Methyltranfer_dom domain-containing protein

Overview
NameMethyltranfer_dom domain-containing protein
Smed IDSMED30013444
Length (bp)1730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Methyltranfer_dom domain-containing protein (SMED30013444) t-SNE clustered cells

Violin plots show distribution of expression levels for Methyltranfer_dom domain-containing protein (SMED30013444) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Methyltranfer_dom domain-containing protein (SMED30013444) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Methyltranfer_dom domain-containing protein (SMED30013444) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013444

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013444h1SMcG0019681 Contig764newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013444h1SMcG0019681 Contig764uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013444h1SMcG0018797 Contig764newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013444h1SMcG0018797 Contig764uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30013444h1SMcG0007968 Contig5020newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013444h1SMcG0007968 Contig5020uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013444h1SMcG0019681 Contig764newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013444h1SMcG0019681 Contig764uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30013444h1SMcG0018797 dd_Smed_v4_8481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013444h1SMcG0018797 dd_Smed_v4_8481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013444h1SMcG0018797 dd_Smed_v4_8481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013444h1SMcG0018797 dd_Smed_v4_8481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013444h1SMcG0018797 dd_Smed_v4_8481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013444h1SMcG0018797 Contig5020newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013444h1SMcG0018797 Contig5020uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013444h1SMcG0018797 Contig764newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013444h1SMcG0018797 Contig764uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Human
Match: METTL25 (methyltransferase like 25 [Source:HGNC Symbol;Acc:HGNC:26228])

HSP 1 Score: 126.716 bits (317), Expect = 4.057e-30
Identity = 82/227 (36.12%), Postives = 120/227 (52.86%), Query Frame = 3
Query: 1032 LMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPT--MFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDA--QVLELFDELRSPRRYAIVAIK 1700
            LM GLH+CG L+   LR F    + K +  VGCCYHLL+E+F N  +    E   FP+ +  ++     GRNA+  A   + RV     L PT  +F+R +LQ ++ D  G    +  VGKI  K    ++F +YVR S +KLG  +    +  + I  Y  KY         F  LK  L+  +E L++ DRL YL E    A   +++LFD ++SPR YA++A+K
Sbjct:  380 LMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGCCYHLLSEEFENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACLALERVAAGQGL-PTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKC---SSFLDYVRRSLKKLGLDE--SKLPEKIIMNYYEKYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQEDIAWSALVKLFDPVKSPRCYAVIALK 600          

HSP 2 Score: 62.7734 bits (151), Expect = 1.151e-9
Identity = 33/70 (47.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            MN KKS+EV+ MS L  +I   + I  V+D+GSGKGYL S LS+  GL V  +DS  +N  GA  R ++ 
Sbjct:  151 MNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKL 220          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Human
Match: RRNAD1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24273])

HSP 1 Score: 82.0333 bits (201), Expect = 7.212e-16
Identity = 97/368 (26.36%), Postives = 155/368 (42.12%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNV--IELDSRESNKTGALNRRKRFMMQVPSKKRKVNAS--ENLKIGSCRSIARNITSTDTISKILLEEG---FSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFP------------------LSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGF-VDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +  KK +E+ ++  L + +        VVD+GSG+G+L   +++  GL V  IE D R   +   L++    ++Q   K+ K N    +     S   + R +  T    ++LL         A  L+TGLH+CG LS  +LR+F  C +  A+  VGCCY  L++     +   Q+ V+  P                   + + QK+G  L  +    A +TV R  R     P                         G  G     E   EEYV+   +++G    L  N+ + +    +      + R   FF L   L+ +VE L++ DRL+YL E G  A++L +F    SPR   +VA K
Sbjct:  130 VRPKKQHEIRRLGELVKKLSDFTGCTQVVDVGSGQGHLSRFMALGLGLMVKSIEGDQRLVERAQRLDQE---LLQALEKEEKRNPQVVQTSPRHSPHHVVRWVDPTALCEELLLPLENPCQGRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDP--GGYPLSQW-VAGLPGYELPYRLREGACHALEEYAERLQKAGPGLRTHCYRAALETVIRRARPELRRP-------------------------GVQGIPRVHELKIEEYVQRGLQRVGLDPQLPLNLAALQAHVAQ------ENRVVAFFSLALLLAPLVETLILLDRLLYLQEQGFHAELLPIFSPELSPRNLVLVATK 460          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Human
Match: METTL25 (methyltransferase like 25 [Source:HGNC Symbol;Acc:HGNC:26228])

HSP 1 Score: 74.7146 bits (182), Expect = 2.380e-15
Identity = 42/111 (37.84%), Postives = 60/111 (54.05%), Query Frame = 3
Query: 1032 LMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPT--MFHRILLQKLLNDKLG 1358
            LM GLH+CG L+   LR F    + K +  VGCCYHLL+E+F N  +    E   FP+ +  ++     GRNA+  A   + RV     L PT  +F+R +LQ ++ D  G
Sbjct:   15 LMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGCCYHLLSEEFENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACLALERVAAGQGL-PTESLFYRAVLQDIIKDCYG 124          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Human
Match: METTL25 (methyltransferase like 25 [Source:HGNC Symbol;Acc:HGNC:26228])

HSP 1 Score: 65.0846 bits (157), Expect = 3.712e-11
Identity = 57/229 (24.89%), Postives = 88/229 (38.43%), Query Frame = 3
Query:  288 FFDFFYSFMPLVNSHSNDFIINDLWNKFL---PETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIPPNWEIVSNDL-NVFIQNCAKFSSFKSFINAKDKF----------FDEIFIDYE----------------MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
               F    + + N+H+ DF    +W + +   PET+             L    K  +E     + T         L+  E           WE    D   +F +   K  S ++F  A   +          F+++ +                   MN KKS+EV+ MS L  +I   + I  V+D+GSGKGYL S LS+  GL V  +DS  +N  GA  R ++ 
Sbjct:   23 LLQFLRDALSISNAHTVDFYTESVWEELVDLPPETV-------------LAALRKSASETEALPSET-------RPLVEAE-----------WEAGMTDFPKIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQRIGENQKAVEFMNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKL 220          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Human
Match: METTL25 (methyltransferase like 25 [Source:HGNC Symbol;Acc:HGNC:26228])

HSP 1 Score: 63.5438 bits (153), Expect = 4.680e-11
Identity = 33/70 (47.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            MN KKS+EV+ MS L  +I   + I  V+D+GSGKGYL S LS+  GL V  +DS  +N  GA  R ++ 
Sbjct:  110 MNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKL 179          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Celegans
Match: F25H2.12 (pep chromosome:WBcel235:I:10570079:10571904:1 gene:WBGene00009123.1 transcript:F25H2.12b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F25H2.12)

HSP 1 Score: 108.997 bits (271), Expect = 3.022e-25
Identity = 98/362 (27.07%), Postives = 179/362 (49.45%), Query Frame = 3
Query:  684 KKSYEVEKMSCLCRNIC-----KEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTISKILLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKF----VNNFQNDQFEVSD---------FPLSNQFQKSGI-ILGRNAKTFASQTVRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKK-IKDENNFEEYVRISCRKLG--FVDLIENMTSEEIKEYEIKYSHLK-FRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            KK +E++++  L   I          I ++VDIG+G G+L   +SI N ++V+ ++  +     A +  ++ ++       ++   EN  + S      N  + D   KI   + F+  + ++ GLH CG  SST+L+ F   + +KA+VL GCCYH   + F      N +N++ E+S+         FPLS +++   I  L R A    ++ +        +  + + R  L+K +  K+  + ++  +G    K I+++  FEEY+R +    G   +D +  +  +   E     S L+  +F +F  L+C  +  +E+ +I DR+  L ENGI+++V+ LF+   SPR  AI+A K
Sbjct:   89 KKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMISIHNNISVMAVEGNQQFTLAANSLDEKLLLDSAKIGSRI---ENFNVKSTPIRYTNFVTEDLALKI---DDFAVNSAILVGLHCCGDFSSTILKVFQKSEKSKALVLFGCCYHKEFQCFHFLRPENNENER-EISENTSFGKSTVFPLSKKWENVEIDYLLREAACHNNENLEERFLKQKIDLSRYARSYLEKWIW-KVSELPEDRNIGMCSVKCIENQTTFEEYIRKAMANRGNHLLDKVLQIIPQ--SELSAHVSSLRSSQFDSFEVLRCMFAPAIESAIIDDRVELLRENGINSRVVPLFEPSISPRNLAIIAYK 440          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Celegans
Match: F25H2.12 (pep chromosome:WBcel235:I:10570079:10571916:1 gene:WBGene00009123.1 transcript:F25H2.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F25H2.12)

HSP 1 Score: 109.383 bits (272), Expect = 3.452e-25
Identity = 98/362 (27.07%), Postives = 179/362 (49.45%), Query Frame = 3
Query:  684 KKSYEVEKMSCLCRNIC-----KEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTISKILLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKF----VNNFQNDQFEVSD---------FPLSNQFQKSGI-ILGRNAKTFASQTVRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKK-IKDENNFEEYVRISCRKLG--FVDLIENMTSEEIKEYEIKYSHLK-FRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            KK +E++++  L   I          I ++VDIG+G G+L   +SI N ++V+ ++  +     A +  ++ ++       ++   EN  + S      N  + D   KI   + F+  + ++ GLH CG  SST+L+ F   + +KA+VL GCCYH   + F      N +N++ E+S+         FPLS +++   I  L R A    ++ +        +  + + R  L+K +  K+  + ++  +G    K I+++  FEEY+R +    G   +D +  +  +   E     S L+  +F +F  L+C  +  +E+ +I DR+  L ENGI+++V+ LF+   SPR  AI+A K
Sbjct:  127 KKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMISIHNNISVMAVEGNQQFTLAANSLDEKLLLDSAKIGSRI---ENFNVKSTPIRYTNFVTEDLALKI---DDFAVNSAILVGLHCCGDFSSTILKVFQKSEKSKALVLFGCCYHKEFQCFHFLRPENNENER-EISENTSFGKSTVFPLSKKWENVEIDYLLREAACHNNENLEERFLKQKIDLSRYARSYLEKWIW-KVSELPEDRNIGMCSVKCIENQTTFEEYIRKAMANRGNHLLDKVLQIIPQ--SELSAHVSSLRSSQFDSFEVLRCMFAPAIESAIIDDRVELLRENGINSRVVPLFEPSISPRNLAIIAYK 478          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Fly
Match: CG33964 (gene:FBgn0053964 transcript:FBtr0100005)

HSP 1 Score: 138.658 bits (348), Expect = 5.616e-35
Identity = 144/521 (27.64%), Postives = 246/521 (47.22%), Query Frame = 3
Query:  243 LEEYLILMNPINETDFFDFFYSFMPLVNSHSNDFIINDLWNKFLPETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIPPNWEIVSNDLNVFIQNCAKFSSFKSFINAKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNI-ANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFM-----------MQV----PSKK-RKVNASENLKIGSC----RSIARNITSTDTISKILLEEGFS------NANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNN--FQNDQF-EVS---DFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNL-HPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGID-AQVLELFDELRSPRRYAIVAIK 1700
            L+  L  +NP      +DF       VN H  +++ +  W+ FL ET++  I   ++    +E      +E+  F          W   +G + K    ++ P       +L     N  + S  + F++AK                K +EV+  + L   + K       +VD G GKGYL S L++  G  V+ +D+  +N   ALNR ++             +QV    P ++ +K  A E+ K        ++ A+ IT T+     LL E F+      + N  +TGLH+CG L++T L+ F    D + +  VGCCYHLL E++     F N    E+     FPLS   ++  + +GRNA+  A+Q++ R L    L + T+++R LL+ L+      + +   VGK+ K      +FEEY++    KL     +  +  EE++    +Y+  K+    F+ L+   + ++E+L++ DRL+YL E G + + +++LFD + SPR +AIV+IK
Sbjct:   13 LDGLLAFLNP-----HWDF-------VNCHMVNYLTDQHWDGFLSETLKSEIAGKEDVALAIEDLFWKTDESERFPA--------WREFLG-KSKQERLSLHPKLLTSVEELIEGQGNSTQLS-IREFMSAK----------------KCHEVDLTAVLVDQLVKNSGQDCFIVDAGDGKGYLSSRLALQYGHRVLGIDANAANTENALNRNRKLQRAWNGLTERAELQVQGITPKRRSKKSPARESTKSAPALENYKTTAKFIT-TELNFGALLAENFTQFRPEDSPNICLTGLHTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLRERQVRMGRNARMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNELQVGKVRKF----ESFEEYIQKCATKLD-APWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKELGYERSYLIDLFDPVISPRHFAIVSIK 489          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Fly
Match: CG2906 (gene:FBgn0033240 transcript:FBtr0113052)

HSP 1 Score: 89.7373 bits (221), Expect = 9.133e-19
Identity = 114/493 (23.12%), Postives = 202/493 (40.97%), Query Frame = 3
Query:  318 LVNSHSNDFIINDLWNKFLPETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNW-YSLIGTEEKI----VDR--NIPPNWEIVSNDLNVFIQNCAKFSSFKSFINAKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTISKILLEEGF------------SNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQ-KSGIILGRNAKTF---ASQTVRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGK---------KIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            L++++  DF I+D W+K LP   +  +ESI      LE      N   +  N   NT   W   L   +E++    V R    PP+  +  + L+                + K K+   +F+   +  KK +E+ +M+ +C    ++  +  +VD G+G G+L   L    GL V   + +       LN++ R +      K +  A+++L         R +  T  +      E F             N  + + GLH CG L  T++R F+ C  AK +  VGCCY    +K      + +  V  +PLS++ + K+   L   A+     A +     LR G+           Q L    L   ++  IV +  +         K      F +Y + + +   F  L     S +  E ++       R  +F+ L+  ++ +VE+++++DR ++L EN    Q+  +FD   SPR +   A+K
Sbjct:   21 LLDAYVLDFFIDDHWSK-LPGNWQKHLESIP-----LE------NLGDLLKNENHNTQLTWPLDLKNLQEELRKLCVSRVPKHPPDNSLPCSLLD----------------HPKLKY---VFLK-RVKPKKHHEIIRMAEICALSQQKTPVDFIVDFGAGVGHLARVLGYGYGLRVCCYEMQPD-----LNQQAREI----DLKLESMAAKHLSEDETTHFQRPVHLTHRLESSTKPEQFLSSIRQALQLTDDNFRFGVIGLHPCGNLGPTLMRMFLGCPQAKFLNFVGCCY----QKMTTQSTHPREHVHGYPLSSELKDKNECQLSYEAREISCHAMEVYHDRLRMGD----------YQHLRIHSLRAAAERIIVHQFPELRHCALRNVKYSPGMTFHQYFQKAVQGTRFEALDSRTLSNQQTETDLANWQ---RIVSFYTLRLMMAPLVESIILYDRCLFLMENDCQVQIEAIFDPRLSPRNHITRAVK 455          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Fly
Match: CG2906 (gene:FBgn0033240 transcript:FBtr0305126)

HSP 1 Score: 88.1965 bits (217), Expect = 1.320e-18
Identity = 85/367 (23.16%), Postives = 153/367 (41.69%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTISKILLEEGF------------SNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQ-KSGIILGRNAKTF---ASQTVRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGK---------KIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +  KK +E+ +M+ +C    ++  +  +VD G+G G+L   L    GL V   + +       LN++ R +      K +  A+++L         R +  T  +      E F             N  + + GLH CG L  T++R F+ C  AK +  VGCCY    +K      + +  V  +PLS++ + K+   L   A+     A +     LR G+           Q L    L   ++  IV +  +         K      F +Y + + +   F  L     S +  E ++       R  +F+ L+  ++ +VE+++++DR ++L EN    Q+  +FD   SPR +   A+K
Sbjct:   23 VKPKKHHEIIRMAEICALSQQKTPVDFIVDFGAGVGHLARVLGYGYGLRVCCYEMQPD-----LNQQAREI----DLKLESMAAKHLSEDETTHFQRPVHLTHRLESSTKPEQFLSSIRQALQLTDDNFRFGVIGLHPCGNLGPTLMRMFLGCPQAKFLNFVGCCY----QKMTTQSTHPREHVHGYPLSSELKDKNECQLSYEAREISCHAMEVYHDRLRMGD----------YQHLRIHSLRAAAERIIVHQFPELRHCALRNVKYSPGMTFHQYFQKAVQGTRFEALDSRTLSNQQTETDLANWQ---RIVSFYTLRLMMAPLVESIILYDRCLFLMENDCQVQIEAIFDPRLSPRNHITRAVK 363          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Zebrafish
Match: mettl25 (methyltransferase like 25 [Source:ZFIN;Acc:ZDB-GENE-041210-90])

HSP 1 Score: 130.183 bits (326), Expect = 1.362e-31
Identity = 84/230 (36.52%), Postives = 124/230 (53.91%), Query Frame = 3
Query: 1026 NYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFE-VSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNL-HPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSE-EIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYL--AENGIDAQVLELFDELRSPRRYAIVAIK 1700
            N ++ GLH+CG L+S+ LR F   Q+ +A+  VGCCYHLL+E+F  +      + V  FP+S   +      GRNA+  A   + RV   G L   ++F+R +L  +L D          VG +  K     +F +YVR + RKL   DL E+  S+ +I+ Y  +Y+        F  LK  L+  +E L++ DRL YL   EN   A +++LFD L+SPR YA+V IK
Sbjct:  363 NAVLVGLHTCGDLASSSLRMFRAKQELRAVCSVGCCYHLLSEEFDQDRPGCTSDGVCGFPMSQYLKDQACFCGRNARMSACLALERVSAGGGLPMESLFYRAVLHVILQDHYDCFKSEKRVGNVYSKA---TSFADYVRRALRKL---DLDESKLSDGDIQSYHDRYTPRMNEMVAFNMLKVTLAPCIEGLILLDRLCYLKEQENVSHAALVQLFDPLQSPRCYAVVGIK 586          

HSP 2 Score: 58.9214 bits (141), Expect = 1.137e-8
Identity = 53/204 (25.98%), Postives = 90/204 (44.12%), Query Frame = 3
Query:  297 FFYSFMPLVNSHSNDFIINDLWNKFL---PETIRHLIESIDNPVYILEQYVKC----CNEAPVFNNLTVNTNC-NWYSLIGTEEKIVDRNIPPNWEIVSNDLNVFIQNCAKFSSFKSFINAKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            F    + + N+H+ DF    +W+ F+   PE +   I S  +    LE+        CN +    +++        + L G         +    E + ++L +   + A   S    + A D+F         MN KK++EV+ MS +  ++ K   +  V+D+GSGKGYL S LS+   L V  +DS  +N  GA  R ++ 
Sbjct:   22 FLSISLSISNAHTVDFYTRGVWSTFISVSPEDVLCAISSTQDSTGALEEKENTTFGFCNASKKLLDISALLRAAKAHCLPGL-------GVCMQLEELMHNLRLMCGDTAAGQSSNKVL-APDEF---------MNWKKAHEVQSMSEVVASLAKCCRVKQVIDVGSGKGYLCSYLSMRYNLQVFGIDSSTTNTHGAQERNRKL 208          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Zebrafish
Match: rrnad1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-515])

HSP 1 Score: 90.8929 bits (224), Expect = 7.936e-19
Identity = 71/251 (28.29%), Postives = 119/251 (47.41%), Query Frame = 3
Query: 1023 ANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNN----FQNDQFE---VSDF------PLSNQFQK-SGIILGRNAKTFASQTV----RRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGF-VDL------IENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
             ++++TGLH+CG LS+T+LR+F +C     I  V CCY  ++ K   N    FQ   F     +DF      P+SN  +  +G  L   A+  A   +    +R+  +  L  T  +R +L+ ++     +  D    G    K     +F EY R++  ++G   DL      ++ M +++ K               +F L   L+ +VE LV+ DR+I+L E G  ++++ LFD   SPR   +VA+K
Sbjct:  263 GSFVLTGLHACGDLSATLLRHFTNCPHVNVITSVACCYMKISTKENPNPPGVFQPPFFSDITTADFCSEFGYPMSNWVRGLTGHQLSYKAREGACHAIEEYLQRLREESTLLRTHCYRAILENIIR---AHRPDIRRPGVQTVKKAHMLSFSEYARLALPRVGLPADLPFDPVCVDAMLAQQGK------------VVAYFSLVLLLAPVVETLVLLDRIIFLQERGFQSKLIPLFDAAFSPRNLVLVAVK 498          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Zebrafish
Match: rrnad1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-515])

HSP 1 Score: 90.5077 bits (223), Expect = 8.335e-19
Identity = 71/251 (28.29%), Postives = 119/251 (47.41%), Query Frame = 3
Query: 1023 ANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNN----FQNDQFE---VSDF------PLSNQFQK-SGIILGRNAKTFASQTV----RRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGF-VDL------IENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
             ++++TGLH+CG LS+T+LR+F +C     I  V CCY  ++ K   N    FQ   F     +DF      P+SN  +  +G  L   A+  A   +    +R+  +  L  T  +R +L+ ++     +  D    G    K     +F EY R++  ++G   DL      ++ M +++ K               +F L   L+ +VE LV+ DR+I+L E G  ++++ LFD   SPR   +VA+K
Sbjct:  264 GSFVLTGLHACGDLSATLLRHFTNCPHVNVITSVACCYMKISTKENPNPPGVFQPPFFSDITTADFCSEFGYPMSNWVRGLTGHQLSYKAREGACHAIEEYLQRLREESTLLRTHCYRAILENIIR---AHRPDIRRPGVQTVKKAHMLSFSEYARLALPRVGLPADLPFDPVCVDAMLAQQGK------------VVAYFSLVLLLAPVVETLVLLDRIIFLQERGFQSKLIPLFDAAFSPRNLVLVAVK 499          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Zebrafish
Match: rrnad1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050522-515])

HSP 1 Score: 83.1889 bits (204), Expect = 2.886e-16
Identity = 71/261 (27.20%), Postives = 119/261 (45.59%), Query Frame = 3
Query: 1023 ANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNN----FQNDQFE---VSDF------PLSNQFQK-SGIILGRNAKTFASQTV----RRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEE----------YVRISCRKLGF-VDL------IENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
             ++++TGLH+CG LS+T+LR+F +C     I  V CCY  ++ K   N    FQ   F     +DF      P+SN  +  +G  L   A+  A   +    +R+  +  L  T  +R +L+ ++     +  D    G    K     +F E          Y R++  ++G   DL      ++ M +++ K               +F L   L+ +VE LV+ DR+I+L E G  ++++ LFD   SPR   +VA+K
Sbjct:  323 GSFVLTGLHACGDLSATLLRHFTNCPHVNVITSVACCYMKISTKENPNPPGVFQPPFFSDITTADFCSEFGYPMSNWVRGLTGHQLSYKAREGACHAIEEYLQRLREESTLLRTHCYRAILENIIR---AHRPDIRRPGVQTVKKAHMLSFSELVTFFCHIRKYARLALPRVGLPADLPFDPVCVDAMLAQQGK------------VVAYFSLVLLLAPVVETLVLLDRIIFLQERGFQSKLIPLFDAAFSPRNLVLVAVK 568          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Xenopus
Match: METTL25 (methyltransferase like 25 [Source:NCBI gene;Acc:779563])

HSP 1 Score: 112.849 bits (281), Expect = 1.063e-25
Identity = 86/226 (38.05%), Postives = 124/226 (54.87%), Query Frame = 3
Query: 1032 LMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRV-LRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAE--NGIDAQVLELFDELRSPRRYAIVAIK 1700
            +M GLH+CG L+   LR F    + KA+  VGCCYHLL+E+F +  +        FP+S   ++S    GRNA+  A   + RV +  G    ++F+R +LQ +L D       +  VGKI  K     NF EYVR S +KLG  D    ++  EI EY  KY   K     F  LK  L+  +E L++ DRL+YL E  N   + +++LFD ++SPR YA+V++K
Sbjct:  362 IMVGLHTCGDLAPNTLRIFTAKPEIKAVCSVGCCYHLLSEEFESPEEEITVTTWGFPMSIHLKESSWFFGRNARMSACLALERVAVGQGLATESLFYRAVLQVILKDCFSVTQSDKRVGKIFSK---SGNFTEYVRKSLKKLGHDD--SELSDMEIMEYFEKYKPRKNEMEAFNMLKVLLAPCIEALILLDRLLYLKEQNNLAWSGLVKLFDPVKSPRCYAVVSMK 582          

HSP 2 Score: 59.3066 bits (142), Expect = 1.220e-8
Identity = 60/236 (25.42%), Postives = 99/236 (41.95%), Query Frame = 3
Query:  288 FFDFFYSFMPLVNSHSNDFIINDLWNKFL---PETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIPPNWEIVSNDLNVFIQNCAKFSSFKSFIN-----AKDKFFDEIFI----------DYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRR----KRFMMQVPSKKRKVNASE 929
               F +  + +  +H+ DF   D+W K +   PET+                             L+  +  N     GT   I  + +P    I SN   V I+   + S   S +N     + D+  + + +          D  MN+KK +EV  MS L ++I     +  V+D+G+GKGYL S LS+   L V  +DS ++N  GA NRR    K++     +  R+V+ ++
Sbjct:   20 LLQFLHETLQISGAHTVDFYTQDIWKKLVAVSPETV-----------------------------LSAFSKHN-----GTSHHI-GKEVPELSSIFSNQQLVNIEAFVEASHSHSLVNMGICTSVDELLEALAVHKAGSPDLKTDQFMNDKKLHEVLIMSQLVQSIANICGVKQVIDLGAGKGYLSSYLSMKYNLKVYGIDSSDTNTDGA-NRRNQKLKKYWKTYKTDAREVSKAQ 219          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Xenopus
Match: rrnad1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:NCBI gene;Acc:733951])

HSP 1 Score: 78.5666 bits (192), Expect = 1.075e-14
Identity = 66/239 (27.62%), Postives = 104/239 (43.51%), Query Frame = 3
Query: 1029 YLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFV----------NNFQNDQFEVSDFPLSNQFQK-SGIILGRNAKTFASQTVR----RVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +L+TGLH+CG LS  MLR+F  C +   I  V CCY  L+   +          +  Q  Q     +PLS+   +  G  L   A+  A   +     R+  +  +  T  +R +L+ ++      +      G    K   E  F EY R   +++G   L    T +E+    +   H K     FF L   L+ ++E L++ DR+I+L E G    ++ LF    SPR   +VA K
Sbjct:  281 FLLTGLHACGDLSVAMLRHFARCPNVVGITSVACCYMKLSTSEMPEPPGVLSSSHPAQATQPLEYGYPLSSWVARLPGHKLSYKAREVACHAIEDYMERLRGESAILRTHCYRAVLETVIRSIDPSMKRP---GVQTIKKAHELPFREYAREGLKRVG---LDPGTTLDEVLVERLLSQHQKV--VAFFSLALLLAPLIETLILLDRMIFLQEQGFHCDLIPLFKPEFSPRNLVLVATK 511          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Xenopus
Match: rrnad1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:NCBI gene;Acc:733951])

HSP 1 Score: 78.1814 bits (191), Expect = 1.274e-14
Identity = 66/239 (27.62%), Postives = 104/239 (43.51%), Query Frame = 3
Query: 1029 YLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFV----------NNFQNDQFEVSDFPLSNQFQK-SGIILGRNAKTFASQTVR----RVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +L+TGLH+CG LS  MLR+F  C +   I  V CCY  L+   +          +  Q  Q     +PLS+   +  G  L   A+  A   +     R+  +  +  T  +R +L+ ++      +      G    K   E  F EY R   +++G   L    T +E+    +   H K     FF L   L+ ++E L++ DR+I+L E G    ++ LF    SPR   +VA K
Sbjct:  302 FLLTGLHACGDLSVAMLRHFARCPNVVGITSVACCYMKLSTSEMPEPPGVLSSSHPAQATQPLEYGYPLSSWVARLPGHKLSYKAREVACHAIEDYMERLRGESAILRTHCYRAVLETVIRSIDPSMKRP---GVQTIKKAHELPFREYAREGLKRVG---LDPGTTLDEVLVERLLSQHQKV--VAFFSLALLLAPLIETLILLDRMIFLQEQGFHCDLIPLFKPEFSPRNLVLVATK 532          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Mouse
Match: Mettl25 (methyltransferase like 25 [Source:MGI Symbol;Acc:MGI:3041259])

HSP 1 Score: 130.568 bits (327), Expect = 1.446e-31
Identity = 88/229 (38.43%), Postives = 130/229 (56.77%), Query Frame = 3
Query: 1032 LMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQND-QFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPT--MFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEE-IKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAE-NGID-AQVLELFDELRSPRRYAIVAIK 1700
            LM GLH+CG L+ + LR F    + KA+  VGCCYHLL+E+F N  ++    E   FP+ +  ++     GRNA+  A   ++RV     L PT  +F+R +LQ ++ D  G       VGKI  K    ++F EYVR+S +KLG   L E+  SEE I +Y   Y         F  LK  L+  +E L++ DRL YL E +G+  + +++LFD ++SPR YA++A+K
Sbjct:  373 LMVGLHTCGDLAPSTLRIFTSKAEVKAVCSVGCCYHLLSEEFENQHKDRCANENWGFPMCHYLKEERWCCGRNARMSACLALQRVAVGQGL-PTESLFYRAVLQNIIKDYYGISKCEQHVGKIYSKC---SSFLEYVRMSLKKLG---LDESKVSEEIIMDYYENYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQDGVAWSALVKLFDPVQSPRCYAVIALK 594          

HSP 2 Score: 61.2326 bits (147), Expect = 2.411e-9
Identity = 32/70 (45.71%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            MN KKS+EV+ MS L  +I     +  ++D+GSGKGYL S LS+  GLNV  +DS  +N  GA  R ++ 
Sbjct:  146 MNTKKSHEVQAMSELICSIADYCGLKQIIDVGSGKGYLSSFLSLKYGLNVYGIDSSNTNTHGAKERNRKL 215          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Mouse
Match: Rrnad1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:MGI Symbol;Acc:MGI:2387197])

HSP 1 Score: 96.6709 bits (239), Expect = 5.989e-21
Identity = 89/368 (24.18%), Postives = 154/368 (41.85%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGA-------------LNRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTISKILLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPTMFHRILLQKL---LNDKLGYVSDNWIVGKIGKKIK----------DENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +  KK +E+ ++  L + +        VVD+GSG+G+L   +S+  GL V  L+  +     A             + +R   M+Q   + R  +  + +            T  + +   L   G S+A  L+TGLH+CG LS  +LR+F  C +  A+  VGCCY  L++               +PLS        I G        +     LR+G  H    +   L K    L       +   ++ ++  +++           E   EEYV+   +++G  D    +    ++ ++ + +    R   FF L   L+ +VE L++ DR++YL E G  A++L +F    SPR   +VA K
Sbjct:   66 VKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSRFMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQWVS---------PTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDP------------GSYPLSQ------WIAGLPGHELPYR-----LREGACHALEDYAERLHKAEPGLQTHCFRAALETVIRQVCPELRRPGVQGIPRVHELKIEEYVKQGLKRVGL-DPQLPLDLAALQAHQAQEN----RVVAFFSLALLLAPLVETLILLDRMLYLQEQGFYAELLPIFSPELSPRNLVLVATK 396          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Mouse
Match: Rrnad1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:MGI Symbol;Acc:MGI:2387197])

HSP 1 Score: 97.0561 bits (240), Expect = 6.231e-21
Identity = 86/359 (23.96%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRK----VNASENLKIGSCRSIARNITSTDTISKILLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPTMFHRILLQKL---LNDKLGYVSDNWIVGKIGKKIK----------DENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +  KK +E+ ++  L + +        VVD+GSG+G+L   +S+  GL V  L+  +     A +  +  +  +   +++    V      +           T  + +   L   G S+A  L+TGLH+CG LS  +LR+F  C +  A+  VGCCY  L++               +PLS        I G        +     LR+G  H    +   L K    L       +   ++ ++  +++           E   EEYV+   +++G +D    +    ++ ++ + +    R   FF L   L+ +VE L++ DR++YL E G  A++L +F    SPR   +VA K
Sbjct:  130 VKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSRFMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQWVSPTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDP------------GSYPLSQ------WIAGLPGHELPYR-----LREGACHALEDYAERLHKAEPGLQTHCFRAALETVIRQVCPELRRPGVQGIPRVHELKIEEYVKQGLKRVG-LDPQLPLDLAALQAHQAQEN----RVVAFFSLALLLAPLVETLILLDRMLYLQEQGFYAELLPIFSPELSPRNLVLVATK 460          
BLAST of Methyltranfer_dom domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6NXH8|MET25_MOUSE (Methyltransferase-like protein 25 OS=Mus musculus OX=10090 GN=Mettl25 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 9.914e-31
Identity = 88/229 (38.43%), Postives = 130/229 (56.77%), Query Frame = 3
Query: 1032 LMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQND-QFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPT--MFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEE-IKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAE-NGID-AQVLELFDELRSPRRYAIVAIK 1700
            LM GLH+CG L+ + LR F    + KA+  VGCCYHLL+E+F N  ++    E   FP+ +  ++     GRNA+  A   ++RV     L PT  +F+R +LQ ++ D  G       VGKI  K    ++F EYVR+S +KLG   L E+  SEE I +Y   Y         F  LK  L+  +E L++ DRL YL E +G+  + +++LFD ++SPR YA++A+K
Sbjct:  370 LMVGLHTCGDLAPSTLRIFTSKAEVKAVCSVGCCYHLLSEEFENQHKDRCANENWGFPMCHYLKEERWCCGRNARMSACLALQRVAVGQGL-PTESLFYRAVLQNIIKDYYGISKCEQHVGKIYSKC---SSFLEYVRMSLKKLG---LDESKVSEEIIMDYYENYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQDGVAWSALVKLFDPVQSPRCYAVIALK 591          

HSP 2 Score: 61.2326 bits (147), Expect = 1.710e-8
Identity = 32/70 (45.71%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            MN KKS+EV+ MS L  +I     +  ++D+GSGKGYL S LS+  GLNV  +DS  +N  GA  R ++ 
Sbjct:  143 MNTKKSHEVQAMSELICSIADYCGLKQIIDVGSGKGYLSSFLSLKYGLNVYGIDSSNTNTHGAKERNRKL 212          
BLAST of Methyltranfer_dom domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N6Q8|MET25_HUMAN (Methyltransferase-like protein 25 OS=Homo sapiens OX=9606 GN=METTL25 PE=2 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.948e-29
Identity = 82/227 (36.12%), Postives = 120/227 (52.86%), Query Frame = 3
Query: 1032 LMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPT--MFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDA--QVLELFDELRSPRRYAIVAIK 1700
            LM GLH+CG L+   LR F    + K +  VGCCYHLL+E+F N  +    E   FP+ +  ++     GRNA+  A   + RV     L PT  +F+R +LQ ++ D  G    +  VGKI  K    ++F +YVR S +KLG  +    +  + I  Y  KY         F  LK  L+  +E L++ DRL YL E    A   +++LFD ++SPR YA++A+K
Sbjct:  380 LMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGCCYHLLSEEFENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACLALERVAAGQGL-PTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKC---SSFLDYVRRSLKKLGLDE--SKLPEKIIMNYYEKYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQEDIAWSALVKLFDPVKSPRCYAVIALK 600          

HSP 2 Score: 62.7734 bits (151), Expect = 5.527e-9
Identity = 33/70 (47.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            MN KKS+EV+ MS L  +I   + I  V+D+GSGKGYL S LS+  GL V  +DS  +N  GA  R ++ 
Sbjct:  151 MNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKL 220          
BLAST of Methyltranfer_dom domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BZG5|RRNAD_MOUSE (Protein RRNAD1 OS=Mus musculus OX=10090 GN=Rrnad1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.982e-20
Identity = 86/359 (23.96%), Postives = 153/359 (42.62%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRK----VNASENLKIGSCRSIARNITSTDTISKILLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPTMFHRILLQKL---LNDKLGYVSDNWIVGKIGKKIK----------DENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +  KK +E+ ++  L + +        VVD+GSG+G+L   +S+  GL V  L+  +     A +  +  +  +   +++    V      +           T  + +   L   G S+A  L+TGLH+CG LS  +LR+F  C +  A+  VGCCY  L++               +PLS        I G        +     LR+G  H    +   L K    L       +   ++ ++  +++           E   EEYV+   +++G +D    +    ++ ++ + +    R   FF L   L+ +VE L++ DR++YL E G  A++L +F    SPR   +VA K
Sbjct:  130 VKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSRFMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQWVSPTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDP------------GSYPLSQ------WIAGLPGHELPYR-----LREGACHALEDYAERLHKAEPGLQTHCFRAALETVIRQVYPELRRPGVQGIPRVHELKIEEYVKQGLKRVG-LDPQLPLDLAALQAHQAQEN----RVVAFFSLALLLAPLVETLILLDRMLYLQEQGFYAELLPIFSPELSPRNLVLVATK 460          
BLAST of Methyltranfer_dom domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6AYG0|RRNAD_RAT (Protein RRNAD1 OS=Rattus norvegicus OX=10116 GN=Rrnad1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.397e-19
Identity = 92/349 (26.36%), Postives = 149/349 (42.69%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNK--TGALNRRKRFMMQVPSKKRK-----VNASENLKIGSCRSIARNITSTDTISKILLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +  KK +E+ ++  L + +        VVD+GSG+G+L   +S+  GL V    S E NK       R  + ++Q   K  K     V  S   +           T  + +   L   G S+   L+TGLH+CG LS  +LR+F  C +  A+  VGCCY  L++    ++   Q+ V+  P      +    L   A         R+ + G    T   R  L+ ++      +      G  G     E   EEYV+   +++G   L   +  ++      +    + R   FF L   L+ +VE L++ DR++YL E G  A++L +F    SPR   +VA K
Sbjct:  130 VKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSRFMSLGLGLMV---KSLEGNKRLVARAQRLDQELLQALDKMEKRHPKMVQRSPRHRPHHVVQWVSPTTLCEELLLPLEMPGQSSTRLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDP--GSYPLSQW-VAGLPGHELPYR----LREGACHALEDYAERLQKAGPGLQTHCFRAALEAVIRQVCPELRRP---GVQGIPRVHELKIEEYVQQGLQRVG---LDPQLPLDQAALQAHQAQ--ENRVVAFFSLALLLAPLVETLILLDRMLYLQEQGFYAELLPIFSPELSPRNLVLVATK 460          
BLAST of Methyltranfer_dom domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5E9V4|RRNAD_BOVIN (Protein RRNAD1 OS=Bos taurus OX=9913 GN=RRNAD1 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.435e-15
Identity = 93/368 (25.27%), Postives = 154/368 (41.85%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNV--IELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTISKILLEEGF------SNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFP------------------LSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +  KK +E+ ++  L + +        VVD+GSG+G+L   +S+  GL V  IE D R   +   L++    ++Q   K+ K N  + ++ G        +   D  +              S A  L+TGLH+CG LS  +L++F  C +  A+  VGCCY  L++     +   Q+ V+  P                   + + QK+G  L  +    A +TV R  +     P                         G  G     E   EEYV+   +++G  D    +    ++ ++ + +    R   FF L   L+ +VE L++ DRL+YL E G  A++L +F    SPR   +VA K
Sbjct:  130 VRPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSRFMSLGLGLMVKSIEGDQRLVERAQRLDQE---LLQTLEKEEKRN-PKVVQTGPRHPPHHVVRWVDPTTLCEELLLPLETSPQSRARLLLTGLHACGDLSVALLKHFCCCPEVVALASVGCCYMKLSDP--GGYPLSQW-VAGLPGYELPYRLREGACHALEEYAERLQKAGPSLRTHCYRAALETVIRCAQPELRRP-------------------------GVQGIPRVHELKIEEYVQRGLQRVGL-DPHLPLNVAALRAHQAQEN----RVVAFFSLALLLAPLVETLILLDRLLYLQEQGFHAELLPIFSPELSPRNLVLVATK 460          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A267GYH5 (Methyltranfer_dom domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006422g2 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.536e-61
Identity = 161/536 (30.04%), Postives = 265/536 (49.44%), Query Frame = 3
Query:  309 FMPLVNSHSNDFIINDLWNKFLPETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIP--------------PNWEIVSND-------------LNVFIQNCAKFSSFKSFINAKDKFF---DEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRR------------------KRFMMQVPSKKRKVNAS----ENLKIGSCRSIARNITSTDTISKILLEE-GFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNN-----------FQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGN---LHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAE-----NGIDAQVLELFDELRSPRRYAIVAIK 1700
            ++PL N+H+NDF+  D+W+  LP+ I   ++ +     ++E +        +  N  +    +W S   + + +   N P              P W   S D             L V  Q+ A+    +   ++ D+        FI + M  KKS+EVE+MS +C  + +   +  +VD+GSGKGYLG+ L +++G  V+E+D++  N  GA+ RR                  KR   +    +++V+AS    ++     C SI+  +     ++ I+ E+ G     + + GLH+CG L+ T+L+ +    +   +V VGCCY+LL E F  +            Q+ +     FPLS + Q     +GRNA+  ASQ+  R+    +   +H +MF+R+LLQ+LL D+LG   DNW+VGKIGK+  D   F  Y R+  ++LG  +L E ++ E I EYE +++H++ R   FF L+C L+  VE  ++ DRL++L E     N    ++  +F    SPR YAIVA K
Sbjct:   18 YLPLPNAHANDFLTLDMWSGMLPDGIASQLDGLSRDRDLIELFQ-------LHRNRLLTDEGHWLSACQSLDGMPSPNPPIDIFPNGQFNKLAAPVWRHTSLDTLARDCAACCLDCLRVAAQSFAELEQHQQASSSTDEASASSTSAFISHAMGIKKSHEVEQMSIICDRLARSRGVDLLVDVGSGKGYLGACLYLAHGQRVLEIDAKPGNTAGAIKRRDNLEEKWRFLQRRAEGNVKRLTPEEYRAEQEVSASTATGDDEAASFCASISAVVRDAQHLADIVAEKCGAKGGPFGLIGLHTCGQLACTLLQFYDQSPNCGLLVNVGCCYNLLTEAFCTSPCEQLQRQQEAAQSIEPPAPGFPLSARLQARRFCIGRNARILASQSPERLADSEDQRQMHRSMFYRVLLQQLLLDQLGRTDDNWVVGKIGKRCPD---FLAYARLGMKRLGLAELSEQISDECIVEYEHRFAHVERRLFRFFLLRCLLAPAVEACILLDRLLWLMERRQQGNSTPPRLCRIFQPKMSPRCYAIVASK 543          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A267DIQ9 (Methyltranfer_dom domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006422g1 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.157e-61
Identity = 160/536 (29.85%), Postives = 266/536 (49.63%), Query Frame = 3
Query:  309 FMPLVNSHSNDFIINDLWNKFLPETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIP--------------PNWEIVSND-------------LNVFIQNCAKFSSFKSFINAKDKFF---DEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRR------------------KRFMMQVPSKKRKVNAS----ENLKIGSCRSIARNITSTDTISKILLEE-GFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNN-----------FQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGN---LHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAE-----NGIDAQVLELFDELRSPRRYAIVAIK 1700
            ++PL N+H+NDF+  D+W+  LP+ I   ++ +     ++E +        +  N  +    +W S   + + +   N P              P W   S D             L V  Q+ A+    +   ++ D+        FI + M  KKS+EVE+MS +C  + +   +  +VD+GSGKGYLG+ L +++G  V+E+D++  N  GA+ RR                  KR   +    +++V+AS    ++     C SI+  +     ++ I++E+ G     + + GLH+CG L+ T+L+ +    +   +V VGCCY+LL E F  +            Q+ +     FPLS + Q     +GRNA+  ASQ+  R+    +   +H +MF+R+LLQ+LL D+LG   DNW+VGKIGK+  D   F  Y R+  ++LG  +L E ++ E I EYE +++H++ R   FF L+C L+  VE  ++ DRL++L E     +    ++  +F    SPR YAIVA K
Sbjct:   18 YLPLPNAHANDFLTLDMWSGMLPDGIASQLDGLSRDRDLIELFQ-------LHRNRLLTDEGHWLSACQSLDGMPSPNPPIDIFPNGQFNKLAAPVWRHTSLDTLARDCAACCLDCLRVAAQSFAELEQHQQTSSSTDEASASSTSAFISHAMGIKKSHEVEQMSIICDRLARSRGVDLLVDVGSGKGYLGACLYLAHGQRVLEIDAKPGNTAGAIKRRDNLEEKWRFLQRRAEGNVKRLTPEEYRAEQEVSASSATGDDEAASFCASISAVVRDAQHLADIVVEKCGAKGGPFGLIGLHTCGQLACTLLQFYDQSPNCGLLVNVGCCYNLLTEAFCTSPCEQLQRQQEAAQSIEPPAPGFPLSARLQARRFCIGRNARILASQSPERLADSEDQRQMHRSMFYRVLLQQLLLDQLGRTDDNWVVGKIGKQCPD---FLAYARLGMKRLGLAELSEQISDECIVEYEHRFAHVERRLFRFFLLRCLLAPAVEACILLDRLLWLMERLQQGDSPPPRLCRIFQPKMSPRCYAIVASK 543          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A1B6E0U3 (Methyltranfer_dom domain-containing protein OS=Clastoptera arizonana OX=38151 GN=g.32747 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 2.512e-54
Identity = 150/503 (29.82%), Postives = 253/503 (50.30%), Query Frame = 3
Query:  261 LMNPINETDFFDFFYSFMPLVNSHSNDFIINDLWNKFLPETIRHLIESIDN---PVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIPPNWEIVSNDLNVFIQNCAKFSSFKSFIN--AKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKV--------NASENLKIGSCRSIARNITSTDTISKILLEEGFSNA--NYLMTGLHSCGGLSSTMLRNFV-DCQDAKAIVLVGCCYHLLNEKF---VNNFQNDQFEVSD--FPLSNQFQKSGIILGRNAKTFASQTVRRVL--RDGNLHPTMFHRILLQKLLNDKLGYVSD-NWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGI-DAQVLELFDELRSPRRYAIVA 1694
            L N INE     F   F+PLVN H  +FI ++L++K +P+ I+  + ++      +  L  +  C NE  V    T        SL                             C      K  ++  ++D F    F  + M+ KK +EVE M  L   I      +++VDIG GKGYL S L++ + L V+ +DS   N  GA+ R K+      S K K         N  E ++  S + +   +  T  + +I+  +   +     +M GLH+CG LS + L+ FV + +   +++ VGCCYHLL E+F     ++  ++  V    FP+SN  Q+    LGRNA+  A+Q+++R+   ++ NL   +FHR+LL++ L  K+GY S   + VG++ KK  D   F++Y + S +KL   ++   ++ EE++++ + + H +  F  FF+++  L+ +VE +++ DR +YL E GI ++ + +LFD   SPR +AI+A
Sbjct:    6 LCNKINE--MIGFIKPFLPLVNCHLVNFITDNLFDKLIPKEIKEEVVAMKTDELKLLFLNNFKHCNNECRVSQLGTYFLKTKMMSLSHN------------------------GGCISLEKLKQILSNKSQDDFKSLPFQGF-MSLKKGHEVEIMCALTTFIANNFKYSHIVDIGGGKGYLSSMLALEHNLKVLSIDSSIVNNQGAIKRTKKLEKAWKSIKNKFPQEDKGKNNIYEPIQSISLKQVTTFVNETTDLIQIVQRQYPHDTCDKVMMVGLHTCGTLSPSSLKLFVNNSKHINSLINVGCCYHLLEEEFEEVSKHWTREEIGVESFGFPMSNYLQEIKFSLGRNARMLAAQSIQRIANEKESNL-DLLFHRVLLEEFLKSKMGYTSLCRFRVGRLAKKTTD---FKDYFKKSIKKLELDEI--KISDEELEQFYVSHLHERELFEKFFFIRVVLAPVVEGIILLDRQLYLHEQGIEESYIAQLFDPYVSPRCHAIIA 475          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A0L8FUD8 (Methyltranfer_dom domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22007650mg PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.153e-51
Identity = 157/541 (29.02%), Postives = 249/541 (46.03%), Query Frame = 3
Query:  288 FFDFFYSFMPLVNSHSNDFIINDLWNKFLPETIRHLIESIDN------PVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIPPNWEIVSNDLNVFIQNC-----AKFSSFKSFINAKDKFF----DEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKV-------------NASENLKI-------GSCRSIARNITST------------------DT-ISKILLEEGFSNAN---------YLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNL-HPTMFHRILLQKLLNDKLGYVSDNWIVG--KIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGI--DAQVLELFDELRSPRRYAIVAIK*I 1706
              DF   ++PLV+SH++DFI  D WN ++P  I+  +  + N      P   +    +      + +++ +    N   L   E K +  N         N+L  FI++       + +   +  + K K+        F+   M+++KS+EV  M+ LC ++C+   I  VVD+GSGKGYLG+ L+ +  L V  +DS + N +GA  R K    Q     +K              N  E+LKI       G C ++ + + +T                  DT I +++ E     AN          L+ GLH+CG L  T LR F     A  +  V CCYHLL E+F  N       +  FP+S+  +K    LG+N K  A Q+V R++    L   ++F R LLQK+  D L     N +    K+ K     ++F +YV+++ +KL      E ++ E ++ Y +KY   K +   F+ +K  L+  +E L+  DR+ YL E     D  +L+LFD + SPR Y IVA+K I
Sbjct:   65 LVDFLTPYLPLVDSHTSDFITKDQWNTYIPAAIQGQLLHLSNDQLLLLPSGAVHWPPQSTQSTTLEDHIPLGIKGNNLRLANLECKTLKWN--------HNNLEEFIKSAHENTLPQLAVLTAIEDLKMKYQLTEDKTPFVKDFMSKQKSHEVAVMAQLCHSLCQHFGICKVVDLGSGKGYLGTQLAFNYNLKVFGIDSADQNTSGANKRAKILKKQWSGLIKKFTINQNSYHNRPVPNEEESLKIQSQNNNSGDCGNLQKFVATTTEKEPRGFYCPFTTYVNSDTNILQLIAEHDKCEANATSQCGSRKLLVAGLHTCGNLCPTALRFFSQNPAAHLLCNVSCCYHLLTEEFDPNGAAQ--SIPGFPVSSILRKMKFHLGQNTKNLACQSVNRIISSSKLIGESLFQRALLQKIFIDTLSMQEQNSLKNSIKLRKLASKCSSFYDYVKMAFQKLDGSS--EKISEEMVQNYLVKYEEDKKKLAAFYQVKSALAPCIEALITLDRIYYLLEQESIKDVSLLQLFDPVTSPRCYGIVAVKKI 593          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: R7UXH0 (Methyltranfer_dom domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_157654 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 3.487e-51
Identity = 148/498 (29.72%), Postives = 238/498 (47.79%), Query Frame = 3
Query:  312 MPLVNSHSNDFIINDLWNKFL-PETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNW--YSLIGTEEKIVDRNIPPNWEIVSNDLNVFIQNCAKFSSFKSFINAKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENLKI--------GSCRS---------IARNITSTDTISKILLE----EGFSN-ANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNN--FQNDQFE--VSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHP--TMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENG--IDAQVLELFDELRSPRRYAIVAIK*I 1706
            MPL+N+H+ DFI  D W   + P     L+   D+ +  L  +     E   +N    N    W  +SL    E      +P               N    +    F + +D +  ++ ++  M +KK +EV  M+ LC ++ K  N   VVDIGSG+GYLG  LS+ + L V+ +DS E N + A  R++R         R     E  K         G  RS         I   +T+   + +++ +    EG +   N+++ GLH+CG L ++++R F    D   +  +GCCYHLL E ++ N   ++D+ +  ++ FPL +        +GRNA+  A+Q++ R + DG   P  ++F R +LQ +L D +GYV  +W VG++  K    + F +Y+R    KL        +  +   EY  KY  L+ + + FF LK   +  +E+L++ DRL +L E     DA ++ LF  + SPR YAIVA K I
Sbjct:    1 MPLINAHNTDFITRDHWECLVHPSIQEELLNLTDDQLARLPAFNS--EEILYYNPAENNCEPVWKHFSLPELREACEHHTLP---------------NLRVLTPLDEFQSTED-YEGKVIVESFMTDKKCHEVHLMAELCFHLAKSSNTQRVVDIGSGRGYLGCHLSLMHNLCVLGIDSSEVNTSSADQRKQRLEKHWQGLLRNSENPERKKGRRRRKSPQGQPRSTPAKSNYVPITHFVTNETDLMQLVTDHFPFEGDAECGNFMLAGLHTCGNLGASIMRLFASNSDLGILCNIGCCYHLLEEDYLRNPHLKHDEPDSPLTGFPLCSYLTGKKAQIGRNARMLAAQSLER-MADGCQLPNISLFWRAVLQVMLRDAVGYVRADWQVGRVASKC---SGFNDYLRRCWDKLQMDS--AKLKDDSADEYLTKYP-LQKQMSAFFLLKALFAPCIESLILLDRLAFLLEQPHIQDAHLVRLFHPVTSPRCYAIVAQKKI 473          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Cavefish
Match: mettl25 (methyltransferase like 25 [Source:NCBI gene;Acc:103026433])

HSP 1 Score: 125.176 bits (313), Expect = 7.013e-30
Identity = 82/229 (35.81%), Postives = 123/229 (53.71%), Query Frame = 3
Query: 1026 NYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLH-PTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIEN-MTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAEN-GID-AQVLELFDELRSPRRYAIVAIK 1700
            + +M GLH+CG L+ + LR FV   + +A+  VGCCYHLL+E+F  +    +  V  FP+S   ++     GRNA+  A   + RV   G L   ++F+R +L  +L D          VG +  K    ++F +YVR + RKL   DL E+ ++  EI+ Y   YS        F  LK  L+  +E L++ DRL YL E   I  + +++LF+ L SPR YA+V IK
Sbjct:  369 DAVMVGLHTCGDLAPSTLRMFVAKPELQAVCSVGCCYHLLSEQFDQDGHECEDGVYGFPMSQYLREQACFCGRNARMSACLALERVSVGGGLPMESLFYRAVLHVILRDHYDAHKSEKRVGNVYSKA---SSFVDYVRRALRKL---DLDESKLSDSEIQSYHDLYSPRMNEMVAFNMLKVTLAPCIEGLILLDRLCYLKEQESISYSALVQLFNPLLSPRCYAVVGIK 591          

HSP 2 Score: 60.8474 bits (146), Expect = 2.713e-9
Identity = 48/198 (24.24%), Postives = 83/198 (41.92%), Query Frame = 3
Query:  297 FFYSFMPLVNSHSNDFIINDLWNKFLPETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRN--IPPNWEIVSNDLNVFIQNCAKFSSFKSFINAKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            F    + + N+H+ DF    +W  F+  +   ++ ++ +      +     +E+  F N+T               K+VD    +          L VF+Q  A   + +      +     +  D  MN KK++EV  MS +  ++ K   +  V+D+GSGKGYL S LS+   L V  +D    N  GA  R ++ 
Sbjct:   21 FLSVSLSIANAHTVDFYTRGVWGLFMAVSPEEVLRAVSSAADRAGESEVSEDESFGFCNIT--------------RKLVDVEALLRATRAHSLPGLGVFVQREAVLETLREMCAEDETCSKPLVPDEFMNSKKAHEVPAMSEVVASLAKCCGVKQVIDVGSGKGYLCSFLSMQYDLQVFGIDCSSINTHGAQERNRKL 204          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Cavefish
Match: rrnad1 (ribosomal RNA adenine dimethylase domain containing 1 [Source:NCBI gene;Acc:103041864])

HSP 1 Score: 95.5153 bits (236), Expect = 2.605e-20
Identity = 72/267 (26.97%), Postives = 130/267 (48.69%), Query Frame = 3
Query:  966 NITSTDTISKI-LLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEK--------FVNNFQNDQFEVSD----FPLSNQFQK-SGIILGRNAKTFASQT----VRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDEN--NFEEYVRISCRKLGF-VDL-IENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
             +TST T  ++    +   ++++++TGLH+CG LS+T+LR+FV+C   + I  V CCY  +  K          +   +   EVS     +P+S   +   G  L   A+  A       ++R+  +  L  T  +R  L+ ++  +  ++    I     + IK  +  +F EY R+   ++G   DL  + +  E + E +        R   +F L   L+ +VE LV+ DR+++L E G  ++++ LFD   SPR + +VA+K
Sbjct:  344 ELTSTSTPEEVHSFTQRTKSSDFVLTGLHACGDLSATLLRHFVNCPHVQGITSVACCYMKITTKENPNPPGLVSSPLSDTSEEVSQSDYGYPMSEWVRGLPGHELSYKAREGACHAMEDYLQRLREESGLLKTHCYRATLETIIRAERPHLCRAGI-----QTIKKAHTLSFSEYARLGLPRVGLPADLPFDQVCVERMLEQQ-------GRVVVYFSLALLLAPVVETLVLLDRMLFLQERGFQSRLVPLFDPALSPRNFVLVAVK 598          

HSP 2 Score: 50.447 bits (119), Expect = 3.987e-6
Identity = 27/105 (25.71%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  630 NAKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENLKIG 944
            +++      IF  + +  KK +E+ K+  L + +C +   +NVVD+GSG+G+L   LS   GL+V  +++  +  + A     + ++ +  + ++   S  L IG
Sbjct:  122 SSQSALLAHIFRKH-VKPKKQHEIRKLGMLVKQLCDQTQCSNVVDVGSGQGHLTRFLSFGLGLDVTGIEADPNLVSMASKFDGQLLLTLAKENQRTGTSPLLAIG 225          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Sea Lamprey
Match: mettl25 (methyltransferase like 25 [Source:ZFIN;Acc:ZDB-GENE-041210-90])

HSP 1 Score: 100.523 bits (249), Expect = 1.338e-22
Identity = 66/230 (28.70%), Postives = 112/230 (48.70%), Query Frame = 3
Query: 1032 LMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVN----NFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRD-GNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGI--DAQVLELFDELRSPRRYAIVAIK 1700
            L+ GLH+CG L++T +R F      + +  V C   L      +    +F+ND      FP+S+  +     +GRN++  A     RV    G L  ++F+R +LQ L+ D  G +S      ++GK      +F +Y R + +KL   D    ++  +I++Y  K+         F  LK  L+  +E +++ DRL +L E      A ++++F  L SPR YA+VA +
Sbjct:  338 LLVGLHTCGDLAATTMRLFAGRAALRGVCTVACVLQLQASPQHHWDGEHFKNDGSRAYGFPMSDHLKSLHCTIGRNSRMSACLAPERVTSGKGLLTESLFYRAVLQVLIEDHYGSLSST---KRVGKTYGKSTSFLDYTRKALQKLELDD--SKLSDADIQDYYSKFLPRLPEMEAFNMLKVILAPCIEGIILMDRLCFLLEQDCVSQAALVQMFHPLTSPRCYALVATR 562          

HSP 2 Score: 64.3142 bits (155), Expect = 3.456e-11
Identity = 52/203 (25.62%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  297 FFYSFMPLVNSHSNDFIINDLWNKFL----PETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEE---KIVDRNIPPNWEIVSNDLNVFIQNCAKFSSFKSFINAKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            F    + +  +H+ +F    LW  +L    P+T++ L+ +   P   L      C ++    N T+       +++  E    +     +P         L + +     F+  +  +    +   EI  D+ M+ KKS+EVE MS +   +  + N++ V+D+GSGKGYL S LS+  GL V  +DS   N  GA  R ++ 
Sbjct:    1 FVSRHLSVSEAHTVEFYSRGLWRSYLGDAEPQTVQLLLIAAPAPTSTL-----TCFQS---ENTTLGIGGTSSAVMDIEHFLHEAQSHTLP--------GLGICVSTDEAFTMLRILLK-DTRVTVEIPEDF-MSTKKSHEVELMSRMVVTLALKCNVSQVIDLGSGKGYLSSYLSMQFGLRVFGIDSSAVNTRGAAERNRKL 185          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Nematostella
Match: EDO48903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHS3])

HSP 1 Score: 133.265 bits (334), Expect = 1.902e-33
Identity = 78/230 (33.91%), Postives = 122/230 (53.04%), Query Frame = 3
Query: 1017 SNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHP-TMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGI-DAQVLELFDELRSPRRYAIVAIK 1700
            ++   ++ GLH+CG L+ T ++ F+  +  KA+ LVGCCYHLL++    + Q        FP+S   Q+    L RNA   A Q   ++     L P ++F+R +LQ +L +K    +    VG+IG K K    F EYV+    KLG       +T  EI+ Y  ++   +     F  L+  ++  +E+L I DRL ++ E G  D+ V+ LFD ++SPR YAI+A K
Sbjct:  279 TDPRLVLVGLHTCGDLAPTAIKLFIGDESVKALCLVGCCYHLLSQAGSGDIQGGD---PGFPMSEYLQREKFTLSRNATMVAQQAADKIATLSKLPPKSVFYRAVLQVILKEKFQLDTRGQHVGRIGSKCK---TFHEYVKKGLSKLGLP--FHKITDLEIEMYYERFQPEEKHILAFHQLRASMAPSIESLFIIDRLCFMKEQGFHDSSVVCLFDPVKSPRCYAIIANK 500          

HSP 2 Score: 66.2402 bits (160), Expect = 1.637e-11
Identity = 59/244 (24.18%), Postives = 96/244 (39.34%), Query Frame = 3
Query:  297 FFYSFMPLVNSHSNDFIINDLWNKFLPETIRHLIESIDNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIPPNWEIVSNDLNVFIQNCAKFSSFKS-----------FINAKDKFFDE--IFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTI 989
            +  S   ++++H+ DF   +LW K LPE +R                          N+L + T      L             P+  +  +D N    +C++   F +           F+  +    D       Y M  KKS+EV  M+ +   I  +     V+D+GSGKGYL   L++  GL V  +DS++ N   A+ R  + +  +  + RK N S N+   S     R  T + TI
Sbjct:    2 YLESKREIIDAHNVDFFTQNLWEKCLPEGLR--------------------------NDLDLLTQEELSRL-------------PSLYLYDDDENYEDSSCSELRKFLTEARSVQLSGIEFVRTRRGMGDGDLQMPLYMMTPKKSHEVSVMAHVVNQIASQVKAEKVLDLGSGKGYLSQALALDYGLTVTGVDSKDMNTQNAVKRSMKLLKALQGRMRKENKSHNMADDSS---GRKDTKSATI 203          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Nematostella
Match: EDO31622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXF2])

HSP 1 Score: 72.0182 bits (175), Expect = 3.385e-13
Identity = 47/159 (29.56%), Postives = 75/159 (47.17%), Query Frame = 3
Query:  759 VDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVPSKKRKVNASENL----------KIGSCRSIARNITSTDTISKIL--LEEGFSN------ANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQ 1181
            +D+G+G G+L   +++  GL V+ L++   +K G   R  R       K+ +   SE L          + G  RS  R IT   T  + L  L   F+        ++++ GLH CG L  TMLR F  C  A  +V+  CCYH ++ K  +N+ + +
Sbjct:  220 LDVGAGLGHLSRVMAMEYGLRVVSLEADGCHK-GEAERLDRKAEASKKKQTQTIGSETLPQHVTFKVSQEGGVARSNPRKITQDITTEEFLDVLTRCFAGDDSPKCPDFILVGLHPCGDLVPTMLRVFAKCDQAVGLVMASCCYHKMDVKPCHNYSSSE 377          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Medaka
Match: mettl25 (methyltransferase like 25 [Source:NCBI gene;Acc:101155244])

HSP 1 Score: 109.383 bits (272), Expect = 7.570e-25
Identity = 82/255 (32.16%), Postives = 122/255 (47.84%), Query Frame = 3
Query:  867 NRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTISKILLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVNNFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRV-LRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSE-EIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAEN 1625
             RRKR  ++  ++ R+  AS+         +   +TS  T    L E      + +M GLH+CG L+ + LR FV   +  A+  VGCCYHLL+E+F             FPLS          GRNA+  A   + RV L  G    ++F+R +L  +L D  G    +  VG +  K K   +F +YVR + RKL   +L E+  S+ +I++Y  KY         F  LK  ++  +E L++ DRL YL E 
Sbjct:  316 ERRKRENVERKAQSRRDGASD---------VFSPLTSYVTAETELRELITELEDAVMVGLHTCGNLAPSTLRMFVAKPELAAVCSVGCCYHLLSEEFDPAGPESLDRSCGFPLSQYLHDRSCFCGRNARMSACLALERVSLGQGIQMESLFYRAVLHVILRDHYGSYKSDRRVGNVYSKAK---SFLDYVRRALRKL---ELDESKLSDNDIQDYHDKYRPRMAEMHAFNMLKVTIAPCIEGLILLDRLCYLKEQ 555          

HSP 2 Score: 72.4034 bits (176), Expect = 5.097e-13
Identity = 50/206 (24.27%), Postives = 94/206 (45.63%), Query Frame = 3
Query:  285 DFFDFFYSFMPLVNSHSNDFIINDLWNKFLPETIRHLIESI-DNPVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEE--KIVDRNIPPNWEIVSNDLNVFIQ---NCAKFSSFKSFINAKDKFFDEIFIDYEMNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRF 884
            +   F    +P+ N+H+ +F   D+W +F+  +   ++ ++  N    +E   +    +        ++N     L+ T E  +    +  P  E+  +  +  ++   N +K +     +        E+  D  MN KKS+EV+ MS +   + +   +  V+D+GSGKGYL S LS+  GL V  +DS  +N  GA  R ++ 
Sbjct:   17 EVMQFLSVTLPIANAHTVEFYTQDVWKRFMAVSPEEVLSAVTPNSDRKMEPERRRTEPSGTMFGFCSHSN----RLLDTHEFLQGAKAHSLPGLEVCMSRSDFLLELQGNWSKSTVLPGIVT-------ELEADEFMNSKKSHEVQSMSEVVAGLARHSGVKQVIDVGSGKGYLSSFLSLQYGLQVYGIDSSSTNTHGAQERNRKL 211          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000025783.1 (SMESG000025783.1)

HSP 1 Score: 262.692 bits (670), Expect = 7.849e-86
Identity = 129/130 (99.23%), Postives = 129/130 (99.23%), Query Frame = 3
Query: 1311 MFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            MFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVI DRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK
Sbjct:    1 MFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVILDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 130          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000025782.1 (SMESG000025782.1)

HSP 1 Score: 155.992 bits (393), Expect = 1.209e-45
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVP 899
            MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVP
Sbjct:    1 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVP 75          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000025782.1 (SMESG000025782.1)

HSP 1 Score: 155.606 bits (392), Expect = 1.386e-45
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 3
Query:  675 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVP 899
            MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVP
Sbjct:    1 MNEKKSYEVEKMSCLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGALNRRKRFMMQVP 75          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000022890.1 (SMESG000022890.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.426e-8
Identity = 65/259 (25.10%), Postives = 109/259 (42.08%), Query Frame = 3
Query:  963 RNITSTDTISKILLEEGFSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFV------------NNFQNDQFEVSDFPLSNQFQKSGIILGRNA-KTFASQTVRRVLRDGNLHPTMFHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFVDLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIYLAENGIDAQVLELFDELRSPRRYAIVAIK 1700
            +NI S D    ++ ++    + YL+ GLH CG L+ TM+  F    +  A+VL  CCYH + +                N      E +   L    +K  +   +N+ K F SQ  R  +++   +  M ++I   KL               K   +   E+ F  Y     +K     +   +  + +    IKY  ++     F  L+  +   +E L++ DR++YL EN I+A + ++F    SPR  AIVA K
Sbjct:    2 KNIDS-DWWDSVMEDDQNEKSQYLLNGLHCCGELAPTMIDMFCRLPNCTAMVLTSCCYHKMKDDSQPMSSVCKTLMSGRNLTYVTLESACHFLFEYKEKLKLAAKQNSNKVFESQIFRATVQEITSNRQMTNKIYKNKLK------------AKKYPTEYSAEDRFNLYCLDFFKKCDIFPIDLTLEEQRMANQRIKYDWMQVVI--FHCLRLTIGPAIETLLLLDRMLYLRENNIEANIYQIFQPSLSPRNSAIVARK 245          
The following BLAST results are available for this feature:
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
METTL254.057e-3036.12methyltransferase like 25 [Source:HGNC Symbol;Acc:... [more]
RRNAD17.212e-1626.36ribosomal RNA adenine dimethylase domain containin... [more]
METTL252.380e-1537.84methyltransferase like 25 [Source:HGNC Symbol;Acc:... [more]
METTL253.712e-1124.89methyltransferase like 25 [Source:HGNC Symbol;Acc:... [more]
METTL254.680e-1147.14methyltransferase like 25 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F25H2.123.022e-2527.07pep chromosome:WBcel235:I:10570079:10571904:1 gene... [more]
F25H2.123.452e-2527.07pep chromosome:WBcel235:I:10570079:10571916:1 gene... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG339645.616e-3527.64gene:FBgn0053964 transcript:FBtr0100005[more]
CG29069.133e-1923.12gene:FBgn0033240 transcript:FBtr0113052[more]
CG29061.320e-1823.16gene:FBgn0033240 transcript:FBtr0305126[more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mettl251.362e-3136.52methyltransferase like 25 [Source:ZFIN;Acc:ZDB-GEN... [more]
rrnad17.936e-1928.29ribosomal RNA adenine dimethylase domain containin... [more]
rrnad18.335e-1928.29ribosomal RNA adenine dimethylase domain containin... [more]
rrnad12.886e-1627.20ribosomal RNA adenine dimethylase domain containin... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
METTL251.063e-2538.05methyltransferase like 25 [Source:NCBI gene;Acc:77... [more]
rrnad11.075e-1427.62ribosomal RNA adenine dimethylase domain containin... [more]
rrnad11.274e-1427.62ribosomal RNA adenine dimethylase domain containin... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Mettl251.446e-3138.43methyltransferase like 25 [Source:MGI Symbol;Acc:M... [more]
Rrnad15.989e-2124.18ribosomal RNA adenine dimethylase domain containin... [more]
Rrnad16.231e-2123.96ribosomal RNA adenine dimethylase domain containin... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NXH8|MET25_MOUSE9.914e-3138.43Methyltransferase-like protein 25 OS=Mus musculus ... [more]
sp|Q8N6Q8|MET25_HUMAN1.948e-2936.12Methyltransferase-like protein 25 OS=Homo sapiens ... [more]
sp|Q8BZG5|RRNAD_MOUSE3.982e-2023.96Protein RRNAD1 OS=Mus musculus OX=10090 GN=Rrnad1 ... [more]
sp|Q6AYG0|RRNAD_RAT1.397e-1926.36Protein RRNAD1 OS=Rattus norvegicus OX=10116 GN=Rr... [more]
sp|Q5E9V4|RRNAD_BOVIN1.435e-1525.27Protein RRNAD1 OS=Bos taurus OX=9913 GN=RRNAD1 PE=... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GYH51.536e-6130.04Methyltranfer_dom domain-containing protein OS=Mac... [more]
A0A267DIQ96.157e-6129.85Methyltranfer_dom domain-containing protein OS=Mac... [more]
A0A1B6E0U32.512e-5429.82Methyltranfer_dom domain-containing protein OS=Cla... [more]
A0A0L8FUD82.153e-5129.02Methyltranfer_dom domain-containing protein OS=Oct... [more]
R7UXH03.487e-5129.72Methyltranfer_dom domain-containing protein OS=Cap... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mettl257.013e-3035.81methyltransferase like 25 [Source:NCBI gene;Acc:10... [more]
rrnad12.605e-2026.97ribosomal RNA adenine dimethylase domain containin... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl251.338e-2228.70methyltransferase like 25 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO489031.902e-3333.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316223.385e-1329.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl257.570e-2532.16methyltransferase like 25 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000025783.17.849e-8699.23SMESG000025783.1[more]
SMESG000025782.11.209e-45100.00SMESG000025782.1[more]
SMESG000025782.11.386e-45100.00SMESG000025782.1[more]
SMESG000022890.11.426e-825.10SMESG000022890.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013444 ID=SMED30013444|Name=Methyltranfer_dom domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1730bp
TATTTGAAACATAAACAAAATTTTTTCAATTTGAGTTAAATGAATATACA
GTTCTTGGTAAGGTTATTAATAATTCGAAAAAATTATCAAAAATTACTAA
AACCACAATTATTTGTTTAAAAAGAAATCAAAGGTTTACTTTTTTTATTC
AATATTTTAAAAATACCACATTTTCAAACATAAAAACGTTTATTGTGGCT
GAAACAGAACAAGTTGATCCAATATTCGATTAATTTACAATTCTAGAGGA
ATATTTAATTTTAATGAACCCGATAAATGAAACGGATTTTTTTGATTTTT
TTTATAGTTTTATGCCTTTAGTAAATTCTCATTCAAACGATTTTATCATC
AATGATTTGTGGAACAAATTTTTGCCCGAAACAATTCGTCATTTAATTGA
GTCAATTGATAATCCAGTGTACATATTGGAACAATATGTGAAATGTTGTA
ATGAAGCACCTGTATTTAATAATTTAACTGTAAATACTAATTGCAATTGG
TATTCTTTGATAGGTACAGAAGAAAAAATAGTTGATAGAAATATACCACC
TAATTGGGAAATAGTTTCCAATGATCTTAATGTTTTCATTCAAAACTGTG
CCAAATTTTCTTCTTTCAAGTCATTTATAAATGCAAAAGATAAGTTTTTC
GATGAAATTTTTATTGATTATGAGATGAATGAAAAGAAATCATATGAAGT
GGAAAAAATGAGCTGCCTATGTCGCAATATTTGTAAAGAACACAATATTG
CTAACGTGGTAGATATTGGGAGTGGAAAAGGATATCTAGGTTCAGATTTG
TCAATATCAAATGGATTAAATGTAATAGAATTAGATTCAAGAGAATCAAA
TAAAACTGGTGCTCTGAATAGGCGTAAGAGATTTATGATGCAAGTTCCAA
GTAAGAAGAGAAAAGTAAATGCTTCTGAAAATCTAAAAATTGGAAGTTGT
AGAAGTATTGCTCGTAATATAACATCAACTGATACCATTAGCAAAATTTT
GTTAGAAGAAGGATTTTCAAATGCCAACTATTTGATGACAGGTTTACACA
GTTGCGGTGGATTGTCATCTACGATGTTGAGGAATTTTGTTGATTGCCAG
GATGCCAAAGCAATTGTGCTCGTTGGTTGTTGTTATCATTTGTTGAATGA
GAAATTCGTCAATAACTTCCAGAATGATCAATTTGAGGTTTCAGATTTTC
CGCTGAGTAATCAATTTCAAAAATCGGGTATTATTTTAGGTAGAAACGCA
AAAACATTCGCTAGTCAGACTGTAAGAAGAGTCCTACGCGACGGAAATCT
GCATCCAACAATGTTTCATAGGATACTTCTCCAGAAATTATTGAATGATA
AATTAGGCTACGTTTCTGATAATTGGATAGTTGGTAAAATAGGTAAAAAG
ATAAAAGATGAAAATAATTTCGAAGAATATGTTCGAATATCCTGTCGAAA
ATTAGGATTTGTGGATTTGATAGAAAATATGACAAGCGAGGAAATCAAGG
AATATGAAATCAAATATTCCCATTTAAAGTTTCGATTTACAAATTTCTTT
TATTTGAAATGCTGCTTGTCAGCAATCGTGGAAAATCTGGTAATTTGGGA
TCGATTGATTTATTTGGCGGAGAATGGAATCGATGCTCAAGTTTTGGAGT
TATTCGATGAATTGAGGTCGCCACGGAGATACGCTATAGTTGCCATTAAA
TGAATAAATTTGACTTATTGATTTCATTAG
back to top

protein sequence of SMED30013444-orf-1

>SMED30013444-orf-1 ID=SMED30013444-orf-1|Name=SMED30013444-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=480bp
MNPINETDFFDFFYSFMPLVNSHSNDFIINDLWNKFLPETIRHLIESIDN
PVYILEQYVKCCNEAPVFNNLTVNTNCNWYSLIGTEEKIVDRNIPPNWEI
VSNDLNVFIQNCAKFSSFKSFINAKDKFFDEIFIDYEMNEKKSYEVEKMS
CLCRNICKEHNIANVVDIGSGKGYLGSDLSISNGLNVIELDSRESNKTGA
LNRRKRFMMQVPSKKRKVNASENLKIGSCRSIARNITSTDTISKILLEEG
FSNANYLMTGLHSCGGLSSTMLRNFVDCQDAKAIVLVGCCYHLLNEKFVN
NFQNDQFEVSDFPLSNQFQKSGIILGRNAKTFASQTVRRVLRDGNLHPTM
FHRILLQKLLNDKLGYVSDNWIVGKIGKKIKDENNFEEYVRISCRKLGFV
DLIENMTSEEIKEYEIKYSHLKFRFTNFFYLKCCLSAIVENLVIWDRLIY
LAENGIDAQVLELFDELRSPRRYAIVAIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006506GPI anchor biosynthetic process
GO:0032259methylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR025714Methyltranfer_dom
IPR000048IQ_motif_EF-hand-BS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025714Methyltransferase domainPFAMPF13679Methyltransf_32coord: 141..296
e-value: 1.5E-26
score: 93.3
NoneNo IPR availablePANTHERPTHR12496:SF0METHYLTRANSFERASE-LIKE PROTEIN 25coord: 8..479
NoneNo IPR availablePANTHERPTHR12496CGI-41 METHYLTRANSFERASEcoord: 8..479