+ +  L PL  P H+R  +   +REG+VL+ P      K + V+ G+ + V+ID       R+TV+ N+   +        VV    PRT+ G YWGY VR+A+CLS + 
Sbjct:   71 SKGRLYTVSVALPGSVMDNAQSPELRTYLAGQIARACAVFCVDEVVIFDELGEDAKSVEGEFKGVGKKGQS-------------CVQLARILQYLECPQYLRKFFFPKHQDLQFAGLLNPLDSPHHMRIDEEAEFREGVVLDRPVKAG--KGSFVNCGMRKEVQIDKQLKTGLRVTVQLNESQNKDGRVYKGVVVAPHIPRTEAGLYWGYSVRLASCLSALF 277          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Match: spout1 (SPOUT domain containing methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-53])

HSP 1 Score: 71.2478 bits (173), Expect = 3.800e-13
Identity = 43/119 (36.13%), Postives = 59/119 (49.58%), Query Frame = 2
Query:  677 LKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE--------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLV 1009
             K + V+ G+ + V+ID       R+TV+ N+   +        VV    PRT+ G YWGY VR+A+CLS V    C + +          YDL IGTSEKG N D   +P F  +  V
Sbjct:  132 FKGSFVNCGMRKEVQIDKQLKTGLRVTVQLNESQNKDGRVYKGVVVAPHIPRTEAGLYWGYSVRLASCLSAVFSE-CPYKEG---------YDLTIGTSEKGQNTDHVTLPAFRSVSAV 240          

HSP 2 Score: 70.4774 bits (171), Expect = 7.062e-13
Identity = 29/53 (54.72%), Postives = 44/53 (83.02%), Query Frame = 2
Query:  230 AEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGK 388
            ++GR YT+S+A+PGS++DNAQS E +  + GQIARA A++ VDE+V++DE G+
Sbjct:   71 SKGRLYTVSVALPGSVMDNAQSPELRTYLAGQIARACAVFCVDEVVIFDELGE 123          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: atl2 (atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-947235])

HSP 1 Score: 254.603 bits (649), Expect = 5.921e-76
Identity = 151/386 (39.12%), Postives = 220/386 (56.99%), Query Frame = 2
Query:   80 EIKLSKKKLKARDSEQRRQRKEERALKFLQNTNTDIK--PFYKKGFNNICGVAEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE-------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK*N 1210
            E K+  +K K +  E R++ +EE+ LK L+ +    +     K+   N     +GR+YT+S+ +PGSI+DNAQS E +  + GQIARA AI+ +DEIV++DE G+    +  +      +G+              CV +A IL+Y++ P+YLRKS FP+   L+ +  L PL  P H+R  +   YREG+VL+ P      K + V+ G+ + V+ID       R+TVK  Q   E       VV+   PRT  G YWGYRVR+A+CLS V    C F D          YDL IGTSE+G++V+   +P F H ++VFG  +GLE ++  D+ L   ++P  +F  YLNTCP+Q S+TIRTEEA+ ISL AL+ ++    KK N
Sbjct:   34 EKKIDWRKEKQKRKEDRKKWREEKLLKKLERSQQQQQQTEHEKEMMVNEGKTPKGRQYTVSVVLPGSIMDNAQSPELRTYLAGQIARACAIFCIDEIVIFDETGEGSKSVEGNFEGVGKKGQA-------------CVQLARILQYLECPQYLRKSFFPKHPDLQFAGLLNPLDSPHHVRIDEESEYREGVVLDRPTKSG--KGSFVNCGMRKEVQIDRQLQTGVRVTVKLQQENVELKVQKGTVVSPQHPRTASGLYWGYRVRLASCLSAVFT-ECPFKDG---------YDLTIGTSERGSSVETVSLPDFRHAMIVFGGLKGLEASVESDQNL-DIAEPSILFNHYLNTCPDQGSRTIRTEEAILISLAALKPRLQAAIKKAN 393          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: atl2 (atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-947235])

HSP 1 Score: 245.358 bits (625), Expect = 1.603e-73
Identity = 138/333 (41.44%), Postives = 196/333 (58.86%), Query Frame = 2
Query:  233 EGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE-------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK*N 1210
            +GR+YT+S+ +PGSI+DNAQS E +  + GQIARA AI+ +DEIV++DE G+    +  +      +G+              CV +A IL+Y++ P+YLRKS FP+   L+ +  L PL  P H+R  +   YREG+VL+ P      K + V+ G+ + V+ID       R+TVK  Q   E       VV+   PRT  G YWGYRVR+A+CLS V    C F D          YDL IGTSE+G++V+   +P F H ++VFG  +GLE ++  D+ L   ++P  +F  YLNTCP+Q S+TIRTEEA+ ISL AL+ ++    KK N
Sbjct:   10 KGRQYTVSVVLPGSIMDNAQSPELRTYLAGQIARACAIFCIDEIVIFDETGEGSKSVEGNFEGVGKKGQA-------------CVQLARILQYLECPQYLRKSFFPKHPDLQFAGLLNPLDSPHHVRIDEESEYREGVVLDRPTKSG--KGSFVNCGMRKEVQIDRQLQTGVRVTVKLQQENVELKVQKGTVVSPQHPRTASGLYWGYRVRLASCLSAVFTE-CPFKDG---------YDLTIGTSERGSSVETVSLPDFRHAMIVFGGLKGLEASVESDQNL-DIAEPSILFNHYLNTCPDQGSRTIRTEEAILISLAALKPRLQAAIKKAN 316          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: atl2 (atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-947235])

HSP 1 Score: 245.743 bits (626), Expect = 3.351e-73
Identity = 138/332 (41.57%), Postives = 195/332 (58.73%), Query Frame = 2
Query:  236 GRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE-------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK*N 1210
            GR+YT+S+ +PGSI+DNAQS E +  + GQIARA AI+ +DEIV++DE G+    +  +      +G+              CV +A IL+Y++ P+YLRKS FP+   L+ +  L PL  P H+R  +   YREG+VL+ P      K + V+ G+ + V+ID       R+TVK  Q   E       VV+   PRT  G YWGYRVR+A+CLS V    C F D          YDL IGTSE+G++V+   +P F H ++VFG  +GLE ++  D+ L   ++P  +F  YLNTCP+Q S+TIRTEEA+ ISL AL+ ++    KK N
Sbjct:   41 GRQYTVSVVLPGSIMDNAQSPELRTYLAGQIARACAIFCIDEIVIFDETGEGSKSVEGNFEGVGKKGQA-------------CVQLARILQYLECPQYLRKSFFPKHPDLQFAGLLNPLDSPHHVRIDEESEYREGVVLDRPTKSG--KGSFVNCGMRKEVQIDRQLQTGVRVTVKLQQENVELKVQKGTVVSPQHPRTASGLYWGYRVRLASCLSAVFT-ECPFKDG---------YDLTIGTSERGSSVETVSLPDFRHAMIVFGGLKGLEASVESDQNL-DIAEPSILFNHYLNTCPDQGSRTIRTEEAILISLAALKPRLQAAIKKAN 346          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: atl2 (atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-947235])

HSP 1 Score: 243.047 bits (619), Expect = 1.299e-72
Identity = 137/331 (41.39%), Postives = 194/331 (58.61%), Query Frame = 2
Query:  239 RKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE-------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK*N 1210
            R+YT+S+ +PGSI+DNAQS E +  + GQIARA AI+ +DEIV++DE G+    +  +      +G+              CV +A IL+Y++ P+YLRKS FP+   L+ +  L PL  P H+R  +   YREG+VL+ P      K + V+ G+ + V+ID       R+TVK  Q   E       VV+   PRT  G YWGYRVR+A+CLS V    C F D          YDL IGTSE+G++V+   +P F H ++VFG  +GLE ++  D+ L   ++P  +F  YLNTCP+Q S+TIRTEEA+ ISL AL+ ++    KK N
Sbjct:   16 RQYTVSVVLPGSIMDNAQSPELRTYLAGQIARACAIFCIDEIVIFDETGEGSKSVEGNFEGVGKKGQA-------------CVQLARILQYLECPQYLRKSFFPKHPDLQFAGLLNPLDSPHHVRIDEESEYREGVVLDRPTKSG--KGSFVNCGMRKEVQIDRQLQTGVRVTVKLQQENVELKVQKGTVVSPQHPRTASGLYWGYRVRLASCLSAVFTE-CPFKDG---------YDLTIGTSERGSSVETVSLPDFRHAMIVFGGLKGLEASVESDQNL-DIAEPSILFNHYLNTCPDQGSRTIRTEEAILISLAALKPRLQAAIKKAN 320          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: atl2 (atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-947235])

HSP 1 Score: 242.662 bits (618), Expect = 1.645e-72
Identity = 137/331 (41.39%), Postives = 194/331 (58.61%), Query Frame = 2
Query:  239 RKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE-------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK*N 1210
            R+YT+S+ +PGSI+DNAQS E +  + GQIARA AI+ +DEIV++DE G+    +  +      +G+              CV +A IL+Y++ P+YLRKS FP+   L+ +  L PL  P H+R  +   YREG+VL+ P      K + V+ G+ + V+ID       R+TVK  Q   E       VV+   PRT  G YWGYRVR+A+CLS V    C F D          YDL IGTSE+G++V+   +P F H ++VFG  +GLE ++  D+ L   ++P  +F  YLNTCP+Q S+TIRTEEA+ ISL AL+ ++    KK N
Sbjct:   13 RQYTVSVVLPGSIMDNAQSPELRTYLAGQIARACAIFCIDEIVIFDETGEGSKSVEGNFEGVGKKGQA-------------CVQLARILQYLECPQYLRKSFFPKHPDLQFAGLLNPLDSPHHVRIDEESEYREGVVLDRPTKSG--KGSFVNCGMRKEVQIDRQLQTGVRVTVKLQQENVELKVQKGTVVSPQHPRTASGLYWGYRVRLASCLSAVFTE-CPFKDG---------YDLTIGTSERGSSVETVSLPDFRHAMIVFGGLKGLEASVESDQNL-DIAEPSILFNHYLNTCPDQGSRTIRTEEAILISLAALKPRLQAAIKKAN 317          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Spout1 (SPOUT domain containing methyltransferase 1 [Source:MGI Symbol;Acc:MGI:106544])

HSP 1 Score: 240.35 bits (612), Expect = 5.838e-71
Identity = 139/332 (41.87%), Postives = 195/332 (58.73%), Query Frame = 2
Query:  233 EGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQ---PICE-----VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK 1204
            +GR YT+S+A+PGSILDNAQS E +  + GQIARA  I+ VDEIVV+DE+G+      D  S E        E     +    CV +A IL+Y++ P+YLRK+ FP+   L+ +  L PL  P H+R  +   +REG+V++ P        +LV+ G+ + V+ID   +   R+TV+ NQ   P C+     VV+   PRTK G YWGY VR+A+CLS V            + P    YDL IGTSE+G++V   ++P F H L+VFG  QGLE A+  D  L + + P  +F  Y+NTC +Q S+TIRTEEA+ ISL AL+  +   G +
Sbjct:   70 QGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACTIFCVDEIVVFDEEGQ------DTKSVE-------GEFRGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGILNPLDSPHHMRQDEESEFREGVVVDRPTKAG--HGSLVNCGMKKEVKIDKKLDPGLRVTVRLNQQQLPECKTYKGTVVSSQDPRTKAGLYWGYTVRLASCLSAVF----------AEAPFQDGYDLTIGTSERGSDVASAQLPSFRHALVVFGGLQGLEAAVDADPNL-EVADPSVLFDFYVNTCLSQGSRTIRTEEAILISLAALQPGLTQVGSR 375          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 101.293 bits (251), Expect = 9.329e-22
Identity = 73/244 (29.92%), Postives = 112/244 (45.90%), Query Frame = 2
Query: 1901 FIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVI-------WKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            F EF+  E  + +Q++  ++TGLFWK +P RT     ++S   ++  +ER+ ++ C+NA G  KL   +   ++ PR FK  +L  S LPV        W   + LK   +  F   V  ++ +   R      +       +  AH   E+   D+   I V  LPPN T LIQPM Q V+   K+ Y   L  K  +  ND       FWK    +L  I    +AW  +   T+ +AW+ L
Sbjct:  159 FQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDL--SNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLD------FPAAHPAEELLSSDDGRII-VKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMDEGNDPKT----FWKN-LTVLDAIYEASRAWNQIRSNTITRAWKKL 388          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 93.9745 bits (232), Expect = 2.059e-19
Identity = 75/252 (29.76%), Postives = 119/252 (47.22%), Query Frame = 2
Query: 1889 F*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHIEVD----------LIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPLV 2614
            F   F +FI  E    +Q++N +ETGLFWK +P+RT + + + ++ GH   +ER+T++ C+NA G  KLK  +   +  PR FK  + +   LPV + S        +  +  L  S    W  +IF  + +   + S  +   + + +D          L  +   I    LPPN   LIQP+ Q VI   K+ Y   L     E  ND    L  FWK+   +L  +  I  AW  V   T+++AW+ ++
Sbjct:  155 FCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTL--NLPVSYFSQ-------KGAWMDL--SIFRQWFDKIFVPQ-VREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQPLGQGVIAAMKRNYRAGLLHNNLEEGND----LKSFWKK-LTLLDALYEIAMAWNLVKPVTISRAWKQIL 389          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 65.4698 bits (158), Expect = 2.315e-10
Identity = 59/242 (24.38%), Postives = 102/242 (42.15%), Query Frame = 2
Query: 1898 GFIEFIANE-GYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHI---EVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            GF   +A E G   +QV++ +ETGL W+ +PN      ++ ++   K  K+RLT+L+C+NA G  ++KP+       PR F+        LP+ +K+     +  + +F               F    +     +  +  HS     E +L+ E  F   + LP + T L+QP  Q +   F +L++            +  +    F     NI   I  + +AW  V  +   +AW  L
Sbjct:  167 GFFRSLAAEHGLSPEQVYSADETGLVWRCLPNSA---PDDGTVPHFKQGKDRLTVLMCANATGSHRIKPLAIGKGGGPRAFRGIQ----HLPIAYKAQGNAWVD-KEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAHSQESELVSENVF--TIFLPSSVTSLLQPTEQGIRRAFMRLFI------------NPPVAFQGF-PTRHNINDAIVNVARAWNAVPSQVFQRAWRKL 385          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Cenpb (centromere protein B [Source:MGI Symbol;Acc:MGI:88376])

HSP 1 Score: 51.2174 bits (121), Expect = 5.174e-8
Identity = 30/81 (37.04%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 1516 ISRDFNLPKSTVSTILKNKNLIKVADVAKGVKVLTKQRPQI--IKEVEKLLLIWINQKQLCGDSISELIIREKANQI*KEL 1752
            I+R FN+P ST+STILKNK  I  ++   GV    ++  ++    ++E LL+ W  Q +  G  +  +I++EKA +I +EL
Sbjct:   31 IARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEEL 111          

HSP 2 Score: 26.9498 bits (58), Expect = 5.174e-8
Identity = 13/30 (43.33%), Postives = 20/30 (66.67%), Query Frame = 3
Query: 1755 LQISEVNDIDYGLFKAISGWLKKFRKRSGI 1844
            L+I+E   +D   F A +GWL +FR+R G+
Sbjct:  105 LRIAEELGMDD--FTASNGWLDRFRRRHGV 132          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q5T280|CI114_HUMAN (Putative methyltransferase C9orf114 OS=Homo sapiens OX=9606 GN=SPOUT1 PE=1 SV=3)

HSP 1 Score: 242.662 bits (618), Expect = 5.561e-71
Identity = 137/331 (41.39%), Postives = 193/331 (58.31%), Query Frame = 2
Query:  236 GRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQ---PIC-----EVVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK 1204
            GR YT+S+A+PGSILDNAQS E +  + GQIARA AI+ VDEIVV+DE+G+    +  + +    +G+              CV +A IL+Y++ P+YLRK+ FP+   L+ +  L PL  P H+R  +   +REGIV++ P        + V+ G+ + V+ID       R+TV+ NQ   P C     +VV+   PRTK G YWGY VR+A+CLS V            + P    YDL IGTSE+G++V   ++P F H L+VFG  QGLE     D  L + ++P  +F  Y+NTCP Q S+TIRTEEA+ ISL AL+  +   G +
Sbjct:   70 GRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQDAKTVEGEFTGVGKKGQA-------------CVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPG--HGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVF----------AEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNL-EVAEPSVLFDLYVNTCPGQGSRTIRTEEAILISLAALQPGLIQAGAR 374          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q3UHX9|CI114_MOUSE (Putative methyltransferase C9orf114 homolog OS=Mus musculus OX=10090 GN=Spout1 PE=1 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 4.083e-70
Identity = 139/332 (41.87%), Postives = 195/332 (58.73%), Query Frame = 2
Query:  233 EGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQ---PICE-----VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK 1204
            +GR YT+S+A+PGSILDNAQS E +  + GQIARA  I+ VDEIVV+DE+G+      D  S E        E     +    CV +A IL+Y++ P+YLRK+ FP+   L+ +  L PL  P H+R  +   +REG+V++ P        +LV+ G+ + V+ID   +   R+TV+ NQ   P C+     VV+   PRTK G YWGY VR+A+CLS V            + P    YDL IGTSE+G++V   ++P F H L+VFG  QGLE A+  D  L + + P  +F  Y+NTC +Q S+TIRTEEA+ ISL AL+  +   G +
Sbjct:   70 QGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACTIFCVDEIVVFDEEGQ------DTKSVE-------GEFRGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGILNPLDSPHHMRQDEESEFREGVVVDRPTKAG--HGSLVNCGMKKEVKIDKKLDPGLRVTVRLNQQQLPECKTYKGTVVSSQDPRTKAGLYWGYTVRLASCLSAVF----------AEAPFQDGYDLTIGTSERGSDVASAQLPSFRHALVVFGGLQGLEAAVDADPNL-EVADPSVLFDFYVNTCLSQGSRTIRTEEAILISLAALQPGLTQVGSR 375          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.699e-40
Identity = 102/251 (40.64%), Postives = 137/251 (54.58%), Query Frame = 2
Query: 1895 KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASY----ICTWCARIFTGK*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDIT-------LTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPLV 2614
            +   + I   GY  QQ+FN +ET  +WK+MP+RTFI +EEKS+ G K  K+RLTLLL +NA GDFKLKPML YHSENPR    KN  KS LPV++K ++K ++    LF      Y    + T+C+     K I   +      A SH    L++    I V+ +P NTT ++QPM Q VI  FK  Y++  F K      D+D++       L  FWK  F IL  I  I  +W  V   TL   W+ L+
Sbjct:  167 EALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRAL--KNYTKSTLPVLYKWNSKARMT-AHLFTAWFTEYFKPTVETYCSE----KKIPFKILLLIDNAPSHPRA-LMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKAL-AAMDSDVSDGSGQSKLKTFWK-GFTILDAIKNIRDSWEEVKLSTLTGVWKKLI 407          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q10950|YMP6_CAEEL (Putative methyltransferase B0361.6 OS=Caenorhabditis elegans OX=6239 GN=B0361.6 PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.474e-35
Identity = 102/320 (31.87%), Postives = 159/320 (49.69%), Query Frame = 2
Query:  245 YTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDH-FPYREGIVLENPQDKSCLKSNLVDIGLNELVEID-----IPQNVDSRITVKYNQPICE-----VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEM-----PKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCP-NQASKTIRTEEAV 1153
            +TISIAVPG  L+NAQS E +  M GQIARAA +Y VDEI++YDE      ++ D+  N    G     L+  E ++  C  +A IL+Y++ P+YLRK LFP    LKN+  L PL    HL+  +    +REG+VL+        +  + +IGL +  EID     +P      + +K     C+     + +  T   + G YWGY VR+   L  V+Q                ++D++ G S +G    + ++     PK   +LLVFG   G++ A+  ++ L +  + +  F   + T   +  S++ R EE V
Sbjct:   66 FTISIAVPGQFLNNAQSAELRTYMAGQIARAATLYRVDEIIIYDES----CRMTDEAVNAYYNGTWQGNLIPAETNYEGCFYLAKILEYLECPQYLRKDLFPIQKPLKNAGLLNPLDAQHHLKYDEKTLRFREGVVLKKRSKDG--RGPICNIGLEKEFEIDSDAVQLPPYTRVTVEIKNLTEQCKLYRGSITSGATVTRETGLYWGYSVRLMTGLQKVLQAK--------------KFDIVAGVSPRGKLASQMDVCILNKPK---ILLVFGGVAGVDAAVESEE-LAEWRRAEDAFDVLIRTTSLSNGSRSERVEENV 361          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q4W5G0|TIGD2_HUMAN (Tigger transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=TIGD2 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.307e-23
Identity = 78/245 (31.84%), Postives = 117/245 (47.76%), Query Frame = 2
Query: 1883 KYF*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVY--AHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            + F   F EF+  E    +Q++  ++TGLFWK +P+RT   + ++S SG +  +ER+ ++ C+NA G  KL   +   ++ PR FK  +L  S LPV + S     +  QS+F      Y      +    K +         +  A  + E+   D+   I V  LPPN T LIQPM Q V+   K+ Y   L  K  +  ND  I    FWK    +L  I  + +AW  V   T+ KAW+ L
Sbjct:  153 REFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIE-QSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRII-VKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEGNDPKI----FWKN-LTVLDAIYEVSRAWNMVKSSTITKAWKKL 388          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2D4Q5L4 (HTH CENPB-type domain-containing protein OS=Micrurus surinamensis OX=129470 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 4.166e-99
Identity = 131/257 (50.97%), Postives = 172/257 (66.93%), Query Frame = 2
Query: 1889 F*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVY-------------AHSH---IEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            F K F +++  EG++ +QVFNC+ETGLFWK++P  T+IT+EEKS+ GHKPMK+RLTLL C+NA GD K+KP+L YHS+NPR FK+ N++KSKL V+W+S+TK           +   +   W   +F  +     V  Y                A +H   +E DL+D+ +FIKV  LPPNTTP++QPM Q+VI NFKKLY K LF KCFE+TNDT +TL +FWKE FNIL+C+N ID AW  VT RTL  AW+ L
Sbjct:  171 FIKEFSDYVKAEGFLPEQVFNCDETGLFWKKIPANTYITKEEKSLPGHKPMKDRLTLLFCANASGDCKVKPLLVYHSDNPRPFKRHNVMKSKLAVMWRSNTK---------AWVTRQFFTEWVREVFAPR-----VKEYLAEQNLPLKCLLLMDNAPAHPPALEEDLVDDCSFIKVKFLPPNTTPILQPMDQQVISNFKKLYTKALFRKCFEVTNDTQLTLREFWKEHFNILNCVNLIDTAWCKVTHRTLYSAWQKL 413          

HSP 2 Score: 105.916 bits (263), Expect = 4.166e-99
Identity = 53/100 (53.00%), Postives = 79/100 (79.00%), Query Frame = 1
Query: 1474 DILKKHEMGICTTNISRDFNLPKSTVSTILKNKNLIKVADVAKGVKVLTKQRPQIIKEVEKLLLIWINQKQLCGDSISELIIREKANQI*KELFYRSPKS 1773
            +I+ K+E G   +++S ++ +P+ST+ST LKNK +IK A+VAKGV +LTKQRPQI++E+EKLLLI+I +K+L GDSI+E++I EKA QI  +L   +P +
Sbjct:   28 EIIAKYEQGTRVSDLSAEYGMPRSTISTFLKNKVVIKAANVAKGVTLLTKQRPQIMEEMEKLLLIFIKEKELAGDSINEVVICEKALQIFSDLNKETPGT 127          

HSP 3 Score: 43.8986 bits (102), Expect = 4.166e-99
Identity = 17/28 (60.71%), Postives = 20/28 (71.43%), Query Frame = 3
Query: 1794 FKAISGWLKKFRKRSGIHIVVRHGETSS 1877
            FKA  GW + FR RSGIH + RHGE +S
Sbjct:  135 FKASRGWFENFRHRSGIHRITRHGEAAS 162          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A3Q2XZ82 (HTH CENPB-type domain-containing protein OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 8.494e-98
Identity = 130/249 (52.21%), Postives = 170/249 (68.27%), Query Frame = 2
Query: 1874 KPRKYF*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSH---IEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            K  + + + F++ +  EGYV  QVFN +ET LFWK+MPNRTFITQEEKS+ GHKPMK+RLTLL+C+NA GD K+KPML YHSENPR FKK  ++KSKLPV+WKS+TK  +  + LF   +         +    K +          A  H   +E +L  +L FIKV  LPPNTTPL+QPM Q+VI +FKKLY K LF++CF +TNDT+++L  +WK+ FN+ HC+  I+KAW  VT RTL  AW+ L
Sbjct:  171 KAAEAYKESFLKMVEEEGYVPHQVFNADETRLFWKKMPNRTFITQEEKSVPGHKPMKDRLTLLMCANASGDCKIKPMLVYHSENPRAFKKNQVVKSKLPVMWKSNTKAWVT-RLLFMDWMHDVFAPSVRKHLEEKGLPVKCLLLLDNAPVHPPSLEEELQGDLEFIKVKFLPPNTTPLLQPMDQQVIASFKKLYTKALFTRCFHVTNDTNLSLRDYWKDHFNVYHCVQLIEKAWHDVTFRTLKAAWKKL 418          

HSP 2 Score: 103.99 bits (258), Expect = 8.494e-98
Identity = 57/110 (51.82%), Postives = 77/110 (70.00%), Query Frame = 1
Query: 1474 DILKKHEMGICTTNISRDFNLPKSTVSTILKNKNLIKVADVAKGVK---VLTKQRPQIIKEVEKLLLIWINQKQLCGDSISELIIREKANQI*KELFYRSPKSMTLIMDF 1794
            +I++KHE G+   +++  +   KST++TILKNK  IK A VAKGV    VL++QR Q I+EVEKLLLIW+N+KQL  DS+SE II EKA Q+  ++  R P S + I DF
Sbjct:   31 EIVEKHERGVRLCDLASQYQYAKSTIATILKNKEAIKGACVAKGVSGVSVLSQQRSQAIEEVEKLLLIWMNEKQLAVDSVSEGIIAEKARQLHSDIIKRQPGSSSSIDDF 140          

HSP 3 Score: 46.9802 bits (110), Expect = 8.494e-98
Identity = 17/31 (54.84%), Postives = 25/31 (80.65%), Query Frame = 3
Query: 1794 FKAISGWLKKFRKRSGIHIVVRHGETSSRGN 1886
            FKA  GW +KF++R+GIH V+RHGE++S  +
Sbjct:  140 FKASHGWFEKFKRRTGIHSVIRHGESASSDD 170          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2H6NCJ9 (HTH CENPB-type domain-containing protein (Fragment) OS=Micrurus lemniscatus carvalhoi OX=129465 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 3.445e-96
Identity = 134/257 (52.14%), Postives = 173/257 (67.32%), Query Frame = 2
Query: 1889 F*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVY-------------AHSH---IEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            F K F +++  EG+V +QVFNC+ETGLFWK+MP  T+IT+EEKS+ GHKPMK+RLTLL C+NA GD K+KP+L YHS+NPR FK+ N++KSKL V+W+S+TK  +  Q         +   W   +F  +     V  Y                A +H   +E DL+D+ +FIKV  LPPNTTP++QPM Q+VI NFKKLY K LF KCFE+TNDT +TL +FWKE FNIL+C+N ID AW  VT RTL  AW+ L
Sbjct:  127 FIKEFSDYVKAEGFVPEQVFNCDETGLFWKKMPANTYITKEEKSLPGHKPMKDRLTLLFCANASGDCKVKPLLVYHSDNPRPFKRHNVMKSKLAVMWRSNTKAWVTRQ---------FFTEWVREVFAPR-----VKEYLAEQNLPLKCLLLMDNAPAHPPALEEDLVDDCSFIKVKFLPPNTTPILQPMDQQVISNFKKLYTKALFRKCFEVTNDTQLTLREFWKEHFNILNCVNLIDTAWCKVTHRTLYSAWQKL 369          

HSP 2 Score: 95.9005 bits (237), Expect = 3.445e-96
Identity = 48/83 (57.83%), Postives = 68/83 (81.93%), Query Frame = 1
Query: 1525 DFNLPKSTVSTILKNKNLIKVADVAKGVKVLTKQRPQIIKEVEKLLLIWINQKQLCGDSISELIIREKANQI*KELFYRSPKS 1773
            ++ +P+ST+ST LKNK +IK A+VAKGV +LTKQRPQI++E+EKLLLI+I +K+L GDSI+E++I EKA QI  +L   +P +
Sbjct:    1 EYGMPRSTISTFLKNKVVIKAANVAKGVTLLTKQRPQIMEEMEKLLLIFIKEKELAGDSINEVVICEKALQIFSDLNKETPGT 83          

HSP 3 Score: 43.8986 bits (102), Expect = 3.445e-96
Identity = 17/28 (60.71%), Postives = 20/28 (71.43%), Query Frame = 3
Query: 1794 FKAISGWLKKFRKRSGIHIVVRHGETSS 1877
            FKA  GW + FR RSGIH + RHGE +S
Sbjct:   91 FKASRGWFENFRHRSGIHRITRHGEAAS 118          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A0P4W6U8 (HTH CENPB-type domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 9.987e-94
Identity = 132/253 (52.17%), Postives = 169/253 (66.80%), Query Frame = 2
Query: 1901 FIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVY-------------AHSH---IEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            F E I  E YV +QVFNC+ETGLFWK++P  T+IT+EE  M GHKPMK+RLTLLLC+NA GD K+KP+L YHS+NPRVFK+ N+IK+KLPV+W+++TK           +   +   W   +F  +     V +Y +              A +H   +E DL DE +FIKV  LPPNTTPL+QPM Q+VI NFKKLY K LF KCF++T DT +TL +FWK+ FNIL+C+N ID+AW  VT RTL  AW  L
Sbjct:  172 FSETIKAEEYVPEQVFNCDETGLFWKKLPANTYITKEETKMPGHKPMKDRLTLLLCANASGDCKIKPLLVYHSDNPRVFKRNNIIKTKLPVMWRANTK---------SWVTRQFFAEWIHEVFAPQ-----VKAYLIEKKLQLKCLLVMDNAPAHPPGLEDDLTDEYSFIKVKFLPPNTTPLLQPMDQQVIANFKKLYTKALFRKCFDVTCDTQLTLREFWKDHFNILNCVNIIDQAWGNVTYRTLKSAWRKL 410          

HSP 2 Score: 93.9745 bits (232), Expect = 9.987e-94
Identity = 48/93 (51.61%), Postives = 72/93 (77.42%), Query Frame = 1
Query: 1474 DILKKHEMGICTTNISRDFNLPKSTVSTILKNKNLIKVADVAKGVKVLTKQRPQIIKEVEKLLLIWINQKQLCGDSISELIIREKANQI*KEL 1752
            +I+ K+E G+  ++++  + + KST+STILK+K ++K ADVA GV  ++KQRPQI++E+EKLLLI+  +K L GDSISE +I EKA QI ++L
Sbjct:   26 EIIAKYESGVRVSDLASQYEMAKSTISTILKHKEVLKKADVAMGVTAISKQRPQIMEEMEKLLLIFTKEKMLSGDSISEALICEKALQIYEDL 118          

HSP 3 Score: 41.9726 bits (97), Expect = 9.987e-94
Identity = 18/28 (64.29%), Postives = 21/28 (75.00%), Query Frame = 3
Query: 1794 FKAISGWLKKFRKRSGIHIVVRHGETSS 1877
            FKA  GW +KFR R+GIH V RHGE +S
Sbjct:  132 FKASKGWFEKFRHRTGIHRVTRHGEAAS 159          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2H6N9B1 (HTH CENPB-type domain-containing protein (Fragment) OS=Micrurus lemniscatus carvalhoi OX=129465 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 4.645e-92
Identity = 134/257 (52.14%), Postives = 173/257 (67.32%), Query Frame = 2
Query: 1889 F*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVY-------------AHSH---IEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            F K F +++  EG+V +QVFNC+ETGLFWK+MP  T+IT+EEKS+ GHKPMK+RLTLL C+NA GD K+KP+L YHS+NPR FK+ N++KSKL V+W+S+TK  +  Q         +   W   +F  +     V  Y                A +H   +E DL+D+ +FIKV  LPPNTTP++QPM Q+VI NFKKLY K LF KCFE+TNDT +TL +FWKE FNIL+C+N ID AW  VT RTL  AW+ L
Sbjct:  122 FIKEFSDYVKAEGFVPEQVFNCDETGLFWKKMPANTYITKEEKSLPGHKPMKDRLTLLFCANASGDCKVKPLLVYHSDNPRPFKRHNVMKSKLAVMWRSNTKAWVTRQ---------FFTEWVREVFAPR-----VKEYLAEQNLPLKCLLLMDNAPAHPPALEEDLVDDCSFIKVKFLPPNTTPILQPMDQQVISNFKKLYTKALFRKCFEVTNDTQLTLREFWKEHFNILNCVNLIDTAWCKVTHRTLYSAWQKL 364          

HSP 2 Score: 95.9005 bits (237), Expect = 4.645e-92
Identity = 48/83 (57.83%), Postives = 68/83 (81.93%), Query Frame = 1
Query: 1525 DFNLPKSTVSTILKNKNLIKVADVAKGVKVLTKQRPQIIKEVEKLLLIWINQKQLCGDSISELIIREKANQI*KELFYRSPKS 1773
            ++ +P+ST+ST LKNK +IK A+VAKGV +LTKQRPQI++E+EKLLLI+I +K+L GDSI+E++I EKA QI  +L   +P +
Sbjct:    1 EYGMPRSTISTFLKNKVVIKAANVAKGVTLLTKQRPQIMEEMEKLLLIFIKEKELAGDSINEVVICEKALQIFSDLNKETPGT 83          

HSP 3 Score: 30.0314 bits (66), Expect = 4.645e-92
Identity = 13/28 (46.43%), Postives = 16/28 (57.14%), Query Frame = 3
Query: 1794 FKAISGWLKKFRKRSGIHIVVRHGETSS 1877
            FKA  GW + FR     H + RHGE +S
Sbjct:   91 FKASRGWFENFR-----HRITRHGEAAS 113          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Match: spout1 (SPOUT domain containing methyltransferase 1 [Source:NCBI gene;Acc:103026649])

HSP 1 Score: 249.98 bits (637), Expect = 1.367e-74
Identity = 157/399 (39.35%), Postives = 219/399 (54.89%), Query Frame = 2
Query:   47 VKNDKNVIPVPEIKLSKKKLKARDSEQRRQRKEERALKFLQNTNTDIKPFYKKGFNNICGV-AEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKY--NQPICE------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKI----CNKGKK 1204
             K  K      E K++ KKLKA + EQ+++ KE + +  L+  N   +   K+           GR YT+SIA+PGS+LDNAQS E +  + GQIARA  ++ VDE+V++DE G+             D G    E     +    CV +A IL+Y++ P+YLRK  FP+   L+ +  L PL  P H+R  D   +REG+V++ P   +    + V+ G+ + V+ID       R+TV+   NQ          VV    PRT+ G YWGY VR+A+CLS VM   C F D          YDL IGTSEKG+N D   +P+F H+L+VFG  QGLE ++  D  L + + P  +F  YLNTCP Q S+TIRTEEA+ ISL  LR KI    C++ K+
Sbjct:    7 AKKQKLFSAAAEEKVNWKKLKAENKEQKKKWKEAKLISQLEKANKAKEEEEKEQQQLKEEQKTNGRLYTVSIALPGSVLDNAQSPELRTYLAGQIARACTVFCVDEVVIFDEQGE-------------DTGTVEGEFKGVGKKGKACVQLARILQYLECPQYLRKVFFPKHPDLQFAGLLNPLDSPHHMRIDDEAEFREGVVVDRPSKAAA--GSFVNCGMRKEVKIDKQLQPGLRVTVRMIKNQNTESKVYKGVVVAPHVPRTEAGQYWGYSVRLASCLSAVMTE-CPFKDG---------YDLTIGTSEKGSNADLTPLPQFRHMLVVFGGLQGLEASVEADSNL-EVTDPSVLFDQYLNTCPGQGSRTIRTEEAILISLSLLRQKIATGFCDQAKQ 379          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Match: spout1 (SPOUT domain containing methyltransferase 1 [Source:NCBI gene;Acc:103026649])

HSP 1 Score: 233.032 bits (593), Expect = 2.178e-68
Identity = 146/375 (38.93%), Postives = 204/375 (54.40%), Query Frame = 2
Query:   47 VKNDKNVIPVPEIKLSKKKLKARDSEQRRQRKEERALKFLQNTNTDIKPFYKKGFNNICGV-AEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKY--NQPICE------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTE 1144
             K  K      E K++ KKLKA + EQ+++ KE + +  L+  N   +   K+           GR YT+SIA+PGS+LDNAQS E +  + GQIARA  ++ VDE+V++DE G+             D G    E     +    CV +A IL+Y++ P+YLRK  FP+   L+ +  L PL  P H+R  D   +REG+V++ P   +    + V+ G+ + V+ID       R+TV+   NQ          VV    PRT+ G YWGY VR+A+CLS VM   C F D          YDL IGTSEKG+N D   +P+F H+L+VFG  QGLE ++  D  L + + P  +F  YLNTCP Q S+TIRTE
Sbjct:    7 AKKQKLFSAAAEEKVNWKKLKAENKEQKKKWKEAKLISQLEKANKAKEEEEKEQQQLKEEQKTNGRLYTVSIALPGSVLDNAQSPELRTYLAGQIARACTVFCVDEVVIFDEQGE-------------DTGTVEGEFKGVGKKGKACVQLARILQYLECPQYLRKVFFPKHPDLQFAGLLNPLDSPHHMRIDDEAEFREGVVVDRPSKAAA--GSFVNCGMRKEVKIDKQLQPGLRVTVRMIKNQNTESKVYKGVVVAPHVPRTEAGQYWGYSVRLASCLSAVMTE-CPFKDG---------YDLTIGTSEKGSNADLTPLPQFRHMLVVFGGLQGLEASVEADSNL-EVTDPSVLFDQYLNTCPGQGSRTIRTE 355          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 3.414e-31
Identity = 81/236 (34.32%), Postives = 122/236 (51.69%), Query Frame = 2
Query: 1907 EFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDI-TLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            E I   GY  +QVFN NETGLFWKRMP  TF+++EEK+  G K  K+RL LL+ +NA GD KLKP+L YHS+ PR    K  IK+ LPVIW+S+ K  +   S+F   + ++ C    +    K + +                       + ++N  P   P +  + + V     +  M+++ +       D D+ T+ +FW+  +NI+  I+ I++AW  V   TLN  W  L
Sbjct:  172 EIIEGGGYSPEQVFNVNETGLFWKRMPASTFLSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRAL--KGCIKADLPVIWRSNKKGWIT-ASVFLDWLKNHFCPAIEKYCKKKNLDH---------------------KALLLLNNAPGHPPTLSELSEHV-----RGTMEQIVA-----NTDKDVQTIREFWR-SYNIMDAIDNINEAWNEVAQTTLNACWGKL 372          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001313.1 (pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gene:ENSPMAG00000001181.1 transcript:ENSPMAT00000001313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 1.737e-24
Identity = 75/235 (31.91%), Postives = 112/235 (47.66%), Query Frame = 2
Query: 1907 EFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            E I   GY  +QVFN NET LFWKRMP  TF+++E+K+  G K  K+RL LL+ +N  GD +LKP+L YHS+ PR    K  IK+ LP IW+S+ K  +   S+F   + ++ C    +    K                  +DL   L        PP  + L +  + +++ N                  D D+ + + +   +NI+  I+ I++AW  V   TLN  W  L
Sbjct:  170 EIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYL--KGCIKADLP-IWRSNKKGWIT-ASVFLDWLKNHFCPAIEKYCKKK-----------------NLDLKALLLRNNAPGHPPTPSELSE--HVKIVAN-----------------TDKDVQIIREFWHSYNIMDAIDNINEAWNEVAQTTLNAYWGKL 364          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010132.1 (pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 gene:ENSPMAG00000009170.1 transcript:ENSPMAT00000010132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 1.898e-24
Identity = 75/235 (31.91%), Postives = 112/235 (47.66%), Query Frame = 2
Query: 1907 EFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            E I   GY  +QVFN NET LFWKRMP  TF+++E+K+  G K  K+RL LL+ +N  GD +LKP+L YHS+ PR    K  IK+ LP IW+S+ K  +   S+F   + ++ C    +    K                  +DL   L        PP  + L +  + +++ N                  D D+ + + +   +NI+  I+ I++AW  V   TLN  W  L
Sbjct:  169 EIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYL--KGCIKADLP-IWRSNKKGWIT-ASVFLDWLKNHFCPAIEKYCKKK-----------------NLDLKALLLRNNAPGHPPTPSELSE--HVKIVAN-----------------TDKDVQIIREFWHSYNIMDAIDNINEAWNEVAQTTLNAYWGKL 363          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003283.1 (pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gene:ENSPMAG00000003000.1 transcript:ENSPMAT00000003283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 2.854e-19
Identity = 65/196 (33.16%), Postives = 103/196 (52.55%), Query Frame = 2
Query: 2027 GHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLV----ASYICTWCARI---FTGK*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLN 2593
            G +  K+RLT++L +NA G ++LKP++ +HS NPR  K    +++ L V ++SS +  +  Q +F   V       +  +C R    F    + +   S+  Y      VDL ++   IKV+ LPP+TT L+QPM Q VI  FK  Y++  F+   E T+  +   +  W+  FNI   I+ I +AW  +T   LN
Sbjct:  182 GLRAAKDRLTVMLGANASGGYRLKPVVVHHSANPRTLK--GFVRADLGVHFRSSKRGWMTDQ-MFTDYVLETLQDELRRYCKRKNQDFKILLVVDNAPSHPPYI-----VDLSEQ---IKVVFLPPHTTSLLQPMGQGVIAAFKAYYLRRTFAMLIEATDGENSQASVTWR-SFNIKQAIDIIVEAWTDITQPCLN 365          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004972.1 (pep scaffold:Pmarinus_7.0:GL476545:74372:75575:-1 gene:ENSPMAG00000004517.1 transcript:ENSPMAT00000004972.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.793e-15
Identity = 71/244 (29.10%), Postives = 109/244 (44.67%), Query Frame = 2
Query: 1907 EFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK--------*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFEITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPLV 2614
            + I  E Y+ +Q+FN +ETG              + K+M+G K  K+RLTLLL  N    +KLKP + YHS N R   +  + K+ LPV ++ + K           + A     W    F  +         I   +      A  H++    ++ N   V+ LPPNTT +IQPM Q  +   + L  ++  ++  E        L   WKE  N+L+ I  I +AW  VT   +N  W+ L+
Sbjct:  153 KIIVEENYLPEQIFNVDETG-------------TDAKTMAGFKAFKDRLTLLLGGNV-AVYKLKPFMIYHSTNARALAR--ISKNMLPVHYRHNKKA---------WMTAVLFEDWFVNCFIPEVKEHCRKNGIPFKIMLILDNAPGHLQYIGDNDPNV--VVFLPPNTTSIIQPMDQGAVATSQGLLSEKHATEEKE--------LRMIWKES-NVLNAIRNIGRAWKEVTKECMNGIWKNLL 360          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Match: YGR283C_mRNA (Putative methyltransferase; may interact with ribosomes, based on co-purification experiments; predicted to be involved in ribosome biogenesis; null mutant is resistant to fluconazole; GFP-fusion protein localizes to the nucleolus; YGR283C has a paralog, YMR310C, that arose from the whole genome duplication [Source:SGD;Acc:S000003515])

HSP 1 Score: 68.5514 bits (166), Expect = 9.729e-13
Identity = 67/237 (28.27%), Postives = 109/237 (45.99%), Query Frame = 2
Query:  254 SIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCT--CLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKS-----NLVDIGLNELVEIDIPQNVDSRITVKYNQPICEVVNRDTPRTKIGAY----WGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYD 931
            SI +P +++DN  ++E       QIAR A +++V EI+V D+                 + +  E+   ++E  + C+L+A +L+Y  TP  L  + F +     LK ++  PPL     + +     Y+EG+ +   +D S  KS     NLV IG N+++ +   QN+ +   V  +    EVV      + I AY     GY VRMA+ L+ V   S G+         D  YD
Sbjct:   41 SICIPTTVIDNCNNLEQVTFTAYQIARTAVLFNVQEIIVLDQ----------------SKDKKHEKKSRSKETISDCLLLATLLQYFVTPPNLLDTTFKKKNKLYLKCASTFPPLNQLPFMNASAEQHYKEGLSI--ARDSSKGKSDDALTNLVYIGKNQIITLS-NQNIPNTARVTVDTERKEVV------SPIDAYKGKPLGYHVRMASTLNEV---SEGYTKIVWVNSGDFHYD 249          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Match: YMR310C_mRNA (Putative methyltransferase; predicted to be involved in ribosome biogenesis; green fluorescent protein (GFP)-fusion protein localizes to the nucleus; not an essential gene; YMR310C has a paralog, YGR283C, that arose from the whole genome duplication [Source:SGD;Acc:S000004927])

HSP 1 Score: 46.595 bits (109), Expect = 9.493e-6
Identity = 69/346 (19.94%), Postives = 151/346 (43.64%), Query Frame = 2
Query:  227 VAEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQC--TCLKNSNHLPPL-VIP-SHLRSGDHFPYREGIV--LENPQ------DKSCLKSNLVDIGLNELVEID---IPQNVDSRITVKYNQPICEVVNRD--TPRTKIGAY------WGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKY-EMPKF---LHLLLVFGDRQGLEHAISVDKALPKDSQ-PKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRS 1180
            +++ R Y  S+ +P +++ + +++      + Q+A+ A++++V E+V+ +++ ++     D    +I   + I  L                L+Y  TP YLR ++F +     L  ++ LP L  +P +  +  DH  YREG+   ++ P        K   ++  ++IG ++ + +    +P  +++R+T+       + + R   +P+   G +      +GY  R+A+  + +  +        G         + +  + + T++ +   +P      H+LLVF     L  A  +D+    D Q P+  F   L  CP   S      +A+ ++L  L +
Sbjct:   14 LSQTRHY--SLCIPTTLVSDCRNLSQITHKVYQVAKFASLFNVSEVVILEDNSQV-----DATKKKISTAKLILAL----------------LQYFVTPPYLRNTVFNEKFRPYLTAASKLPRLSTLPFTRYQKQDHGRYREGLTIKMQKPTLARKKIGKVFKQTKYINIGKSKALALQSQLVP--INARVTI-------DTITRKIVSPQEAYGDFTGLDSQYGYYTRIASSFTDLFMK--------GPLKEGYTQSVYVPLTTRDTSIPELSSLPTAETNPHILLVFSTWDTLARAFKLDQDQFVDCQGPQEFFDAQLP-CPVSNSD---VADAIPMTLTTLST 315          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO35825 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKF0])

HSP 1 Score: 224.172 bits (570), Expect = 1.903e-66
Identity = 134/326 (41.10%), Postives = 189/326 (57.98%), Query Frame = 2
Query:  236 GRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKY-------NQPIC--EVVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKI 1186
            GR +T+S+A+PGSILDNAQS E +  + GQIARA  +++VDE++V++E  K   K  D  SN             ++ D N  + +A IL+Y++ P+YLRK+ FP+   L+ +  L PL  P H+R  D  PYREG+VL+ P  +S    +LV+ G+ + V+ID       R+TVK        N+ I    VV+   PR   G YWGY VR+A   S V   S          P    YD++IGTSE+G  VD  E+  F H+L+VFG  +GLE ++  D++L   S P  +F  Y+NTCP Q S+TIRTEEA+ IS+ AL+  I
Sbjct:    1 GRDFTVSLALPGSILDNAQSAELRTYLAGQIARAVVVFNVDEVIVFNESRKSLDKSKDGVSN-----------FHSKADAN--LQLARILQYLECPQYLRKAFFPRHKDLQYAGLLNPLDCPHHMRIDDDMPYREGVVLDRPVGQS--GGSLVNAGMRKEVKIDKCIKPGIRVTVKLKPTSKSGNKQIFFGNVVSPSAPRVDAGLYWGYSVRLAPSFSDVFTES----------PYPQGYDVMIGTSERGAPVDCLELQPFSHMLIVFGGLKGLEASLESDESL-DVSDPSELFHHYVNTCPGQGSRTIRTEEAILISMAALKPVI 300          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 60.077 bits (144), Expect = 1.301e-11
Identity = 31/93 (33.33%), Postives = 54/93 (58.06%), Query Frame = 2
Query: 1916 ANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTK 2194
              +GY S  ++N  ETGL+++ +P++  + + E + +      ERLT+ LC N  G+F+ KP++   + NP  F K  L    LPVIW+++ +
Sbjct:  154 VTDGYRSTDIYNLVETGLYYRALPDKNLVPETESTST------ERLTVTLCCNMDGEFE-KPLVIGPTANPPCFAK--LDSECLPVIWRANRR 237          

HSP 2 Score: 28.4906 bits (62), Expect = 1.301e-11
Identity = 11/23 (47.83%), Postives = 17/23 (73.91%), Query Frame = 3
Query: 1776 DIDYGLFKAISGWLKKFRKRSGI 1844
            ++D   F+A +GWL+ FR+R GI
Sbjct:  106 ELDMKDFRASNGWLEGFRRRHGI 128          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: spout1 (SPOUT domain containing methyltransferase 1 [Source:NCBI gene;Acc:101164418])

HSP 1 Score: 231.491 bits (589), Expect = 2.518e-68
Identity = 135/334 (40.42%), Postives = 186/334 (55.69%), Query Frame = 2
Query:  233 EGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDF-------NPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREGIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICE--------VVNRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLIIGTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIFKGYLNTCPNQASKTIRTEEAVSISLGALRSKIC 1189
            +GR YT+S+A+PGS+LDNAQS E +  + GQIARA A++ VDEI+V+DE G                    E++ S E DF         C+ +A IL+Y++ P+YLRK  FP    L+ +  L PL  P H+R  +   YREG+VL  P  +   K +LV+ G+ + V ID       R+TVK N+   +        VV    PRT+   YWGY VR+A+CLS V            + P    YDL +GTSEKG  +++  +  F HLL+VFG   GLE ++  D+ L   + P  +F  YLNTCP Q S+TIRTEEA+ IS+ AL+ KI 
Sbjct:   42 KGRAYTVSVALPGSVLDNAQSPELRTYLAGQIARACAVFCVDEIIVFDEQG--------------------EDVKSVEGDFKGVGKKGQACIQLARILQYVECPQYLRKCFFPVHKDLQYAGLLNPLDSPHHMRMDEESDYREGVVLNRPPKQG--KGSLVNCGMRKEVRIDKQLQSGLRVTVKLNKMQNQDSKLYKGVVVPPHVPRTEAALYWGYTVRLASCLSAVFT----------EGPHKGGYDLTVGTSEKGNTLEQTTLSPFKHLLVVFGGLHGLEASVDADQNL-NVTDPSLLFDLYLNTCPGQGSRTIRTEEAILISMAALQPKIA 342          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 4.632e-35
Identity = 97/258 (37.60%), Postives = 131/258 (50.78%), Query Frame = 2
Query: 1862 WRNFKPRKYF*KGFIEFIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTK------LKLG-*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHIEVDLIDELNFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFE-ITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            + NFK + +    F   I   GY  +Q+FN +ETGLFWKRMP+RTFI QEE    G K  K+RLTL+ C NA G F +KP L Y S+NPR  K KN  K  L V W  + K      L L   ++ F   V  Y+         GK +   V      A  H + DL    + +++  LPPNTT LIQPM Q +I  FK LY +       + + +D D +L  +W+  + I  C+  I +A   +   TLN  W+ L
Sbjct:   84 FENFKKQAFVNNKFKAIIEEGGYKPEQIFNIDETGLFWKRMPSRTFIMQEEAKAPGFKAQKDRLTLVKCGNAAG-FMIKPGLIYRSKNPRALKNKN--KDDLHVCWMYNAKAWMTKALNLDWFKNCFIPQVKCYL--------RGKGLDFKVLLLVDNAGGHAD-DL--AYDCVQIKFLPPNTTSLIQPMDQGIIRAFKALYTRNTLQHLVDAMDSDQDSSLKDYWRG-YTIASCLQNIQRAIQEMKTETLNACWKKL 326          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.025e-25
Identity = 79/245 (32.24%), Postives = 117/245 (47.76%), Query Frame = 2
Query: 1913 IANEG-YVSQQVFNCNETGLFWKRMPNRTFITQEEKSMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNLIKSKLPVIWKSSTKLKLG*QSLFYGLVASYICTWCARIFTGK*ITN*VSSYYVYAHSHIEVDLI--------DEL--NFIKVMNLPPNTTPLIQPMYQEVIVNFKKLYMKELFSKCFE-ITNDTDITLTKFWKECFNILHCINFIDKAWIGVTCRTLNKAWEPL 2611
            I  EG Y  +QVFN  ETGLFWK++P+       +   SG +  K+R+TL++C NA G F +KP L    +NPR  K KN+  S LPV W  +T            +  +    W    F  +     V  Y        +V L+        D+L  + +++  LPPNT+ LIQPM Q +I  FK LY +       + + +D + +   +W+E + I  C+  I +A   +   TLN  WE L
Sbjct:  146 IIKEGTYKPEQVFNMGETGLFWKQIPS-------QAKASGFRGQKDRVTLVMCGNAAG-FMIKPGLISRLKNPRALKNKNM--SALPVYWMHNT---------MAWMTKALNLNWFKGCFIPE-----VKGYLTEKGLDFKVLLLIDNAGGFADDLSHDGVQIEFLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHLVDAMDSDQNFSFKDYWRE-YTIASCLQHIQRAHQEMKSETLNGCWEKL 365          

HSP 2 Score: 27.7202 bits (60), Expect = 1.025e-25
Identity = 12/27 (44.44%), Postives = 15/27 (55.56%), Query Frame = 3
Query: 1794 FKAISGWLKKFRKRSGIHIVVRHGETS 1874
            F A  GW  KF+KR G+  V   GE +
Sbjct:  102 FYASKGWFDKFQKRFGLKSVSLQGEAT 128          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000034610.1 (pep primary_assembly:ASM223467v1:22:20217020:20217298:1 gene:ENSORLG00000027855.1 transcript:ENSORLT00000034610.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 4.613e-7
Identity = 31/56 (55.36%), Postives = 34/56 (60.71%), Query Frame = -1
Query: 1939 SIGFNLKSPRALLHSKRVSLSFIGLCPDIDFSSCVIKVLLGIRFQKSPVSLQLKTC 2106
            S GF +K P   LH  RV+LSF  L P    SSC+IKV  GI FQ  PVS  LKTC
Sbjct:    2 SPGFIIK-PAGFLHIVRVTLSFWALNPGAFASSCMIKVREGILFQDKPVSSMLKTC 56          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000044882.1 (SMESG000044882.1)

HSP 1 Score: 205.297 bits (521), Expect = 4.646e-62
Identity = 99/110 (90.00%), Postives = 101/110 (91.82%), Query Frame = 2
Query:  314 MIGQIARAAAIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREG 643
            MI QIARAAAIYSVDEIVVYDEDGKLPTKINDDG       RCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKN+NHLPPLVIPSHLRSGDHFPY +G
Sbjct:    1 MIAQIARAAAIYSVDEIVVYDEDGKLPTKINDDG-------RCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNANHLPPLVIPSHLRSGDHFPYGKG 103          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000044882.1 (SMESG000044882.1)

HSP 1 Score: 160.229 bits (404), Expect = 4.063e-46
Identity = 79/99 (79.80%), Postives = 81/99 (81.82%), Query Frame = 2
Query:  347 YSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYREG 643
            YSVDEIVVYDEDG                 RCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKN+NHLPPLVIPSHLRSGDHFPY +G
Sbjct:   12 YSVDEIVVYDEDG-----------------RCIEELLSTEEDFNPCVLMAFILKYMDTPEYLRKSLFPQCTCLKNANHLPPLVIPSHLRSGDHFPYGKG 93          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000047535.1 (SMESG000047535.1)

HSP 1 Score: 116.316 bits (290), Expect = 3.759e-26
Identity = 56/68 (82.35%), Postives = 61/68 (89.71%), Query Frame = 1
Query: 1498 GICTTNISRDFNLPKSTVSTILKNKNLIKVADVAKGVKVLTKQRPQIIKEVEKLLLIWINQKQLCGDS 1701
             +C  +  RDFNLPKS VSTILKNK+LIKVADVAKGV VLTKQRPQII+EVEKLLLIWINQKQLCGD+
Sbjct:  573 ALCEKDPHRDFNLPKSMVSTILKNKDLIKVADVAKGVNVLTKQRPQIIEEVEKLLLIWINQKQLCGDT 640          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000027161.1 (SMESG000027161.1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.329e-18
Identity = 35/82 (42.68%), Postives = 50/82 (60.98%), Query Frame = 2
Query: 1910 FIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEK-SMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNL 2152
            F+    Y + QV+NC+ET L +K +PNRTF T+ +     G K  K+RLTLL C N  G  KL+P++   S+ PR F + N+
Sbjct:  356 FLEEGCYTADQVYNCDETDLCYKILPNRTFTTKTDNHKREGFKKRKDRLTLLFCVNKSGSHKLRPLMIGKSKAPRCFYRVNM 437          

HSP 2 Score: 31.187 bits (69), Expect = 2.329e-18
Identity = 14/28 (50.00%), Postives = 18/28 (64.29%), Query Frame = 3
Query: 1794 FKAISGWLKKFRKRSGIHIVVRHGETSS 1877
            FKA +GWL +F+KR  I  V+  GE  S
Sbjct:  313 FKASNGWLDRFKKRHAISQVLVLGEIRS 340          

HSP 3 Score: 29.6462 bits (65), Expect = 2.329e-18
Identity = 12/33 (36.36%), Postives = 18/33 (54.55%), Query Frame = 3
Query: 2208 DKACFMDWLRHIFAPGVREYLQENKLPIKCLLI 2306
            +   F DW    F P VR +L++ KL  K L++
Sbjct:  453 NTTAFYDWFHKTFVPDVRAHLRKLKLEEKALIL 485          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000013943.1 (SMESG000013943.1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.790e-15
Identity = 35/82 (42.68%), Postives = 48/82 (58.54%), Query Frame = 2
Query: 1910 FIANEGYVSQQVFNCNETGLFWKRMPNRTFITQEEK-SMSGHKPMKERLTLLLCSNARGDFKLKPMLAYHSENPRVFKKKNL 2152
            F+    Y + QV+NC+ETGL +K +PNRT  T+ +     G K  K+RLTLL C N  G  KL P++   S+ PR F   N+
Sbjct:  163 FLEEGCYTADQVYNCDETGLCYKMLPNRTLATKTDNHKREGFKKRKDRLTLLFCINKSGSHKLSPLMIGKSKAPRCFHHVNM 244          

HSP 2 Score: 25.7942 bits (55), Expect = 2.790e-15
Identity = 13/28 (46.43%), Postives = 17/28 (60.71%), Query Frame = 3
Query: 1794 FKAISGWLKKFRKRSGIHIVVRHGETSS 1877
            FKA + WL +F+KR  I  V+  GE  S
Sbjct:  120 FKASNIWLDRFKKRHTISQVLVSGEIHS 147          

HSP 3 Score: 25.409 bits (54), Expect = 2.790e-15
Identity = 20/80 (25.00%), Postives = 43/80 (53.75%), Query Frame = 1
Query: 1510 TNISRDFNLPKSTVSTILKNKNLIK-VADVAKGVKVLTKQRPQIIKE--VEKLLLIWINQKQLCGDSISELIIREKANQI 1740
            T ++RDF + +STV     N+ +I+ + ++ +   +L ++R +   +  ++  L  W+ Q +  G  IS  I++ KA + 
Sbjct:   30 TQLARDFGISESTVRGWKTNEIMIRSLPNILEDELILQRKRVKSASDNVLDSALYQWLVQARSEGVPISGPILKAKAEKF 109          
The following BLAST results are available for this feature:
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPOUT11.158e-7141.39SPOUT domain containing methyltransferase 1 [Sourc... [more]
TIGD15.620e-4140.64tigger transposable element derived 1 [Source:HGNC... [more]
TIGD22.721e-2431.84tigger transposable element derived 2 [Source:HGNC... [more]
TIGD22.721e-2431.84tigger transposable element derived 2 [Source:HGNC... [more]
JRKL1.313e-1929.76JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
B0361.61.159e-3631.88Putative methyltransferase B0361.6 [Source:UniPro... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG121281.646e-5637.91gene:FBgn0033473 transcript:FBtr0088393[more]
CG121281.006e-2242.40gene:FBgn0033473 transcript:FBtr0088394[more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
spout14.270e-7041.03SPOUT domain containing methyltransferase 1 [Sourc... [more]
spout12.640e-4036.94SPOUT domain containing methyltransferase 1 [Sourc... [more]
spout13.800e-1336.13SPOUT domain containing methyltransferase 1 [Sourc... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atl25.921e-7639.12atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-9472... [more]
atl21.603e-7341.44atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-9472... [more]
atl23.351e-7341.57atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-9472... [more]
atl21.299e-7241.39atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-9472... [more]
atl21.645e-7241.39atlastin GTPase 2 [Source:Xenbase;Acc:XB-GENE-9472... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spout15.838e-7141.87SPOUT domain containing methyltransferase 1 [Sourc... [more]
Tigd29.329e-2229.92tigger transposable element derived 2 [Source:MGI ... [more]
Jrkl2.059e-1929.76Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Jrk2.315e-1024.38jerky [Source:MGI Symbol;Acc:MGI:106214][more]
Cenpb5.174e-837.04centromere protein B [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5T280|CI114_HUMAN5.561e-7141.39Putative methyltransferase C9orf114 OS=Homo sapien... [more]
sp|Q3UHX9|CI114_MOUSE4.083e-7041.87Putative methyltransferase C9orf114 homolog OS=Mus... [more]
sp|Q96MW7|TIGD1_HUMAN2.699e-4040.64Tigger transposable element-derived protein 1 OS=H... [more]
sp|Q10950|YMP6_CAEEL1.474e-3531.88Putative methyltransferase B0361.6 OS=Caenorhabdit... [more]
sp|Q4W5G0|TIGD2_HUMAN1.307e-2331.84Tigger transposable element-derived protein 2 OS=H... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D4Q5L44.166e-9950.97HTH CENPB-type domain-containing protein OS=Micrur... [more]
A0A3Q2XZ828.494e-9852.21HTH CENPB-type domain-containing protein OS=Hippoc... [more]
A0A2H6NCJ93.445e-9652.14HTH CENPB-type domain-containing protein (Fragment... [more]
A0A0P4W6U89.987e-9452.17HTH CENPB-type domain-containing protein OS=Scylla... [more]
A0A2H6N9B14.645e-9252.14HTH CENPB-type domain-containing protein (Fragment... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spout11.367e-7439.35SPOUT domain containing methyltransferase 1 [Sourc... [more]
spout12.178e-6838.93SPOUT domain containing methyltransferase 1 [Sourc... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005656.13.414e-3134.32pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000001313.11.737e-2431.91pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gen... [more]
ENSPMAT00000010132.11.898e-2431.91pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 g... [more]
ENSPMAT00000003283.12.854e-1933.16pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gen... [more]
ENSPMAT00000004972.12.793e-1529.10pep scaffold:Pmarinus_7.0:GL476545:74372:75575:-1 ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YGR283C_mRNA9.729e-1328.27Putative methyltransferase; may interact with ribo... [more]
YMR310C_mRNA9.493e-619.94Putative methyltransferase; predicted to be involv... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO358251.903e-6641.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447381.301e-1133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
spout12.518e-6840.42SPOUT domain containing methyltransferase 1 [Sourc... [more]
ENSORLT00000031980.14.632e-3537.60pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
ENSORLT00000036785.11.025e-2532.24pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
ENSORLT00000034610.14.613e-755.36pep primary_assembly:ASM223467v1:22:20217020:20217... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044882.14.646e-6290.00SMESG000044882.1[more]
SMESG000044882.14.063e-4679.80SMESG000044882.1[more]
SMESG000047535.13.759e-2682.35SMESG000047535.1[more]
SMESG000027161.12.329e-1842.68SMESG000027161.1[more]
SMESG000013943.12.790e-1542.68SMESG000013943.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013450 ID=SMED30013450|Name=Tigger transposable element-derived protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2667bp
TTAAAATTTGTTTAAATAATACATACTATTATTTTACGAAATGAAGGTTA
AAAATGATAAAAATGTGATTCCTGTACCCGAAATAAAATTATCTAAAAAG
AAATTAAAAGCTAGAGATTCTGAGCAACGCCGACAGCGTAAAGAAGAAAG
AGCATTAAAATTTCTTCAAAATACGAATACTGACATAAAACCTTTTTACA
AAAAAGGATTCAATAATATATGCGGAGTTGCGGAAGGTAGAAAGTACACG
ATCAGTATTGCTGTCCCAGGTTCTATTTTAGACAATGCACAATCAATGGA
ATATAAATGTTTAATGATTGGTCAAATTGCTCGAGCGGCAGCTATTTATT
CAGTTGATGAAATCGTCGTTTATGACGAAGACGGTAAATTGCCGACCAAA
ATAAATGATGATGGATCAAATGAGATTGATCAAGGTCGATGCATAGAAGA
ATTATTAAGCACTGAAGAAGATTTTAATCCATGCGTTTTAATGGCATTTA
TATTAAAATATATGGATACTCCAGAGTATCTCCGAAAAAGTTTATTTCCC
CAATGTACATGTCTTAAAAACTCGAATCATTTACCGCCTCTTGTTATCCC
ATCGCATTTGAGATCCGGAGATCATTTCCCATACCGGGAAGGGATCGTAC
TAGAAAACCCCCAGGATAAAAGTTGCTTAAAATCTAATCTTGTCGATATC
GGATTGAACGAACTAGTTGAAATCGACATTCCTCAAAATGTGGATTCTAG
AATCACGGTAAAGTATAACCAGCCGATTTGTGAAGTTGTCAATCGTGATA
CTCCAAGAACCAAAATAGGAGCCTATTGGGGTTACCGAGTCCGAATGGCT
AACTGTTTATCGGGTGTCATGCAACGAAGTTGCGGTTTCAATGACAAATG
CGGAGACAAACCAACCGACTGCCAATATGACTTGATTATTGGGACATCGG
AAAAGGGGACAAATGTAGATAAATACGAAATGCCGAAATTCTTGCATTTG
TTGTTGGTTTTCGGAGACAGGCAAGGACTAGAGCATGCTATCAGTGTTGA
CAAGGCCTTGCCTAAGGATTCGCAGCCTAAAAGCATTTTCAAGGGATATT
TAAATACTTGTCCGAACCAAGCTTCAAAAACAATCCGTACCGAGGAAGCA
GTCTCTATCAGTCTCGGAGCATTGAGATCAAAAATTTGCAATAAAGGAAA
AAAATAAAATATTTATATTTCTTTTATCGATTTAAATATTGTTTATCGAT
TTTATGTTATTTAAGTATTATTTATTGATTTTCATGTTGTATCGATTTTA
ATGTTATTTATCGATTTTAATATTATTTACCATAATGATGTAATAATAAA
GATGATCAAATGGATAAAGAAAGTCACTGAAATTTCCTTTTTCTAATGTT
TATAATCTTAACTTTATGTCTAATTGTCATTCATACCACTTCACTAAAAG
CATGATTTCAAAAAGAAATGTAAGACATTTTGAAGAAACATGAGATGGGC
ATTTGTACAACCAATATTTCAAGAGATTTTAATTTACCGAAATCAACGGT
TAGCACAATTTTAAAAAACAAAAATTTAATTAAAGTAGCCGATGTTGCAA
AGGGAGTGAAGGTCTTGACAAAACAAAGACCGCAAATAATAAAGGAGGTA
GAGAAATTATTATTAATTTGGATAAATCAAAAACAGCTTTGTGGTGATAG
TATTAGTGAATTGATAATACGTGAAAAAGCTAACCAAATATAGAAAGAAT
TATTTTACAGATCTCCGAAGTCAATGACATTGATTATGGACTTTTTAAGG
CTATTAGTGGATGGCTCAAAAAGTTTCGTAAAAGAAGTGGTATTCATATT
GTGGTTAGACATGGAGAAACTTCAAGCCGCGGAAATATTTTTAAAAAGGT
TTTATAGAGTTTATTGCAAACGAGGGTTATGTTTCACAACAAGTTTTTAA
TTGTAATGAGACTGGACTTTTTTGGAAGCGAATGCCCAACAGAACCTTTA
TTACACAGGAAGAAAAATCAATGTCTGGACATAAGCCGATGAAAGAAAGG
CTAACTCTTTTACTATGTAGCAATGCACGCGGAGATTTTAAATTGAAGCC
GATGCTAGCATACCATTCAGAAAATCCACGAGTTTTTAAAAAGAAAAACT
TGATTAAGTCTAAATTGCCTGTGATTTGGAAATCAAGCACTAAACTAAAG
CTTGGATGACAAAGCTTGTTTTATGGATTGGTTGCGTCATATATTTGCAC
CTGGTGTGCGAGAATATTTACAGGAAAATAAATTACCAATTAAGTGTCTT
CTTATTATGTATATGCACATTCACATATTGAAGTTGATTTGATTGATGAA
CTTAACTTCATAAAAGTCATGAATCTCCCGCCTAATACAACACCTTTGAT
TCAGCCTATGTATCAAGAAGTGATTGTAAATTTTAAAAAATTGTACATGA
AAGAATTATTTTCAAAATGTTTTGAAATTACCAATGATACTGACATAACT
CTAACGAAATTTTGGAAGGAATGCTTTAATATCCTTCATTGCATAAATTT
TATTGATAAAGCATGGATTGGTGTTACTTGTCGTACCCTGAACAAAGCGT
GGGAACCACTGGTGAAATTAATGTTAAAGAAAAGTACCCTTTCCAGCAGT
AAATTGTTTTGACCTAA
back to top

protein sequence of SMED30013450-orf-1

>SMED30013450-orf-1 ID=SMED30013450-orf-1|Name=SMED30013450-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=389bp
MKVKNDKNVIPVPEIKLSKKKLKARDSEQRRQRKEERALKFLQNTNTDIK
PFYKKGFNNICGVAEGRKYTISIAVPGSILDNAQSMEYKCLMIGQIARAA
AIYSVDEIVVYDEDGKLPTKINDDGSNEIDQGRCIEELLSTEEDFNPCVL
MAFILKYMDTPEYLRKSLFPQCTCLKNSNHLPPLVIPSHLRSGDHFPYRE
GIVLENPQDKSCLKSNLVDIGLNELVEIDIPQNVDSRITVKYNQPICEVV
NRDTPRTKIGAYWGYRVRMANCLSGVMQRSCGFNDKCGDKPTDCQYDLII
GTSEKGTNVDKYEMPKFLHLLLVFGDRQGLEHAISVDKALPKDSQPKSIF
KGYLNTCPNQASKTIRTEEAVSISLGALRSKICNKGKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR009057Homeobox-like_sf
IPR006600HTH_CenpB_DNA-bd_dom
IPR007889HTH_Psq
IPR004875DDE_SF_endonuclease_dom
IPR003750Put_MeTrfase
IPR029026tRNA_m1G_MTases_N
IPR029028Alpha/beta_knot_MTases
IPR012340NA-bd_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding