WD repeat domain 78

Overview
NameWD repeat domain 78
Smed IDSMED30013441
Uniprot Best hitWD repeat-containing protein 78 OS=Homo sapiens OX=9606 GN=WDR78 PE=2 SV=1 (E=1.66298e-153)
Length (bp)2597
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat domain 78 (SMED30013441) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat domain 78 (SMED30013441) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat domain 78 (SMED30013441) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat domain 78 (SMED30013441) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013441

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013441SMESG000047563.1 SmedASXL_012704SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013441SMESG000047563.1 dd_Smed_v4_8721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013441SMESG000047563.1 dd_Smed_v4_8721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013441SMESG000047563.1 dd_Smed_v4_8721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013441SMESG000047563.1 dd_Smed_v4_8721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013441SMESG000047563.1 dd_Smed_v6_8721_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013441SMESG000047563.1 dd_Smed_v4_8721_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013441SMESG000047563.1 dd_Smed_v4_8721_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat domain 78 vs. Ensembl Human
Match: WDR78 (WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:26252])

HSP 1 Score: 474.937 bits (1221), Expect = 3.463e-154
Identity = 267/663 (40.27%), Postives = 384/663 (57.92%), Query Frame = 1
Query:  490 LNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEE-HSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRI--ATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMP 2469
            L  +T+++ I+     I+  E+L+K ++I+L ETET+  FD+  ++ + + +++ ++ ++NK YE+L  +R GND Y+ER M TF  A  +K +Q ++I   D G M+T WD++D Y  M+                + S   + VE  SK    P   D  +P  T  K                    NS++      ++ + A    D +  ++ IL S++     F MER L  N +  K+  YR LP  KE   E     +++   E+   ES K +  E  A     P       +LE LW +    TKG NV++ AWN+ NPD+LAV YG F +  QK GL CCWS+KN  +PER ++ P G TA+ +S    NLLA+G  NGTI++++VR  S+  V+D+  +  +HLGPV QL+W+ +  G + +   E+L+SIS+DGR+++W +RKG +       +DLM+LKR   A+   G  K+KK +ALIS+ A G CFAF+PKD NIYLAG EEGHIHKCSCSYNEQYLD + GH  PVY + W+PF +DVFLSCSADW + +W  E   P ++F  A   V  +AWSPKSS IFA  NE  VE+W+L +STLDPLIV    P     T++ F +  +CL+VGDSDG +  + LRNMP
Sbjct:  210 LTSFTDLQVIRAAPEKIVTKEDLEKNIEIILTETETLRFFDLPTVMVSVESEEAEKVTQRNKNYEVLCRNRLGNDLYVERMMQTFNGAPKNKDVQCDKIIMEDKGIMSTAWDLYDSYNAMELV--------------SLSVKQSVVESSSKANVLPKDQDQRLPGSTTEK--------------------NSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLFFMERVLMENIFQPKLAAYRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPA------NLERLWSFSCDLTKGLNVSSLAWNKTNPDLLAVGYGHFGFKEQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGTIAIYNVRSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDC------YDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNIYLAGTEEGHIHKCSCSYNEQYLDTYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANENRVEIWDLHISTLDPLIVNTANPGIK-FTTILFAKQTDCLLVGDSDGQVSVYELRNMP 825          
BLAST of WD repeat domain 78 vs. Ensembl Human
Match: WDR78 (WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:26252])

HSP 1 Score: 380.948 bits (977), Expect = 2.130e-121
Identity = 233/637 (36.58%), Postives = 341/637 (53.53%), Query Frame = 1
Query:  568 VDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRS-EEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRI--ATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMP 2469
            ++I+L ETET+  FD+  ++ + + +++ ++ ++NK YE+L  +R GND Y+ER M TF  A  +K +Q ++I   D G M+T WD++D Y  M+                + S   + VE  SK    P   D  +P  T  K                    NS++      ++ + A    D +  ++ IL S++     F MER L  N +  K+  YR LP  KE   E     +++   E+   ES K +  E  A     P       +LE LW +    TKG NV++ AWN+ NPD+LAV YG F +  QK GL CCWS+KN  +PER ++ P G TA+ +S    NLLA+G  NGTI++++VR  S+  V+D+  +  +HLGPV QL+W+ +  G + +   E+L+SIS+DGR+++W +RKG +       +DLM+LKR   A+   G  K+KK +ALIS+ A G CFAF+PK                                  PVY + W+PF +DVFLSCSADW + +W  E   P ++F  A   V  +AWSPKSS IFA  NE  VE+W+L +STLDPLIV    P     T++ F +  +CL+VGDSDG +  + LRNMP
Sbjct:    2 IEIILTETETLRFFDLPTVMVSVESEEAEKVTQRNKNYEVLCRNRLGNDLYVERMMQTFNGAPKNKDVQCDKIIMEDKGIMSTAWDLYDSYNAMELV--------------SLSVKQSVVESSSKANVLPKDQDQRLPGSTTEK--------------------NSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLFFMERVLMENIFQPKLAAYRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPA------NLERLWSFSCDLTKGLNVSSLAWNKTNPDLLAVGYGHFGFKEQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGTIAIYNVRSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDC------YDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPK---------------------------------GPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANENRVEIWDLHISTLDPLIVNTANPGIK-FTTILFAKQTDCLLVGDSDGQVSVYELRNMP 558          
BLAST of WD repeat domain 78 vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 199.904 bits (507), Expect = 1.705e-53
Identity = 112/369 (30.35%), Postives = 188/369 (50.95%), Query Frame = 1
Query: 1396 LEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACV-NEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQ 2487
            L PLWK+     K  +V A  WN +  D+ AV YG +D+  Q  G++  +SLKN  +PE  F   SG   +     H  L+A+G ++G +++++++K   +    +   SG+H  PV Q++W         + +    S+SSDGR+  W++ K         H D++KLK     + G+  +      +     G+ F F+ +   ++L G EEG I+KCS SY+ Q+LD +  H   V  + W+P+   VF+SCS+DWT+K+W    + P+  +     +V  +AW+P SS +FA V  +G   +++L ++  + +  + +  +   LT V F      +IVGD  G + +      LR MP   K Q
Sbjct:  323 LLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKW----QKDDMDQNLNFFSVSSDGRIVSWTLVK-----RKLVHIDVIKLK-----VEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIY-DLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQ 676          
BLAST of WD repeat domain 78 vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 199.904 bits (507), Expect = 1.761e-53
Identity = 112/369 (30.35%), Postives = 188/369 (50.95%), Query Frame = 1
Query: 1396 LEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACV-NEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQ 2487
            L PLWK+     K  +V A  WN +  D+ AV YG +D+  Q  G++  +SLKN  +PE  F   SG   +     H  L+A+G ++G +++++++K   +    +   SG+H  PV Q++W         + +    S+SSDGR+  W++ K         H D++KLK     + G+  +      +     G+ F F+ +   ++L G EEG I+KCS SY+ Q+LD +  H   V  + W+P+   VF+SCS+DWT+K+W    + P+  +     +V  +AW+P SS +FA V  +G   +++L ++  + +  + +  +   LT V F      +IVGD  G + +      LR MP   K Q
Sbjct:  319 LLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKW----QKDDMDQNLNFFSVSSDGRIVSWTLVK-----RKLVHIDVIKLK-----VEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIY-DLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQ 672          
BLAST of WD repeat domain 78 vs. Ensembl Human
Match: WDR78 (WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:26252])

HSP 1 Score: 162.925 bits (411), Expect = 8.569e-42
Identity = 112/356 (31.46%), Postives = 176/356 (49.44%), Query Frame = 1
Query:  490 LNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKN 1557
            L  +T+++ I+     I+  E+L+K ++I+L ETET+  FD+  ++ + + +++ ++ ++NK YE+L  +R GND Y+ER M TF  A  +K +Q ++I   D G M+T WD++D Y  M+               ++ S   + VE  SK    P   D  +P  T  K                    NS++      ++ + A    D +  ++ IL S++     F MER L  N +  K+  YR LP  KE   E     +++   E+   ES K +  E  A     P       +LE LW +    TKG NV++ AWN+ NPD+LAV YG F +  QK GL CCWS+KN
Sbjct:  210 LTSFTDLQVIRAAPEKIVTKEDLEKNIEIILTETETLRFFDLPTVMVSVESEEAEKVTQRNKNYEVLCRNRLGNDLYVERMMQTFNGAPKNKDVQCDKIIMEDKGIMSTAWDLYDSYNAME--------------LVSLSVKQSVVESSSKANVLPKDQDQRLPGSTTEK--------------------NSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLFFMERVLMENIFQPKLAAYRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPA------NLERLWSFSCDLTKGLNVSSLAWNKTNPDLLAVGYGHFGFKEQKRGLACCWSIKN 525          
BLAST of WD repeat domain 78 vs. Ensembl Celegans
Match: dyci-1 (DYnein Chain, light Intermediate [Source:UniProtKB/TrEMBL;Acc:O45087])

HSP 1 Score: 103.605 bits (257), Expect = 1.684e-22
Identity = 90/360 (25.00%), Postives = 162/360 (45.00%), Query Frame = 1
Query: 1423 SFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDY-PERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGR-HLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDN----FFGHTAPVYGIKWSPF-----MNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPL--IVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALR 2460
            ++T  R V   A++   PD+LAV YG  D  N+ PG++  W+ K+     E      S   ++++++ H++LL  G  +G I V+D R  S +  ++    + + H   V  L     V G    H+   +S+S DGR+  W+V    +                    P  GK+  T     + AS +  +F   +   ++ G + G I   S +  +  +      + GH+  + GI++         + +F+S S DWT+KLW  +  N   +F+S    V  +AWSP    +FA ++ +G + VWNL      P+  +      E   +  + ++  G+ + VGD +G +H + +R
Sbjct:  279 TWTAKRLVTGMAFSEHYPDLLAVSYGPCDIPNEPPGVIVVWNTKSKRMTAEFIVYCQSEIQSVAFARFHAHLLLAGCESGQICVWDNRLTSRKLPINRSPLTTQAHTYTVSCLA----VVGTKNAHN--FVSLSRDGRICSWNVDNLTQ--------------------PVDGKELMTKE--GKAASATRMSFPIGEMQTFVVGTDTGEILAASRNGADPAVIKTDVCYKGHSGTLTGIEFHRASGVVDFSHLFISSSHDWTVKLWSTKDANLKFSFESHPDLVLDVAWSPVHPAVFASIDADGNIFVWNLNEDVEGPVARLRAGAEGESVYMNRLIWSPDGKHVFVGDDEGRVHMYDVR 610          
BLAST of WD repeat domain 78 vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 53.5286 bits (127), Expect = 5.615e-7
Identity = 28/83 (33.73%), Postives = 41/83 (49.40%), Query Frame = 1
Query: 2095 GHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQ-------NPVINFQSAVKSVNSIAWSP-KSSVIFACVNEGAVEVWNL 2319
             H AP   + WSPF ++V  SCS D T K+W I  +        P +      K VN+IAW P  ++V+     E  + +WN+
Sbjct:   77 AHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNRNLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNV 159          
BLAST of WD repeat domain 78 vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 53.5286 bits (127), Expect = 5.771e-7
Identity = 28/83 (33.73%), Postives = 41/83 (49.40%), Query Frame = 1
Query: 2095 GHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQ-------NPVINFQSAVKSVNSIAWSP-KSSVIFACVNEGAVEVWNL 2319
             H AP   + WSPF ++V  SCS D T K+W I  +        P +      K VN+IAW P  ++V+     E  + +WN+
Sbjct:   77 AHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNRNLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNV 159          
BLAST of WD repeat domain 78 vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 53.5286 bits (127), Expect = 5.771e-7
Identity = 28/83 (33.73%), Postives = 41/83 (49.40%), Query Frame = 1
Query: 2095 GHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQ-------NPVINFQSAVKSVNSIAWSP-KSSVIFACVNEGAVEVWNL 2319
             H AP   + WSPF ++V  SCS D T K+W I  +        P +      K VN+IAW P  ++V+     E  + +WN+
Sbjct:   77 AHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNRNLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNV 159          
BLAST of WD repeat domain 78 vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 53.1434 bits (126), Expect = 6.973e-7
Identity = 28/83 (33.73%), Postives = 41/83 (49.40%), Query Frame = 1
Query: 2095 GHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQ-------NPVINFQSAVKSVNSIAWSP-KSSVIFACVNEGAVEVWNL 2319
             H AP   + WSPF ++V  SCS D T K+W I  +        P +      K VN+IAW P  ++V+     E  + +WN+
Sbjct:   77 AHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNRNLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNV 159          
BLAST of WD repeat domain 78 vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0342788)

HSP 1 Score: 192.971 bits (489), Expect = 3.838e-51
Identity = 115/389 (29.56%), Postives = 196/389 (50.39%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQ-KPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEV-LISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACV-NEGAVEVWNLQLSTLDPLIVENICPEY-TVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQTEALDKTIQ 2514
            EF   + +L PLWK+    TK  NV    +N    D+ AVC+G  D+  Q   G +C +++KN  +P+   +   G        T+  L  IG+++G ++V+++R+   E +  ++  + +H   V Q++W     G      EV   S+SSDGRV  W + +        +   ++ L R    + G    K     ++  + GSC  F+P D  I+L G E G+I+KCS +++ +YL  ++ H   VY I ++ F +++F+SC ADW +K+W   R +P+  F     +V  + W+P SS +FA V  EG V V++L ++    + ++ + P+    LT ++F E    ++VGD  G+  +      LR M   PK Q      T+Q
Sbjct:  338 EFREGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNCKHGECVWQIKW-----GLDMADGEVNFFSVSSDGRVFNWILMQN-----KLWVTTIITLYRENGLVDGPDGTK-----VTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFSSKYLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGA-AVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQLYLDQNTLQ 710          
BLAST of WD repeat domain 78 vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0071521)

HSP 1 Score: 192.586 bits (488), Expect = 4.411e-51
Identity = 115/389 (29.56%), Postives = 196/389 (50.39%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQ-KPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEV-LISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACV-NEGAVEVWNLQLSTLDPLIVENICPEY-TVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQTEALDKTIQ 2514
            EF   + +L PLWK+    TK  NV    +N    D+ AVC+G  D+  Q   G +C +++KN  +P+   +   G        T+  L  IG+++G ++V+++R+   E +  ++  + +H   V Q++W     G      EV   S+SSDGRV  W + +        +   ++ L R    + G    K     ++  + GSC  F+P D  I+L G E G+I+KCS +++ +YL  ++ H   VY I ++ F +++F+SC ADW +K+W   R +P+  F     +V  + W+P SS +FA V  EG V V++L ++    + ++ + P+    LT ++F E    ++VGD  G+  +      LR M   PK Q      T+Q
Sbjct:  337 EFREGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNCKHGECVWQIKW-----GLDMADGEVNFFSVSSDGRVFNWILMQN-----KLWVTTIITLYRENGLVDGPDGTK-----VTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFSSKYLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGA-AVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQLYLDQNTLQ 709          
BLAST of WD repeat domain 78 vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0345666)

HSP 1 Score: 192.586 bits (488), Expect = 4.411e-51
Identity = 115/389 (29.56%), Postives = 196/389 (50.39%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQ-KPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEV-LISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACV-NEGAVEVWNLQLSTLDPLIVENICPEY-TVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQTEALDKTIQ 2514
            EF   + +L PLWK+    TK  NV    +N    D+ AVC+G  D+  Q   G +C +++KN  +P+   +   G        T+  L  IG+++G ++V+++R+   E +  ++  + +H   V Q++W     G      EV   S+SSDGRV  W + +        +   ++ L R    + G    K     ++  + GSC  F+P D  I+L G E G+I+KCS +++ +YL  ++ H   VY I ++ F +++F+SC ADW +K+W   R +P+  F     +V  + W+P SS +FA V  EG V V++L ++    + ++ + P+    LT ++F E    ++VGD  G+  +      LR M   PK Q      T+Q
Sbjct:  337 EFREGEGNLLPLWKFQYDKTKKMNVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNLREDCKEPLYVSRGVNCKHGECVWQIKW-----GLDMADGEVNFFSVSSDGRVFNWILMQN-----KLWVTTIITLYRENGLVDGPDGTK-----VTLKSGGSCMVFHPVDNKIFLVGTECGYIYKCSTAFSSKYLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFIFDLGA-AVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNKLTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQLYLDQNTLQ 709          
BLAST of WD repeat domain 78 vs. Ensembl Fly
Match: Dic61B (gene:FBgn0263988 transcript:FBtr0072538)

HSP 1 Score: 160.614 bits (405), Expect = 1.163e-40
Identity = 108/375 (28.80%), Postives = 176/375 (46.93%), Query Frame = 1
Query: 1438 RNVAAFAWNRQNPDILAVCYGDFDYANQK---PGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHS-EVLISISSDGRVTQWSVRK-----GFESSESDFHHDLMKLKRIATRIPG--AGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIAS 2529
            + V+   + R N DILAV YG + +++Q     G V  WS+KN   PER +      TAI++S    +LLAIG+++G++ V DV    D  V  ++ ++     PV  + W+ +VS    E   +  +S+S DG VT++ + K     GF           M L+R+     G       +     +++  G     +P   +IY    +EG IHKCS +Y  QYL+    H   V  +++SP+   +FL+C  DW +++W      P++     +  V+   WSP  S I   VN     VW+ + + L P+    +   +   T   F+  G  L++G+  G     AL +MP  P  Q + L+K I   I +
Sbjct:  298 KAVSDIDFCRSNGDILAVAYGLYSFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVSDDDHETDIDPFLSLSQDGSVTRFRIIKSPFLLGFTQ---------MILERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKDIYYVLTDEGCIHKCSINYQHQYLEVLRCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTIIVTVNRETANVWDFRRNLLRPMSKHKMDSSFN--TVARFSHCGRTLVIGNERGNTLFNALNDMPFSPHFQYDELEKAIFKAIGN 661          
BLAST of WD repeat domain 78 vs. Ensembl Fly
Match: Dic61B (gene:FBgn0263988 transcript:FBtr0072539)

HSP 1 Score: 160.614 bits (405), Expect = 1.995e-40
Identity = 108/375 (28.80%), Postives = 176/375 (46.93%), Query Frame = 1
Query: 1438 RNVAAFAWNRQNPDILAVCYGDFDYANQK---PGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHS-EVLISISSDGRVTQWSVRK-----GFESSESDFHHDLMKLKRIATRIPG--AGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIAS 2529
            + V+   + R N DILAV YG + +++Q     G V  WS+KN   PER +      TAI++S    +LLAIG+++G++ V DV    D  V  ++ ++     PV  + W+ +VS    E   +  +S+S DG VT++ + K     GF           M L+R+     G       +     +++  G     +P   +IY    +EG IHKCS +Y  QYL+    H   V  +++SP+   +FL+C  DW +++W      P++     +  V+   WSP  S I   VN     VW+ + + L P+    +   +   T   F+  G  L++G+  G     AL +MP  P  Q + L+K I   I +
Sbjct:  378 KAVSDIDFCRSNGDILAVAYGLYSFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVSDDDHETDIDPFLSLSQDGSVTRFRIIKSPFLLGFTQ---------MILERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKDIYYVLTDEGCIHKCSINYQHQYLEVLRCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTIIVTVNRETANVWDFRRNLLRPMSKHKMDSSFN--TVARFSHCGRTLVIGNERGNTLFNALNDMPFSPHFQYDELEKAIFKAIGN 741          
BLAST of WD repeat domain 78 vs. Ensembl Zebrafish
Match: wdr78 (WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-050522-322])

HSP 1 Score: 411.764 bits (1057), Expect = 5.165e-131
Identity = 235/680 (34.56%), Postives = 366/680 (53.82%), Query Frame = 1
Query:  493 NVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQ 2532
            N  +++++ ++E    L++  LD   +  L ETETIW+ D+  +  + + +D+  ++++N  Y  L  +R GNDKY+ER M TF +A  +K +Q + I   D   M T+WD++D + N+                 + S N     +R          ++++PE ++S+G      P   +++    S  S      T    +      D +   + IL S+++     +MER +  N +  K+  YR LP    ++E+    Q+  V  E+  +E SK                    P LE LW +    T GRNV+   WN++NPD+LAV YG  ++ N   GLVCCWSLKN  +P+R F   SG TA+ +S +++N LA+GM++GTI++++V+      + D+   +  H  PV QL W+    G + +  E+L+S+SSDGR+++W   K  E        DLMKLK     I     ++     IS    G CF F+P D  IYL G EEGHIHKCS SYNEQYL+++  H  PVY + WSPF +DVFLSCS+DWTI+LW  + Q PV+ F S  + V  I WSP  + +F  V+EG VE+W+L++S+LDP +V    P     T++ F+   +C++VGDS+G +  + L+N+     +Q E L+  IQS ++SQ
Sbjct:  164 NSISDIQSHREEPKEQLRENILDSTANCYLSETETIWLLDIPAVSVSVESEDAEAVKERNNAYTELCKNRQGNDKYVERSMQTFSDASKTKEVQCDSITMVDKAVMCTVWDMYDSFNNI----------------SDVSANTVVSSERH---------EATIPE-SSSEG--HLVHPKRSNQSLSVVSTVSTVSGSSTHIEKMACVLPLDEEPDLQLILQSDKLKQDLALMERVVLANVFQPKLAAYRQLP----IIEDPDCVQM--VMEEESWTEQSKNSHC----------------PFLERLWDFSCELTMGRNVSCMVWNKKNPDLLAVGYGQVEFKNPNSGLVCCWSLKNPTWPDRVFHCESGVTALDFSASNANQLAVGMYDGTIAIYNVQTSEQTPITDSSDCANLHTSPVWQLTWIDHEDGLAADKGEILVSVSSDGRISKWIHYKSMECV------DLMKLK-----IHDLQWKRH----ISSLTPGMCFDFHPNDSKIYLVGTEEGHIHKCSSSYNEQYLESYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWRQDLQIPVMGFTSGQRVVFDIMWSPHCATVFGAVSEGKVEIWDLRVSSLDPTLVNWTSPGVNP-TALLFSPETDCVLVGDSEGQVTVYKLKNITAGGGSQGETLEDVIQSTLSSQ 777          
BLAST of WD repeat domain 78 vs. Ensembl Zebrafish
Match: wdr78 (WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-050522-322])

HSP 1 Score: 411.764 bits (1057), Expect = 5.165e-131
Identity = 235/680 (34.56%), Postives = 366/680 (53.82%), Query Frame = 1
Query:  493 NVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQ 2532
            N  +++++ ++E    L++  LD   +  L ETETIW+ D+  +  + + +D+  ++++N  Y  L  +R GNDKY+ER M TF +A  +K +Q + I   D   M T+WD++D + N+                 + S N     +R          ++++PE ++S+G      P   +++    S  S      T    +      D +   + IL S+++     +MER +  N +  K+  YR LP    ++E+    Q+  V  E+  +E SK                    P LE LW +    T GRNV+   WN++NPD+LAV YG  ++ N   GLVCCWSLKN  +P+R F   SG TA+ +S +++N LA+GM++GTI++++V+      + D+   +  H  PV QL W+    G + +  E+L+S+SSDGR+++W   K  E        DLMKLK     I     ++     IS    G CF F+P D  IYL G EEGHIHKCS SYNEQYL+++  H  PVY + WSPF +DVFLSCS+DWTI+LW  + Q PV+ F S  + V  I WSP  + +F  V+EG VE+W+L++S+LDP +V    P     T++ F+   +C++VGDS+G +  + L+N+     +Q E L+  IQS ++SQ
Sbjct:  164 NSISDIQSHREEPKEQLRENILDSTANCYLSETETIWLLDIPAVSVSVESEDAEAVKERNNAYTELCKNRQGNDKYVERSMQTFSDASKTKEVQCDSITMVDKAVMCTVWDMYDSFNNI----------------SDVSANTVVSSERH---------EATIPE-SSSEG--HLVHPKRSNQSLSVVSTVSTVSGSSTHIEKMACVLPLDEEPDLQLILQSDKLKQDLALMERVVLANVFQPKLAAYRQLP----IIEDPDCVQM--VMEEESWTEQSKNSHC----------------PFLERLWDFSCELTMGRNVSCMVWNKKNPDLLAVGYGQVEFKNPNSGLVCCWSLKNPTWPDRVFHCESGVTALDFSASNANQLAVGMYDGTIAIYNVQTSEQTPITDSSDCANLHTSPVWQLTWIDHEDGLAADKGEILVSVSSDGRISKWIHYKSMECV------DLMKLK-----IHDLQWKRH----ISSLTPGMCFDFHPNDSKIYLVGTEEGHIHKCSSSYNEQYLESYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWRQDLQIPVMGFTSGQRVVFDIMWSPHCATVFGAVSEGKVEIWDLRVSSLDPTLVNWTSPGVNP-TALLFSPETDCVLVGDSEGQVTVYKLKNITAGGGSQGETLEDVIQSTLSSQ 777          
BLAST of WD repeat domain 78 vs. Ensembl Zebrafish
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 200.675 bits (509), Expect = 3.912e-54
Identity = 119/375 (31.73%), Postives = 199/375 (53.07%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYAS-GSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALR-NMPPYPKNQ 2487
            EF   +  L PLWK+     KG +V A  WN    D+ AV  G +++  Q+ G++  ++LKN  +PE  F   SG   +   +  S L+A+G+++G +SV+D+RKKSD+ + ++  +SG+H G V Q++W  +       H+    S+S+DGRV  W++ K           D++KL  +  ++P        D L +  A+ G+   F+ +  + +L G E G IHK S  Y+ ++L+ +  H   V  ++W+PF  +VF+SC  DW +K+W     +PV  F+    SV  +AWSP SS +FA V  +G V V++L ++  + L  + +  + T L  + F      +IVGD  G + +  L  N+   PK +
Sbjct:  281 EFRGEKGTLLPLWKFQYDKAKGLSVTALCWNHIYSDLFAVGLGSYEFTQQERGMLLFYTLKNPSFPEFIFNTDSGVMCVDIHEQLSYLVAVGLYDGCVSVYDLRKKSDQPMYNSIASSGKHTGAVWQVKW--QKDDLDSNHN--FFSVSTDGRVVSWTLVK-----HEIVFTDIIKLPPV-DKVP--------DDLKNVVATAGTSLDFHKQKDHHFLVGTEAGKIHKGSKYYSSKFLEMYDAHFMTVSCVRWNPFHPNVFISCGWDWMVKIWDHTINSPVFTFELK-SSVTDVAWSPYSSTVFAAVTADGKVHVFDLSINKYEALCQQKVVSKKTRLLHIEFNPVHPIIIVGDDRGRVISLKLSPNLRKKPKEK 636          
BLAST of WD repeat domain 78 vs. Ensembl Zebrafish
Match: dnai1.1 (dynein, axonemal, intermediate chain 1, paralog 1 [Source:ZFIN;Acc:ZDB-GENE-040910-7])

HSP 1 Score: 169.859 bits (429), Expect = 3.829e-44
Identity = 106/376 (28.19%), Postives = 191/376 (50.80%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLE-WVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTE 2493
            EF   +  L PLW++  +  K  +V+A  WN++  D+ AV  G   +   + G++  ++ +N ++PE  F   SG   +   +  S+L+A+G+FNG + V+++  K D+ + ++  +SG+H G V Q++ W   + G     +    S+S+DGRV  W++ K +E     F  +++KL  +  ++P        + +++   +G    F+ + P  +L G E G IHK S  Y  +++  +  H   V  ++W+PF   VF++C  DW + +W     +PV  F     SV  +AW+P SS +FA V  +G V V++L ++  + L  + +      LT + F      +IVG+  G     +L+  P   KN  E
Sbjct:  205 EFRGDKGTLLPLWEFQYNKVKSLHVSALCWNKKYNDLFAVGLGSHKFTELECGMLLFYTWRNNNHPEFLFNTDSGVMCVDIHEQKSHLVAVGLFNGNVCVYNLMAKDDQPIYNSMASSGKHSGTVWQVKWWEDDLYG-----NHTFFSVSADGRVVSWTLGK-YEL----FSTNIIKLPPM-DKVP----DDLNNVIVT---AGLTLDFHKQKPYHFLVGTEAGKIHKGSTHYT-RFIKTYEAHFRMVSCVRWNPFNPKVFITCGMDWRVNIWDETTDSPVFTFDLK-SSVMDVAWAPYSSTVFAAVTADGKVHVFDLSINRFEALCQQRVVSTKRHLTCIEFNPVHPIIIVGNDRG--RVISLKLSPNLRKNPKE 558          
BLAST of WD repeat domain 78 vs. Ensembl Zebrafish
Match: dnai1.1 (dynein, axonemal, intermediate chain 1, paralog 1 [Source:ZFIN;Acc:ZDB-GENE-040910-7])

HSP 1 Score: 169.474 bits (428), Expect = 4.160e-44
Identity = 105/375 (28.00%), Postives = 189/375 (50.40%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTE 2493
            EF   +  L PLW++  +  K  +V+A  WN++  D+ AV  G   +   + G++  ++ +N ++PE  F   SG   +   +  S+L+A+G+FNG + V+++  K D+ + ++  +SG+H G V Q++W           +    S+S+DGRV  W++ K +E     F  +++KL  +  ++P        + +++   +G    F+ + P  +L G E G IHK S  Y  +++  +  H   V  ++W+PF   VF++C  DW + +W     +PV  F     SV  +AW+P SS +FA V  +G V V++L ++  + L  + +      LT + F      +IVG+  G     +L+  P   KN  E
Sbjct:  175 EFRGDKGTLLPLWEFQYNKVKSLHVSALCWNKKYNDLFAVGLGSHKFTELECGMLLFYTWRNNNHPEFLFNTDSGVMCVDIHEQKSHLVAVGLFNGNVCVYNLMAKDDQPIYNSMASSGKHSGTVWQVKW----WEDDLYGNHTFFSVSADGRVVSWTLGK-YEL----FSTNIIKLPPM-DKVP----DDLNNVIVT---AGLTLDFHKQKPYHFLVGTEAGKIHKGSTHYT-RFIKTYEAHFRMVSCVRWNPFNPKVFITCGMDWRVNIWDETTDSPVFTFDLK-SSVMDVAWAPYSSTVFAAVTADGKVHVFDLSINRFEALCQQRVVSTKRHLTCIEFNPVHPIIIVGNDRG--RVISLKLSPNLRKNPKE 528          
BLAST of WD repeat domain 78 vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 458.373 bits (1178), Expect = 1.531e-148
Identity = 293/837 (35.01%), Postives = 443/837 (52.93%), Query Frame = 1
Query:  100 SSTRRNMNQSTIRMSMYTTNASKTQSILSKKAESESKRSL--KVPVRLVDANGTDYTXXXXXXXXXXXXENEKD---TPTD--NISQGSFY-------TQSISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNE-GNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANS--DSDLFGTRQSSV----TASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGR-SEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKT---DALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQL 2535
            S T+  MNQS    SM  T++ K+ ++ ++    E   SL  K  ++++D +G D +P PL   +      ++    TP D   I+    +       T   +SF+G     FTRS    S+   +++ + S+++   + G    L   +E++  + E   I  +E+LDK ++I L +TET+W+ DM P L + D +++     +N+ YE L   + GNDKY+ER M TF  A  SK +Q +RI   D G  A++WD++D Y                      SP +  V++             +V   T SK    SRS     +++ T S NS   +D F +  + +     A    +++  +EEIL  E+     F MER +  N +  ++  YR LP   +               EDE+  S+ + +              +  P L  LW +    TKG NV++ +WN++N D+LAV YG F +  QK G+ CCWSLKNI +PER F    G TA+ +S  H NLLA+GM+NGT+++++V+   D  V+D+     +H  PV QL+W+    G   ++  E+L+S+ +DGR+T+W +RKG +       +DLMKLKR  +        +K    +A IS+ A G CF F PKD NIYLAG EEGHIHKCSCSYNEQ+LD + GH  PVY I WSPF  DVFLSCSADW I LW  +  +P++ F +   +V  I WSP S+++F  V E  VE+W+L  ST+DPLIV    P    LTS+ F ++  C+++GDSDG ++ + LRN+     ++  AL   I + +A+QL
Sbjct:   37 SVTQSRMNQSIFNRSMLGTSSRKSLNLHAESKMGERNLSLVGKQNIKILDDDGKDVSPQPLFQAEPGTVPQKQSKLFTPPDASGIATSDMFSSLSLQQTAFNASFVGP----FTRSTFGGSTVSRSSKETESLTEYIEDTGFKRELASLSEIQGKQHEMQPI--EEDLDKIINIFLTDTETLWLLDMPPALTSSDSENADLNRVRNQAYEDLCKDKVGNDKYIERMMQTFSGAPKSKEVQCDRIILEDIGVTASVWDLYDSYY---------------------SPESLTVKE-------------TVDRATESKNISTSRS----SESRGTRSVNSLGRADSFSSSATDIEGLPLARIPDEAEPDSEEILKLEKFQQDLFFMERVVVENTFQSRLAAYRQLPVIAD-------------HEEDEDKISAVSSN--------------IMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQFGFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNEDFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWHIRKGLDC------NDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTENRVEIWDLGTSTIDPLIVNEANPGVK-LTSILFAKNTNCVLIGDSDGQVNVYELRNVSSSKDSEVNALYDIIGATLATQL 795          
BLAST of WD repeat domain 78 vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 451.055 bits (1159), Expect = 8.137e-146
Identity = 287/814 (35.26%), Postives = 432/814 (53.07%), Query Frame = 1
Query:  100 SSTRRNMNQSTIRMSMYTTNASKTQSILSKKAESESKRSL--KVPVRLVDANGTDYTXXXXXXXXXXXXENEKD---TPTD--NISQGSFY-------TQSISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNE-GNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANS--DSDLFGTRQSSV----TASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGR-SEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKT---DALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNM 2466
            S T+  MNQS    SM  T++ K+ ++ ++    E   SL  K  ++++D +G D +P PL   +      ++    TP D   I+    +       T   +SF+G     FTRS    S+   +++ + S+++   + G    L   +E++  + E   I  +E+LDK ++I L +TET+W+ DM P L + D +++     +N+ YE L   + GNDKY+ER M TF  A  SK +Q +RI   D G  A++WD++D Y                      SP +  V++             +V   T SK    SRS     +++ T S NS   +D F +  + +     A    +++  +EEIL  E+     F MER +  N +  ++  YR LP   +               EDE+  S+ + +              +  P L  LW +    TKG NV++ +WN++N D+LAV YG F +  QK G+ CCWSLKNI +PER F    G TA+ +S  H NLLA+GM+NGT+++++V+   D  V+D+     +H  PV QL+W+    G   ++  E+L+S+ +DGR+T+W +RKG +       +DLMKLKR  +        +K    +A IS+ A G CF F PKD NIYLAG EEGHIHKCSCSYNEQ+LD + GH  PVY I WSPF  DVFLSCSADW I LW  +  +P++ F +   +V  I WSP S+++F  V E  VE+W+L  ST+DPLIV    P    LTS+ F ++  C+++GDSDG ++ + LRN+
Sbjct:   37 SVTQSRMNQSIFNRSMLGTSSRKSLNLHAESKMGERNLSLVGKQNIKILDDDGKDVSPQPLFQAEPGTVPQKQSKLFTPPDASGIATSDMFSSLSLQQTAFNASFVGP----FTRSTFGGSTVSRSSKETESLTEYIEDTGFKRELASLSEIQGKQHEMQPI--EEDLDKIINIFLTDTETLWLLDMPPALTSSDSENADLNRVRNQAYEDLCKDKVGNDKYIERMMQTFSGAPKSKEVQCDRIILEDIGVTASVWDLYDSYY---------------------SPESLTVKE-------------TVDRATESKNISTSRS----SESRGTRSVNSLGRADSFSSSATDIEGLPLARIPDEAEPDSEEILKLEKFQQDLFFMERVVVENTFQSRLAAYRQLPVIAD-------------HEEDEDKISAVSSN--------------IMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQFGFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNEDFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWHIRKGLDC------NDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTENRVEIWDLGTSTIDPLIVNEANPGVK-LTSILFAKNTNCVLIGDSDGQVNVYELRNV 772          
BLAST of WD repeat domain 78 vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 437.187 bits (1123), Expect = 3.801e-141
Identity = 278/795 (34.97%), Postives = 417/795 (52.45%), Query Frame = 1
Query:  100 SSTRRNMNQSTIRMSMYTTNASKTQSILSKKAESESKRSL--KVPVRLVDANGTDYTXXXXXXXXXXXXENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGR-SEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKT---DALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNM 2466
            S T+  MNQS    SM  T++ K+ ++ ++    E   SL  K  ++++D +G D +P PL          + +  T    Q   +T   +S + T+ + F+    QQ++   +      ++ +      P+  +++E++  + E   I  +E+LDK ++I L +TET+W+ DM P L + D +++     +N+ YE L   + GNDKY+ER M TF  A  SK +Q +RI   D G  A++WD++D Y                      SP +  V++             +V   T SK    SRS      +  T       D+ G   + +      DS    EEIL  E+     F MER +  N +  ++  YR LP      E + +        E++  + S   S              +  P L  LW +    TKG NV++ +WN++N D+LAV YG F +  QK G+ CCWSLKNI +PER F    G TA+ +S  H NLLA+GM+NGT+++++V+   D  V+D+     +H  PV QL+W+    G   ++  E+L+S+ +DGR+T+W +RKG +       +DLMKLKR  +        +K    +A IS+ A G CF F PKD NIYLAG EEGHIHKCSCSYNEQ+LD + GH  PVY I WSPF  DVFLSCSADW I LW  +  +P++ F +   +V  I WSP S+++F  V E  VE+W+L  ST+DPLIV    P    LTS+ F ++  C+++GDSDG ++ + LRN+
Sbjct:    2 SVTQSRMNQSIFNRSMLGTSSRKSLNLHAESKMGERNLSLVGKQNIKILDDDGKDVSPQPLF---------QAEPGTVPQKQSKLFTPPDASGIATSDM-FSSLSLQQTAFNASFVDFGKIAKKKCYYKEPTF-IFSEIQGKQHEMQPI--EEDLDKIINIFLTDTETLWLLDMPPALTSSDSENADLNRVRNQAYEDLCKDKVGNDKYIERMMQTFSGAPKSKEVQCDRIILEDIGVTASVWDLYDSYY---------------------SPESLTVKE-------------TVDRATESKNISTSRSSENSFSSSAT-------DIEGLPLARIPDEAEPDS----EEILKLEKFQQDLFFMERVVVENTFQSRLAAYRQLPVIIN-PEGVHMNSFLAFYHEEDEDKISAVSSN-------------IMSPSLNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQFGFTEQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNEDFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEILVSVCADGRITRWHIRKGLDC------NDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTENRVEIWDLGTSTIDPLIVNEANPGVK-LTSILFAKNTNCVLIGDSDGQVNVYELRNV 717          
BLAST of WD repeat domain 78 vs. Ensembl Xenopus
Match: csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:Xenbase;Acc:XB-GENE-983697])

HSP 1 Score: 133.265 bits (334), Expect = 9.690e-32
Identity = 100/365 (27.40%), Postives = 168/365 (46.03%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLKNIDY-PERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDV-----FLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNE-GAVEVWNLQLSTLDP---LIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKN 2484
            ++K R V+   W+ Q P++L   Y + + A  +P G+   W++K     PE  F   S   + ++++ H NL+  G ++G I ++D R      V  T  ++  H  PV    + + V G    H+  LISIS+DG++  WS+             D++   + +  +    KQ K  A+       +C +F   D N ++ G EEG ++  C         + F GH  P+ GI     +  V     F++ S DWT+KLW  +   P+ +F+     V  + WSP    +FACV+  G +++WNL   T  P   + VE        L  V +T SG  + VG+S+G +  + +      P+N
Sbjct:  244 WSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKMTPEYVFHCQSAVMSAAFARFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPV----YCVNVVGTQNAHN--LISISTDGKICSWSL-------------DMLSQPQDSMEL--VHKQSKAVAV-------TCMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHSAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGVGRLDLWNLNNDTEVPTASITVEG----NPALNRVRWTHSGREIAVGNSEGEIFIYDVGEQIAVPRN 576          
BLAST of WD repeat domain 78 vs. Ensembl Xenopus
Match: csrnp2 (cysteine-serine-rich nuclear protein 2 [Source:Xenbase;Acc:XB-GENE-983697])

HSP 1 Score: 132.88 bits (333), Expect = 1.477e-31
Identity = 100/365 (27.40%), Postives = 168/365 (46.03%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLKNIDY-PERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDV-----FLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNE-GAVEVWNLQLSTLDP---LIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKN 2484
            ++K R V+   W+ Q P++L   Y + + A  +P G+   W++K     PE  F   S   + ++++ H NL+  G ++G I ++D R      V  T  ++  H  PV    + + V G    H+  LISIS+DG++  WS+             D++   + +  +    KQ K  A+       +C +F   D N ++ G EEG ++  C         + F GH  P+ GI     +  V     F++ S DWT+KLW  +   P+ +F+     V  + WSP    +FACV+  G +++WNL   T  P   + VE        L  V +T SG  + VG+S+G +  + +      P+N
Sbjct:  275 WSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKMTPEYVFHCQSAVMSAAFARFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPV----YCVNVVGTQNAHN--LISISTDGKICSWSL-------------DMLSQPQDSMEL--VHKQSKAVAV-------TCMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHSAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGVGRLDLWNLNNDTEVPTASITVEG----NPALNRVRWTHSGREIAVGNSEGEIFIYDVGEQIAVPRN 607          
BLAST of WD repeat domain 78 vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 461.84 bits (1187), Expect = 9.441e-150
Identity = 255/665 (38.35%), Postives = 382/665 (57.44%), Query Frame = 1
Query:  490 LNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVK--QIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRS-EEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIAT--RIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMP 2469
            L  +T+V+ ++  +   +  EEL+K ++I+L ETET+  FD+  ++F+ + +++ +I +KNK YE L  +R GND Y+ER M TF  A  +K +Q  +I   + G +AT WD++D Y                       P       RS   SK      S+P         + R P + D         S+S      ++ + A    D +  +E IL S+++    F MER L  N +  K+  YR LP YKE   E   +  Q++ +   ++  +    +  E      +  E +    +LE LW +    TKG NV++ +WN+ NPD+LAV YG+F +  QK G+ CCWS+KN  +PER ++   G T++ +S +  NLLA+G  NGT+++++V+   +  V+D+  +  +HLGPV Q++W+ +  G + ++  E+L+SIS+DGR+++W +RKG +       HDLM+LKR        G  K+KK +ALIS+ A G CFAF+PKD NIYLAG EEG IHKCSCSYNEQYL+ + GH  PVY + W+PF  DVFLSCSADW + +WH +   P ++F      V  ++WSPKS+ IFA  NE  VE+W+LQ+STLDPLIV N+       T+V F +  +CL+VGDSDG +  + LRNMP
Sbjct:  170 LASFTDVRVLRSTAEAAISKEELEKTIEIILTETETLRFFDLPTVMFSTESEEAEKIIEKNKKYETLCRNRLGNDLYVERMMQTFNGAPKNKEVQCEKIILEEKGVVATTWDLYDSYN---------------------IPETLLAAKRSGYSSK-----GSLP--------AKDRDPKIQD---------SESSSLMDIENVILAKVQEDEEDNSEAILKSDKLHQDLFYMERVLMENVFQPKLAAYRQLPVYKEHEPEEPEETLQVENLKVAEDEPKKEDEEEVEMELELEIATEQSTIPANLERLWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNFGFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRKGLDC------HDLMRLKRTTATGGKKGGEKEKKGEALISRQAPGMCFAFHPKDTNIYLAGTEEGLIHKCSCSYNEQYLETYRGHKGPVYKVTWNPFCPDVFLSCSADWGVMIWHQDTVKPFLSFYPTTYVVYDVSWSPKSAYIFAAANENRVEIWDLQISTLDPLIV-NVANPGIKFTTVLFAKETDCLLVGDSDGQVAVYELRNMP 784          
BLAST of WD repeat domain 78 vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 246.899 bits (629), Expect = 5.765e-71
Identity = 146/461 (31.67%), Postives = 246/461 (53.36%), Query Frame = 1
Query:  490 LNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVK--QIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRS-EEHSEVLISISSDGRVTQWSVRKGFE 1863
            L  +T+V+ ++  +   +  EEL+K ++I+L ETET+  FD+  ++F+ + +++ +I +KNK YE L  +R GND Y+ER M TF  A  +K +Q  +I   + G +AT WD++D Y                       P       RS   SK      S+P         + R P + D         S+S      ++ + A    D +  +E IL S+++    F MER L  N +  K+  YR LP YKE   E   +  Q++ +   ++  +    +  E      +  E +    +LE LW +    TKG NV++ +WN+ NPD+LAV YG+F +  QK G+ CCWS+KN  +PER ++   G T++ +S +  NLLA+G  NGT+++++V+   +  V+D+  +  +HLGPV Q++W+ +  G + ++  E+L+SIS+DGR+++W +RKG +
Sbjct:  170 LASFTDVRVLRSTAEAAISKEELEKTIEIILTETETLRFFDLPTVMFSTESEEAEKIIEKNKKYETLCRNRLGNDLYVERMMQTFNGAPKNKEVQCEKIILEEKGVVATTWDLYDSYN---------------------IPETLLAAKRSGYSSK-----GSLP--------AKDRDPKIQD---------SESSSLMDIENVILAKVQEDEEDNSEAILKSDKLHQDLFYMERVLMENVFQPKLAAYRQLPVYKEHEPEEPEETLQVENLKVAEDEPKKEDEEEVEMELELEIATEQSTIPANLERLWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNFGFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRKGLD 587          
BLAST of WD repeat domain 78 vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 246.899 bits (629), Expect = 5.765e-71
Identity = 146/461 (31.67%), Postives = 246/461 (53.36%), Query Frame = 1
Query:  490 LNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVK--QIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRS-EEHSEVLISISSDGRVTQWSVRKGFE 1863
            L  +T+V+ ++  +   +  EEL+K ++I+L ETET+  FD+  ++F+ + +++ +I +KNK YE L  +R GND Y+ER M TF  A  +K +Q  +I   + G +AT WD++D Y                       P       RS   SK      S+P         + R P + D         S+S      ++ + A    D +  +E IL S+++    F MER L  N +  K+  YR LP YKE   E   +  Q++ +   ++  +    +  E      +  E +    +LE LW +    TKG NV++ +WN+ NPD+LAV YG+F +  QK G+ CCWS+KN  +PER ++   G T++ +S +  NLLA+G  NGT+++++V+   +  V+D+  +  +HLGPV Q++W+ +  G + ++  E+L+SIS+DGR+++W +RKG +
Sbjct:  170 LASFTDVRVLRSTAEAAISKEELEKTIEIILTETETLRFFDLPTVMFSTESEEAEKIIEKNKKYETLCRNRLGNDLYVERMMQTFNGAPKNKEVQCEKIILEEKGVVATTWDLYDSYN---------------------IPETLLAAKRSGYSSK-----GSLP--------AKDRDPKIQD---------SESSSLMDIENVILAKVQEDEEDNSEAILKSDKLHQDLFYMERVLMENVFQPKLAAYRQLPVYKEHEPEEPEETLQVENLKVAEDEPKKEDEEEVEMELELEIATEQSTIPANLERLWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNFGFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRKGLD 587          
BLAST of WD repeat domain 78 vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 211.46 bits (537), Expect = 2.762e-61
Identity = 122/339 (35.99%), Postives = 187/339 (55.16%), Query Frame = 1
Query: 1099 VTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVK--QIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRS-EEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIAT--RIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGH 2100
            + A    D +  +E IL S+++    F MER L  N +  K+  YR LP YKE   E   +  Q++ +   ++  +    +  E      +  E +    +LE LW +    TKG NV++ +WN+ NP                             +PER ++   G T++ +S +  NLLA+G  NGT+++++V+   +  V+D+  +  +HLGPV Q++W+ +  G + ++  E+L+SIS+DGR+++W +RKG +       HDLM+LKR        G  K+KK +ALIS+ A G CFAF+PKD NIYLAG EEG IHKCSCSYNEQYL+ + GH
Sbjct:    7 ILAKVQEDEEDNSEAILKSDKLHQDLFYMERVLMENVFQPKLAAYRQLPVYKEHEPEEPEETLQVENLKVAEDEPKKEDEEEVEMELELEIATEQSTIPANLERLWSFSCDLTKGLNVSSLSWNKANP-----------------------------WPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRKGLDC------HDLMRLKRTTATGGKKGGEKEKKGEALISRQAPGMCFAFHPKDTNIYLAGTEEGLIHKCSCSYNEQYLETYRGH 310          
BLAST of WD repeat domain 78 vs. Ensembl Mouse
Match: Dnaic1 (dynein, axonemal, intermediate chain 1 [Source:MGI Symbol;Acc:MGI:1916172])

HSP 1 Score: 196.052 bits (497), Expect = 2.460e-52
Identity = 120/385 (31.17%), Postives = 190/385 (49.35%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIA--TRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACV-NEGAVEVWNLQLSTLDPLIVENICPEYTV------LTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQ 2487
            E+   +  L PLWK+     K   V A  WN +  D+ AV +G +D+  Q  G++  +S+KN  +PE  F   SG   +     H  L+ +G ++G +++++++K   +    +   SG+H  PV Q++W         +H+    S+SSDGR+  W++ K         H D++KLK     T IP  G Q  T         G+ F F+ +   ++L G EEG I+KCS SY+ Q+LD +  H   V  + W+P+   VF+SCS+DWT+K+W    + P+  +     +V  +AW+P SS +FA V  +G   V++L ++       E IC +  V      +T V F      +IVGD  G +        LR MP   K Q
Sbjct:  312 EYRDQEGTLLPLWKFQNDKAKRLAVTALCWNPKYKDLFAVGHGSYDFMKQSRGMLLLYSMKNPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNLKKPHSQPCFRSTSKSGKHTDPVWQVKW----QKDDMDHNLNFFSVSSDGRIVSWTLVKS-----ELVHIDIIKLKTEGSTTEIP-EGLQLHT------VGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMAVDAVLWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIY-DLNSAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKY-----EAICNQPVVAKKKNKITHVQFNPIHPIIIVGDDRGHIICLKLSPNLRKMPKEKKGQ 674          
BLAST of WD repeat domain 78 vs. UniProt
Match: sp|Q5VTH9|WDR78_HUMAN (WD repeat-containing protein 78 OS=Homo sapiens OX=9606 GN=WDR78 PE=2 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 1.663e-153
Identity = 267/663 (40.27%), Postives = 384/663 (57.92%), Query Frame = 1
Query:  490 LNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEE-HSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRI--ATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMP 2469
            L  +T+++ I+     I+  E+L+K ++I+L ETET+  FD+  ++ + + +++ ++ ++NK YE+L  +R GND Y+ER M TF  A  +K +Q ++I   D G M+T WD++D Y  M+                + S   + VE  SK    P   D  +P  T  K                    NS++      ++ + A    D +  ++ IL S++     F MER L  N +  K+  YR LP  KE   E     +++   E+   ES K +  E  A     P       +LE LW +    TKG NV++ AWN+ NPD+LAV YG F +  QK GL CCWS+KN  +PER ++ P G TA+ +S    NLLA+G  NGTI++++VR  S+  V+D+  +  +HLGPV QL+W+ +  G + +   E+L+SIS+DGR+++W +RKG +       +DLM+LKR   A+   G  K+KK +ALIS+ A G CFAF+PKD NIYLAG EEGHIHKCSCSYNEQYLD + GH  PVY + W+PF +DVFLSCSADW + +W  E   P ++F  A   V  +AWSPKSS IFA  NE  VE+W+L +STLDPLIV    P     T++ F +  +CL+VGDSDG +  + LRNMP
Sbjct:  210 LTSFTDLQVIRAAPEKIVTKEDLEKNIEIILTETETLRFFDLPTVMVSVESEEAEKVTQRNKNYEVLCRNRLGNDLYVERMMQTFNGAPKNKDVQCDKIIMEDKGIMSTAWDLYDSYNAMELV--------------SLSVKQSVVESSSKANVLPKDQDQRLPGSTTEK--------------------NSETSSLMDIENVILAKIHEDEEDHSDAILKSDKFHQDLFFMERVLMENIFQPKLAAYRQLPVLKEPEPEEPEDVLESAKHEEVEEESKKEEEEEIHAEESTIPA------NLERLWSFSCDLTKGLNVSSLAWNKTNPDLLAVGYGHFGFKEQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGTIAIYNVRSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDC------YDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNIYLAGTEEGHIHKCSCSYNEQYLDTYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANENRVEIWDLHISTLDPLIVNTANPGIK-FTTILFAKQTDCLLVGDSDGQVSVYELRNMP 825          
BLAST of WD repeat domain 78 vs. UniProt
Match: sp|E9PYY5|WDR78_MOUSE (WD repeat-containing protein 78 OS=Mus musculus OX=10090 GN=Wdr78 PE=1 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 6.604e-149
Identity = 255/665 (38.35%), Postives = 382/665 (57.44%), Query Frame = 1
Query:  490 LNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVK--QIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRS-EEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIAT--RIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMP 2469
            L  +T+V+ ++  +   +  EEL+K ++I+L ETET+  FD+  ++F+ + +++ +I +KNK YE L  +R GND Y+ER M TF  A  +K +Q  +I   + G +AT WD++D Y                       P       RS   SK      S+P         + R P + D         S+S      ++ + A    D +  +E IL S+++    F MER L  N +  K+  YR LP YKE   E   +  Q++ +   ++  +    +  E      +  E +    +LE LW +    TKG NV++ +WN+ NPD+LAV YG+F +  QK G+ CCWS+KN  +PER ++   G T++ +S +  NLLA+G  NGT+++++V+   +  V+D+  +  +HLGPV Q++W+ +  G + ++  E+L+SIS+DGR+++W +RKG +       HDLM+LKR        G  K+KK +ALIS+ A G CFAF+PKD NIYLAG EEG IHKCSCSYNEQYL+ + GH  PVY + W+PF  DVFLSCSADW + +WH +   P ++F      V  ++WSPKS+ IFA  NE  VE+W+LQ+STLDPLIV N+       T+V F +  +CL+VGDSDG +  + LRNMP
Sbjct:  170 LASFTDVRVLRSTAEAAISKEELEKTIEIILTETETLRFFDLPTVMFSTESEEAEKIIEKNKKYETLCRNRLGNDLYVERMMQTFNGAPKNKEVQCEKIILEEKGVVATTWDLYDSYN---------------------IPETLLAAKRSGYSSK-----GSLP--------AKDRDPKIQD---------SESSSLMDIENVILAKVQEDEEDNSEAILKSDKLHQDLFYMERVLMENVFQPKLAAYRQLPVYKEHEPEEPEETLQVENLKVAEDEPKKEDEEEVEMELELEIATEQSTIPANLERLWSFSCDLTKGLNVSSLSWNKANPDLLAVGYGNFGFREQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNVQSSHNIPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDKREILVSISADGRISKWIIRKGLDC------HDLMRLKRTTATGGKKGGEKEKKGEALISRQAPGMCFAFHPKDTNIYLAGTEEGLIHKCSCSYNEQYLETYRGHKGPVYKVTWNPFCPDVFLSCSADWGVMIWHQDTVKPFLSFYPTTYVVYDVSWSPKSAYIFAAANENRVEIWDLQISTLDPLIV-NVANPGIKFTTVLFAKETDCLLVGDSDGQVAVYELRNMP 784          
BLAST of WD repeat domain 78 vs. UniProt
Match: sp|Q4V8G4|WDR78_RAT (WD repeat-containing protein 78 OS=Rattus norvegicus OX=10116 GN=Wdr78 PE=2 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 1.151e-146
Identity = 252/664 (37.95%), Postives = 381/664 (57.38%), Query Frame = 1
Query:  490 LNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVS-TEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRS-EEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKR--IATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMP 2469
            L  + +V+ ++  +   +  EEL++ V+I L ETET+  FD+  ++ + D +++ ++ +KN  YE+L  +R GND Y+ER M TF  A  +K +Q ++I   + G MAT WD++D +                       P A+    RS   SK   +              + R P + D         S+S      +S + A +  D +  +E+IL S+++    F MER L  N +  K+  YR LP YKEL      + ++ V+   ++  +  + +  E      +  E +    +LE LW +    TKG NV++ +WN+ N D+LAV YG+F +  QK G+ CCWS+KN  +PER ++ P G T++ +S +  NLLA+G  NGT+++++V+   +  V+D+  +  +HLGPV Q++W+ +  G + ++  E+L+SIS+DGR+++W +RKG +       HDLM LKR  + +   G  K+KK +ALIS+ A G CFAF+ KD NIYLAG EEG IHKCSCSYNEQYL+ + GH  PVY + W+PF  DVFLSCSADW + +WH +   P   F      V  +AWSPKS+ IFA  NE  VE+W+LQ+STLDPLIV N+       T+V F +  +CL+VGDSDG +  + LRNMP
Sbjct:  170 LASFADVRVMRAPAEAAITKEELERNVEIFLMETETLRFFDLPTVMISTDSEEAEKVIEKNINYEILCRNRLGNDLYVERMMQTFNGAPKNKDVQCDKIIMEEKGVMATTWDLYDSFN---------------------IPEASLAAKRSAYLSKASLL-------------VRDRDPKIQD---------SESSSLMDIESVILAKSHEDEEDNSEKILKSDKLHQDLFYMERVLMENVFQPKLAAYRQLPIYKELEPGQPEEDLQVVNKVTEDEVKKDEEEEMETELEIEITTEQSTIPANLERLWSFSCDLTKGLNVSSLSWNKANSDLLAVGYGNFGFKEQKRGMACCWSIKNPMWPERIYQSPYGVTSVDFSISSPNLLAVGYHNGTVAIYNVQSNHNTPVLDSSESPQKHLGPVWQVQWIEQDRGTTGDDRREILVSISADGRISKWVIRKGLDC------HDLMHLKRTTVTSSKKGIEKEKKGEALISRQAPGMCFAFHTKDTNIYLAGTEEGLIHKCSCSYNEQYLETYRGHKGPVYKVTWNPFCPDVFLSCSADWGVMIWHQDNVKPFFTFYPTTYVVYDVAWSPKSAYIFAAANENRVEIWDLQISTLDPLIV-NVANPGIKFTTVLFAKQTDCLLVGDSDGQVAVYELRNMP 783          
BLAST of WD repeat domain 78 vs. UniProt
Match: sp|Q16959|DYI2_HELCR (Dynein intermediate chain 2, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.346e-56
Identity = 118/379 (31.13%), Postives = 194/379 (51.19%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLW-HIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENIC-PEYTVLTSVTFTESGECLIVGDSDGILHTFALR-NMPPYPKNQTEA 2496
            EF   +  L PLWK+    +K   V +  WN +  D+ AV +G +D+  Q  G++  ++LKN  +PE  +   SG   I     H  L+ +G  +G++ VF+V       V  +   +G+H  PV Q+ W         +++    S+SSDGRV  W++ K          ++L     I  ++  A +       ++    G+CF F+ +   ++L G EEG IHKCS +Y+ Q+LD F  H   VY + W+ F   +F+SCSADW++K+W H  R  P+  F     +V  +AW+P SS +FA V  +G V V++L L+  +P+  + +   + T LT +TF  +   ++VGD  G + +  L  N+   PK++  A
Sbjct:  310 EFRDQEGTLLPLWKFSYDKSKRLAVTSVCWNPKYKDLFAVAHGSYDFMKQSRGMILFYTLKNPSFPEFVYPTDSGVMCIDIRPEHPYLICVGYCDGSVGVFNVTSTDANPVFQSTAKTGKHTDPVWQVAW----QKDDLDNNLNFFSVSSDGRVVAWTLVK----------NELTYTDVIQLQLDSAPQDGPEGTQLTPLGCGTCFDFHKQTDYLFLVGTEEGKIHKCSKAYSSQFLDTFEAHHMAVYKVMWNHFHPKIFISCSADWSVKIWDHTYRNGPMFTFDLG-SAVGDVAWAPYSSTVFAAVTADGKVHVFDLNLNKYEPICEQAVVQKKKTKLTHITFNPNFPIVLVGDDRGYVSSLKLSPNLRKVPKDKKGA 673          
BLAST of WD repeat domain 78 vs. UniProt
Match: sp|Q9UI46|DNAI1_HUMAN (Dynein intermediate chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAI1 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 8.456e-53
Identity = 112/369 (30.35%), Postives = 188/369 (50.95%), Query Frame = 1
Query: 1396 LEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACV-NEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQ 2487
            L PLWK+     K  +V A  WN +  D+ AV YG +D+  Q  G++  +SLKN  +PE  F   SG   +     H  L+A+G ++G +++++++K   +    +   SG+H  PV Q++W         + +    S+SSDGR+  W++ K         H D++KLK     + G+  +      +     G+ F F+ +   ++L G EEG I+KCS SY+ Q+LD +  H   V  + W+P+   VF+SCS+DWT+K+W    + P+  +     +V  +AW+P SS +FA V  +G   +++L ++  + +  + +  +   LT V F      +IVGD  G + +      LR MP   K Q
Sbjct:  319 LLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKW----QKDDMDQNLNFFSVSSDGRIVSWTLVK-----RKLVHIDVIKLK-----VEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIY-DLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQ 672          
BLAST of WD repeat domain 78 vs. TrEMBL
Match: gnl|BL_ORD_ID|16177909 (tr|A0A4S2LYK1|A0A4S2LYK1_OPIFE WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003998 PE=4 SV=1)

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 370/868 (42.63%), Postives = 530/868 (61.06%), Query Frame = 1
Query:   97 LSSTRRNMNQSTIRMSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTXXXXXXXXXXXXENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXX--------------XXXXXXNASPNATAVE-DRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEI--------------KVKQIKTVSTED---------ENSESSKTKSAEELAAS-------------ILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESS-ESDFHHDLMKLKRIATRIPG-AGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKN---QTEALDKTIQSCIASQ 2532
            ++ +++N  Q   R ++     S+  S +SK++E + KR  +  +RL+DANGTD TPLPLL++D+++KE EKD  T+  SQ S   QS SS   TNP  FTRS          +  +   S E ++ NA     Y EVKT+ Q    +L + +L+K VD+ + ET+T WIFD AP + ++D DD+ +  K+   Y+ LL +RAGND+Y+ERGMNT  N  ISK++QT RI  ++  +MAT+WD+ D ++  +  +                         + +     TA + +R+ +Q   +A +  V   T S G   S +P      ++T  +NS+SDLFG R S+VT ++ +    K+ +IL   R+      MERALN+N Y++K+L Y  L   + +M  +              KV  + T S +D         ++S +  T S   + ++             +  P  A++ P    LW+Y  + TKGRNV   AWN++NP+ILAV YG F++ NQK GLVCCWSLK I+YPER +  PS  TA+ WSK HSNLLA+GMF+G I VFDVRK     V+DT HA+GRHLG VR+++WV+R SGR+E  SEVL+S+S+DGRVT+WSVRKGF+S+ + D+H DLM LKR     PG   K K++++LIS+ A GSC AFN +DP+IY+ G E+G IHKCSCSYNEQYL+ FFGHTAPVY I+WSPF+ DVFLSCSADWTIKLWH++  + +I+ Q+ +  V+SI+WSP  SVIFA  NE A+E+WNL  ST++P +VE +  + + +TSV F+E  + ++VGD+ G +H + L + P  P N   Q   L + +Q+CI  Q
Sbjct:    7 VAQSKKNFGQCLRRSALVL--GSRVSSCVSKRSEGD-KRQSRPSIRLIDANGTDLTPLPLLTEDRRIKE-EKDISTE-FSQTSV--QSESSLHITNPFAFTRS------FVSGSSPTGDSSSEVSDENADRFRGYAEVKTLAQPQREVLSEADLNKLVDVKIAETDTFWIFDRAPTVTSQDADDAQQQTKRTAAYKALLAARAGNDRYMERGMNTTNNPVISKTVQTTRIITHERAAMATVWDMADTFKEEESSELSDSKGAEPTSPVEPGKHGKNRSTYQTDGLAGGTADQTNRTVLQDFAVAAEPIV-GATDSAGLGNSATP------KDTMVSNSESDLFGFRYSAVTQASFY---PKSMDILKLPRLVQDIDRMERALNVNTYYDKLLQYEAL-HLRTIMTPLTLDRSDTDPSSTGPKVPGMTTPSLDDNSAGQPPGAKHSNAGGTASGHSMGSTSQTGMPLHGKGVDVDGPTAAMN-PDTSLLWRYQCNLTKGRNVTDMAWNKENPNILAVGYGKFEFENQKKGLVCCWSLKFIEYPERFYETPSAVTAVGWSKIHSNLLAVGMFSGVIYVFDVRKNDPTPVIDTTHAAGRHLGAVRKVQWVVRQSGRAENLSEVLVSVSTDGRVTEWSVRKGFDSTGDCDYHTDLMVLKRSYVSAPGTVNKPKRSESLISRTAFGSCMAFNKRDPSIYVVGTEDGPIHKCSCSYNEQYLETFFGHTAPVYQIEWSPFVPDVFLSCSADWTIKLWHLDHTSALISIQTHISMVSSISWSPYHSVIFASANESALEIWNLDSSTIEPYVVETVSSD-SNMTSVLFSECSDSVLVGDNQGTVHVYGLEDFPETPTNSLSQAATLAEILQTCIKDQ 848          
BLAST of WD repeat domain 78 vs. TrEMBL
Match: gnl|BL_ORD_ID|20403908 (tr|H2KQB6|H2KQB6_CLOSI WD repeat-containing protein 78 OS=Clonorchis sinensis OX=79923 GN=CLF_103603 PE=4 SV=1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 368/866 (42.49%), Postives = 525/866 (60.62%), Query Frame = 1
Query:   97 LSSTRRNMNQSTIRMSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTXXXXXXXXXXXXENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRN-------------MDXXXXXXXXXXXXXXXXNASPNATAVE-DRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEI--------------KVKQIKTVSTED---------ENSESSKTKSAEELAASI------------LKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESS-ESDFHHDLMKLKRIATRIPG-AGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKN---QTEALDKTIQSCIASQ 2532
            L+ +++N+ Q   + ++     S+  S +SKK+E + KR  +  +RL+DANG D TPLPLL++D++ KE EKD  T+  SQ S   QS SS   TNP  FTRS          +  +   + E ++ N      Y EVKT+ Q    +L + +L+K VD+ + ET+T WIFD AP + ++D DD+ +  K+   Y+ LL SRAGND+Y+ERGMNT  N  I KS+QT RI  ++  +MAT+WD+ D ++                  +    G      + +     TA + +R+ +Q   +  D  +   T S G   S +P      ++T  +NS+SDLFG R S+VT ++ +    K  +IL   R+      MERALN+N Y++K+L Y  L   + +M  +              KV  ++T S +D         ++S +  T S   + ++             +    A + P    LW+Y  S TKGRNV   AWN++NP+ILAV YG F++ NQK GLVCCWSLK I+YPER +  PS  TA+ WSK HSNLLA+GMF+G I VFDVRK     V+DT HA+GRHLG VR+++WV+R SGR+E  SEVL+S+S+DGRVT+WSVRKGF+S+ + D+H DLM LKR     PG   K K++++LIS+ A GSC AFN +DP+IY+ G E+G IHKCSCSYNEQYL+ F GHTAPVY I+WSPF+ DVFLSCSADWTIKLWH++  + +I+ Q+ +  V+SI+WSP  S+IFA  NE A+E+WNL  ST++P +VE +  + + +TSV F+E  + ++VGD+ G +H + L++ P  P N   Q  AL + +Q+CI  Q
Sbjct:    7 LAQSKKNLGQCLRKSALVL--GSRVSSCVSKKSEGD-KRQSRPSIRLIDANGADLTPLPLLTEDRRNKE-EKDISTE-FSQTSV--QSGSSLHITNPFAFTRS------FVSGSSPTGDSNSEVSDENVDRFRGYAEVKTLAQPQREVLSEADLNKLVDVKIAETDTFWIFDRAPTVTSQDADDAQQQTKRTAAYKALLASRAGNDRYMERGMNTSNNPVIPKSVQTMRIITHERAAMATVWDMADTFKEEISELSDNKVAEPTSPTEPGKHGKIRSTYQTDGLAGGTADQTNRTVLQDFAVTADPII-GATDSAGLGNSTTP------KDTMVSNSESDLFGFRYSAVTQTSFY---PKAMDILKLPRLVEDIDRMERALNVNTYYDKLLQYEAL-HLRTIMTPLTLDRSDTDPSSTGPKVPGMRTPSLDDNSAGQQTGAKHSNAGGTASGHSMGSTSQTGIPLHGKGVDVDSPVAATNPDTSLLWRYQCSLTKGRNVTDMAWNKENPNILAVGYGKFEFENQKKGLVCCWSLKFIEYPERFYETPSAVTAVGWSKIHSNLLAVGMFSGVIYVFDVRKNDPTPVIDTTHAAGRHLGAVRKVQWVVRQSGRAENLSEVLVSVSTDGRVTEWSVRKGFDSTGDCDYHTDLMVLKRSYVSAPGTVNKPKRSESLISRTAFGSCMAFNKRDPSIYVVGTEDGPIHKCSCSYNEQYLETFLGHTAPVYQIEWSPFVPDVFLSCSADWTIKLWHLDHTSALISIQTHISMVSSISWSPFHSLIFASANESALEIWNLDSSTIEPYVVETVSSD-SNMTSVLFSECSDSVLVGDNQGTVHVYGLQDFPETPTNTLSQAAALAEILQTCIKEQ 847          
BLAST of WD repeat domain 78 vs. TrEMBL
Match: gnl|BL_ORD_ID|19144722 (tr|A0A4E0R9X7|A0A4E0R9X7_FASHE WD repeat-containing protein 78 OS=Fasciola hepatica OX=6192 GN=D915_005125 PE=4 SV=1)

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 379/897 (42.25%), Postives = 529/897 (58.97%), Query Frame = 1
Query:  106 TRRNMNQSTIRMSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTXXXXXXXXXXXXENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKV-------------QSKPIAVDSSVPELTASKGGQQSRSPTVIDKT--------QETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKEL----MEE---------IKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQ------PH---------------------------------------LEP----LWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGA--GKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYP---KNQTEALDKTIQSCIASQ 2532
            TRRN+ QS  + ++     S+  S +SKK++ + KR  +  +RL+DANG D TPLPLL++DK+L ++E++  T+ +SQ S +  S SS   TNP  FT+S    S S  TA+S S  SDE  E        YTEVKT+ Q    IL + +LDK VD+V+ ET+T WIFD+ P + T+D +D+ +  K+N  Y+ LL SR GND+Y+ERGMNT     I+KS+QT+RI   +  SMAT+WD+ D      +E  +           +A P     E    V              ++PI   + + + +         +  + D T        ++T  +NS+SDLFG R S    S  + +Q    +IL+  ++      M+RALN+N Y++K+L+Y +L   K +    +E          ++   I  V+T DENS    T++A   A+  LKP  A +       PH                                       + P    LW+Y    TKGRNV+  AWNR++P+ILAV YG F++ +Q+ GLVCCWSLK I++PER +  PSG TA+ WSK HSNLLA+GMF+G I VFDVRK   E V+DT HA+GRH GPVR++ WVIR SGR+E  SEVL+S+S+DGRVTQW VRKGF+S+      DLM LKR     PG+   K K+ ++LIS+ A G   AFN ++P+IY+ G EEG IHKCSCSYNEQYLD F GHTA VY I+WSPF++DVFLSCSADWTIK+WH++ Q  +IN Q+ V  V+SI+WSP +S+IFA  NEGA+E+WNL  ST+DP ++E +  +   +TSV F+ES E +++GD+ G +H + L + PP P   ++Q   LD  +Q+CI  Q
Sbjct:   10 TRRNLGQSLRKSALVL--GSRVSSCVSKKSDPD-KRPSRPSIRLIDANGVDLTPLPLLTEDKRL-KDEREISTE-VSQTSLH--SGSSLHITNPFAFTKS--FISGSSPTADSHSETSDETGE----RYRGYTEVKTLAQPQREILSESDLDKLVDVVICETDTFWIFDLPPTVMTQDCEDAQQQLKRNAAYKALLASRLGNDRYMERGMNTLNCPFITKSVQTDRIILLETASMATIWDMQDTLMEQQQEGGRV----------DAKPPEAHTEHEKNVFMGTSNEVLEDGGPAEPIGRGAVLHDFSVVADHVPGSATALSDATMLGNSITPKDTMVSNSESDLFGFRYS--VTSQVNITQP-TLDILSLPKLQKDLNRMQRALNINTYYDKLLHYEDLHLRKIMSPTALERSDTDPPSIGMRAPGITAVATLDENSAGHGTQNAPGSAS--LKPAAAPTPVASNGLPHDSGLVMAAQTTSANPNVPKHPSIVTARNSELHGRSERTGVSPDTVLLWRYQCLMTKGRNVSDMAWNREDPNILAVGYGQFEFESQRKGLVCCWSLKYIEHPERFYETPSGVTAVGWSKIHSNLLAVGMFSGVIYVFDVRKNVAEPVIDTTHAAGRHFGPVRKILWVIRESGRAESLSEVLVSVSTDGRVTQWFVRKGFDST------DLMVLKRSYVTAPGSVNSKSKRNESLISRTAFGCSIAFNKREPSIYVVGTEEGPIHKCSCSYNEQYLDTFLGHTASVYEIEWSPFLSDVFLSCSADWTIKVWHLDHQQCLINIQTNVNVVSSISWSPHNSIIFASANEGALEIWNLDHSTIDPFVLETVSSDAN-MTSVLFSESSESVLIGDNQGSVHVYGLVDFPPAPDSAEDQPARLDSILQTCIGEQ 871          
BLAST of WD repeat domain 78 vs. TrEMBL
Match: gnl|BL_ORD_ID|23536920 (tr|A0A210QJC3|A0A210QJC3_MIZYE WD repeat-containing protein 78 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08769 PE=4 SV=1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 333/825 (40.36%), Postives = 494/825 (59.88%), Query Frame = 1
Query:  127 STIRMSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYT--------XXXXXXXXXXXXENEKDTPTDNISQGSFYTQS--ISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQY--------RNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAV--DSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQN 2541
            ST   S   ++AS+ +S+ +++AE  S    K PV+++D  G D T           +  +   + ++   TPTD +SQ S Y  +   +S  G  P  FTRS     S G   +S     DE  E ++     + +++  ++E    L + +L+K VD+ L ETETIW+ D+  I  + + D++A I+K+ + Y+ L+ SR GND+Y+ERGMNTF      K+IQTN+I +ND G  AT WD++D Y         N D  +E+    +  + +   S   T  +  S  Q KP+     S+V   +A+    QSR+ +   +   ++ A S+S +F +R++ V++  T     + ++IL +E      FIMER +N+N Y  K   YR      ++                         S  E A    +   A   P+++ LW Y    TKGRNV+   WN+ NPD++A+ YG F+++NQK GL+CCWSLKN ++PER +    G TAI +S+++ NLLA+G+++G +++++V+   DE +VD+ H +G+H  PV  + W+ +  G  +E +EVL+SIS+DGRVTQWS+RKGFES      +DLM+LKR+ TR+ G  K+KK +A IS++A G CF F+ +D NIYLAG EEGHIHKCSCSYNEQYLD++ GH  PVY ++WSPF+ND+FLSCSADW+I+LWH ER  P+++F S  KSV  + WSP+SS +FACVNEG VEVW+L LSTLDP IV N        T+VTF ++ EC++VGDS+G +  + LR MP  P+NQ EAL+  I++ +ASQLQ+
Sbjct:   49 STRSRSNILSSASR-KSMAAREAEKASMAG-KPPVQVIDEGGNDVTPIPLLSHDHTTVKKNQSNILDSSVGTPTDLMSQASIYNTANVTASTFGGGP--FTRS-VFSQSQGTGTDSMMGGDDEITEPSSEQ-TAWADIRHKREEVKETLTEADLEKEVDLTLTETETIWLLDLPTICVSTESDEAAGIKKRTETYQELIRSRVGNDRYMERGMNTFNEPPKFKTIQTNKIAYNDVGITATTWDMYDTYDEQDKENKENDDGGEEEGTISRPTSPKDGDSKEETGSQTTS--QDKPVLTREGSTVKIGSATAQSIQSRAES---RATMSSMAGSES-IFASRETGVSSMPTDLIALEEDKILKAENFKRDLFIMERVINLNTYQPKQASYRGFDIVPDI------------------------DSTSETANPTQQISVADMGPNVDRLWAYSCPMTKGRNVSCMTWNKLNPDLIAIGYGQFEFSNQKSGLICCWSLKNPEFPERVYTCKEGVTAIDFSRSNPNLLAVGLYDGGVAIYNVKSTQDEPIVDSFHLAGKHTAPVWHIRWIEKERGSGDERTEVLVSISTDGRVTQWSIRKGFES------YDLMRLKRMPTRM-GGKKEKKGEAFISRHAGGLCFDFHSRDANIYLAGTEEGHIHKCSCSYNEQYLDSYTGHNGPVYKMEWSPFVNDIFLSCSADWSIRLWHQERNKPILSFFSLNKSVYDVTWSPRSSTVFACVNEGRVEVWDLSLSTLDPQIVSNPS-SGAKQTAVTFAKNSECILVGDSEGQVTVYELRCMPEPPENQAEALNNVIKASLASQLQS 829          
BLAST of WD repeat domain 78 vs. TrEMBL
Match: gnl|BL_ORD_ID|23914878 (tr|K1Q316|K1Q316_CRAGI WD repeat-containing protein 78 OS=Crassostrea gigas OX=29159 GN=CGI_10007892 PE=4 SV=1)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 311/735 (42.31%), Postives = 445/735 (60.54%), Query Frame = 1
Query:  316 TPTDNISQGSFYTQS--ISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSS--VPELTASKGGQQSRSPTVIDK-------TQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQ 2487
            TPTD +SQ S Y      +S  G  P  FTRS     S+     S S M ++  E +    + + E++  ++E    L +++LDK V++ L ETETIW+ DM     + + +++A+I+K+N+ Y+ L  +R GND Y+ERGMNTF      K++QT +I   D G MA+ WD++D +   D+E    E  +EE   I+   +    ED  K  +KP   + S  V E +A         P+V  +       T  ++ A S+S +F +R++ V++  +  S  + E+I  SE      FIMER +N+N Y  K   YR+ P   ++  E+     K VS   +                          P+ + LW Y    T GRN++  +WN+ NPD++AV YG+F++++QK GL+CCW LKN DYPER F    G TA+ +SK + NLLA+GM++G +++++V    DE +VD  H  G+H  PV  ++W+ +  G  EE SEV++SIS+DGRVTQWS+RKGFE       +D+MKLKR  TR+ G  K+KK +A IS++A G CF F+ K+PNIY+AG EEGHIHKCSCSYNEQYL+ + GHT PVY I+WSPF++D+FLSCSADW+I+LWH ER  PV+NF S+ KSV  + WSPKSS +FACVNEGAVEVW+L +STLDP+I  N        TSV+F+++ +C++VGDS G L  + LR+MP  P NQ
Sbjct:   77 TPTDLMSQASIYNTGNVTASTFGGGP--FTRS---VFSASQGTTSDSMMGEDITEPSQDMSSAWAEIRHKREEVKETLTEDDLDKVVNLTLTETETIWLLDMPGTSVSNEAEEAAKIKKRNEEYQELKKNRVGNDLYMERGMNTFNEPAKYKTVQTTKITCVDTGIMASTWDMYDTFEQRDQEIRAKEKEEEEEGTISRPSSPKEGED-GKAGAKPQVGEPSGLVREGSAHSVRIDGAKPSVSGQPHSESRATMASSMAGSES-VFASRETGVSSVPSEMSAVEEEKIFKSENFQRDLFIMERVVNLNTYQPKQALYRDFPIIPDIDREVTEMGDKQVSMVSDMG------------------------PNFDRLWSYSCKLTNGRNISCMSWNKLNPDLIAVGYGEFEFSDQKSGLICCWCLKNPDYPERVFTCKEGVTALDFSKAYPNLLAVGMYDGGVAIYNVASMKDEPIVDNFHTPGKHTAPVWHIKWIEKERGSGEETSEVVVSISTDGRVTQWSIRKGFEC------YDIMKLKRTPTRM-GGKKEKKGEAFISRHAGGMCFDFHTKEPNIYVAGTEEGHIHKCSCSYNEQYLETYNGHTGPVYKIEWSPFVSDLFLSCSADWSIRLWHQERTQPVLNFFSSTKSVYDVVWSPKSSTVFACVNEGAVEVWDLSISTLDPIITNNPT-SGAKKTSVSFSKNSDCILVGDSKGELTVYQLRSMPEPPANQ 772          
BLAST of WD repeat domain 78 vs. Ensembl Cavefish
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 201.06 bits (510), Expect = 1.877e-54
Identity = 115/377 (30.50%), Postives = 190/377 (50.40%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACV-NEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQ 2487
            EF   +  L PLWK+     K  +V A  W     D+ AV  G + +  Q  G++  +SLKN  YPE  F   SG   +   K  S+L+A+G ++G++ V++++++  + +  +    G+H  PV Q++W         +++    SISSDGRV  W++ K          ++L+    I   + G+    +    +   A G+ F F+ +   ++L G EEG IHKCS  Y+ Q+L+ +  H   V  +KW+ F   VF+SCS+DWT+K+W    ++P+  F      V  +AWSP SS +FA V  +G V V++L ++  + +  + +  + T LT + F      +IVGD  G + +      LR  P   K Q
Sbjct:  251 EFREQEGTLLPLWKFQYDKAKHLSVTALCWLCNYKDLFAVGLGSYKFTKQGRGMLLFYSLKNSTYPEYIFTTLSGVMCLDIHKQLSSLVAVGFYDGSVGVYNLKEEGPQPIYKSTAKMGKHTDPVWQVKW----QKDDIDNNHNFFSISSDGRVVSWTLVK----------NELVFTDIIRLSVEGSISNGQEGMQLPAMACGTSFDFHQQIDYLFLIGTEEGKIHKCSKCYSSQFLETYAAHNMAVDAVKWNQFHPKVFISCSSDWTVKIWDHTIKSPMFTFDLNA-PVGDVAWSPYSSTVFAAVTTDGKVHVFDLSINKYEAICQQAVAAKKTKLTHIEFNPVYPIIIVGDDRGYVTSLKLSPNLRRKPKEKKGQ 612          
BLAST of WD repeat domain 78 vs. Ensembl Cavefish
Match: dync1i2a (dynein cytoplasmic 1 intermediate chain 2 [Source:NCBI gene;Acc:103032060])

HSP 1 Score: 129.798 bits (325), Expect = 8.495e-31
Identity = 102/363 (28.10%), Postives = 165/363 (45.45%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLK-NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDV-----FLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNE-GAVEVWNLQLSTLDPLIVENICPEYT-VLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKN 2484
            ++K R V    W+ Q P++L   Y + + A  +P G+   W++K     PE  F   S   + ++ K H NL+  G ++G I ++D R      V  T  ++  H  PV    + + V G    H+  LISIS+DG++  WS+             D++   + +  +    KQ K  A+ S        +F   D N ++ G E+G ++  C         + F GH  P+ GI        V     FL+ S DWT+KLW  +   P+ +F+     V  + WSP    +FACV+  G +++WNL   T  P    +I  E T  L  + + +SG  + VGDSDG +  + +      P+N
Sbjct:  245 WSKHRVVTCLDWSPQYPELLVASYNNNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSAAFVKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSASAHTHPV----YCVNVVGTQNAHN--LISISTDGKMCSWSL-------------DMLSQPQDSMEL--VFKQSKAVAVTS-------MSFPLGDVNNFVVGSEDGSVYTACRHGSKAGISEMFEGHHGPITGIHCHTAAGPVDFSHLFLTSSFDWTVKLWSTKNNKPLYSFEDNSDYVYDVMWSPVHPALFACVDGVGHLDLWNLNNDTEVP--TASITVEGTPALNRLRWAQSGREIAVGDSDGQILIYEVGEQIAVPRN 577          
BLAST of WD repeat domain 78 vs. Ensembl Cavefish
Match: dync1i2a (dynein cytoplasmic 1 intermediate chain 2 [Source:NCBI gene;Acc:103032060])

HSP 1 Score: 129.413 bits (324), Expect = 1.044e-30
Identity = 102/363 (28.10%), Postives = 165/363 (45.45%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLK-NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDV-----FLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNE-GAVEVWNLQLSTLDPLIVENICPEYT-VLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKN 2484
            ++K R V    W+ Q P++L   Y + + A  +P G+   W++K     PE  F   S   + ++ K H NL+  G ++G I ++D R      V  T  ++  H  PV    + + V G    H+  LISIS+DG++  WS+             D++   + +  +    KQ K  A+ S        +F   D N ++ G E+G ++  C         + F GH  P+ GI        V     FL+ S DWT+KLW  +   P+ +F+     V  + WSP    +FACV+  G +++WNL   T  P    +I  E T  L  + + +SG  + VGDSDG +  + +      P+N
Sbjct:  263 WSKHRVVTCLDWSPQYPELLVASYNNNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSAAFVKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSASAHTHPV----YCVNVVGTQNAHN--LISISTDGKMCSWSL-------------DMLSQPQDSMEL--VFKQSKAVAVTS-------MSFPLGDVNNFVVGSEDGSVYTACRHGSKAGISEMFEGHHGPITGIHCHTAAGPVDFSHLFLTSSFDWTVKLWSTKNNKPLYSFEDNSDYVYDVMWSPVHPALFACVDGVGHLDLWNLNNDTEVP--TASITVEGTPALNRLRWAQSGREIAVGDSDGQILIYEVGEQIAVPRN 595          
BLAST of WD repeat domain 78 vs. Ensembl Cavefish
Match: dync1i2a (dynein cytoplasmic 1 intermediate chain 2 [Source:NCBI gene;Acc:103032060])

HSP 1 Score: 127.102 bits (318), Expect = 6.889e-30
Identity = 100/347 (28.82%), Postives = 159/347 (45.82%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLK-NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDV-----FLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNE-GAVEVWNLQLSTLDPLIVENICPEYT-VLTSVTFTESGECLIVGDSDG 2436
            ++K R V    W+ Q P++L   Y + + A  +P G+   W++K     PE  F   S   + ++ K H NL+  G ++G I ++D R      V  T  ++  H  PV    + + V G    H+  LISIS+DG++  WS+             D++   + +  +    KQ K  A+ S        +F   D N ++ G E+G ++  C         + F GH  P+ GI        V     FL+ S DWT+KLW  +   P+ +F+     V  + WSP    +FACV+  G +++WNL   T  P    +I  E T  L  + + +SG  + VGDSDG
Sbjct:  263 WSKHRVVTCLDWSPQYPELLVASYNNNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSAAFVKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSASAHTHPV----YCVNVVGTQNAHN--LISISTDGKMCSWSL-------------DMLSQPQDSMEL--VFKQSKAVAVTS-------MSFPLGDVNNFVVGSEDGSVYTACRHGSKAGISEMFEGHHGPITGIHCHTAAGPVDFSHLFLTSSFDWTVKLWSTKNNKPLYSFEDNSDYVYDVMWSPVHPALFACVDGVGHLDLWNLNNDTEVP--TASITVEGTPALNRLRWAQSGREIAVGDSDG 579          
BLAST of WD repeat domain 78 vs. Ensembl Cavefish
Match: dync1i2b (dynein, cytoplasmic 1, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-090121-1])

HSP 1 Score: 123.25 bits (308), Expect = 9.795e-29
Identity = 98/364 (26.92%), Postives = 164/364 (45.05%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLK-NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIKW----SPF-MNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNE-GAVEVWNLQLSTLDP---LIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPK 2481
            ++K R V    W+ Q P++L   Y   + A  +P G+   W++K     PE  F   S   + ++++ H NL+  G ++G I ++D R      V  T  ++  H  PV    + + + G    H+  LISIS+DG++  WS+             D++   + +  +    KQ K  A+ S        +F   D N ++ G E+G ++  C         + F GH  PV G+       P   + +F++ S DWT+KLW      P+ +F+     V  + WSP    +FACV+  G +++WNL   T  P   + VE        L  V +  SG  + VGDS+G +H + +      P+
Sbjct:  233 WSKHRVVTCLDWSLQYPELLVASYSSNEEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSAAFARFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSASAHTHPV----YCVSLVGSQNAHN--LISISTDGKMCSWSL-------------DMLSTPQDSLEL--VFKQSKPVAVTS-------MSFPLGDVNNFVVGSEDGTVYTACRHGSKAGISEMFEGHHGPVTGLDCHMAAGPVDFSHLFVTSSFDWTVKLWSTRNTKPLYSFEDNSDYVYDVMWSPAHPALFACVDGVGHLDLWNLNNETEVPTASVTVEG----NPALNRVRWANSGREVAVGDSEGQVHIYDVGEQIAVPR 564          
BLAST of WD repeat domain 78 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000105.1 (pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 gene:ENSPMAG00000000091.1 transcript:ENSPMAT00000000105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 214.542 bits (545), Expect = 8.996e-64
Identity = 110/254 (43.31%), Postives = 163/254 (64.17%), Query Frame = 1
Query: 1729 RHLGPVRQLEWV-IRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIA----TRIPG--AGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTES-GECLIVGDSDGILHTFALRNM 2466
            +H+G V Q++WV +   G  E+  E L SIS+DGRVT+W+VRKG +        DLM+LKR       R  G    +++K +ALI + A G+C  F+P+D N+YLAG EEG IH+CSCSY+EQ+L ++  H  PVY + WSPF  +VFLSCS+DW+++LW ++  +PV+  Q   ++V  +AWSP S  + A +   A+ VW+L  STLDP++V +       +T V F+ + G CL+VGDSDG +  + L+ +
Sbjct:    1 KHMGAVWQVQWVRLEQGGGGEDRGETLTSISADGRVTRWAVRKGLDC------QDLMRLKRTGEGRTRRTAGVEGQRERKNEALIWRLACGTCVDFHPQDSNVYLAGTEEGFIHRCSCSYSEQHLQSYSAHQGPVYRVLWSPFEPEVFLSCSSDWSVRLWRVDLTSPVLTLQCGSQAVLDVAWSPHSPTLLAALTAEALHVWDLSSSTLDPVLV-SPGRRGVHMTRVAFSRAPGHCLLVGDSDGHVTLYQLKGL 247          
BLAST of WD repeat domain 78 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004773.1 (pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 gene:ENSPMAG00000004320.1 transcript:ENSPMAT00000004773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 1.199e-53
Identity = 115/377 (30.50%), Postives = 193/377 (51.19%), Query Frame = 1
Query: 1396 LEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHA-SGRHLGPVRQLEWVIRVSGRSEEHSEV-LISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIP-GAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLW-HIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENI-CPEYTVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQTEA 2496
            L PLW++     +   V A  WN    D+  V +G +++  Q  G +  ++LKN  +PE  F   SG   +       +L+A G+++GT++V+++    D        A SG+H  PV Q++W      R +  + +   S+SSDGRV  W++ K          ++L+ +  +   +  G       D  +   +SG+ F F+ +  +++L G E+G I KCS +Y+ Q+LD +  H   V  ++W+PF   VF SCSADW++K+W H  +  PV  F     +V  +AW+P SS +FA V  +G V V+++ ++  + L  +++   ++T LT V F  S   LIVGD  G++ +      LR +P   K Q  A
Sbjct:  138 LLPLWRFQCEQARRLTVTALCWNPCYHDLFVVGFGSYEFQKQGRGALVVFTLKNPSFPEFVFATESGVMGVDVHDARPHLVAAGLYDGTVAVYNLAAPVDAQPSHRSSARSGKHTDPVWQVKW-----QRDDLDNNLNFFSVSSDGRVASWTLIK----------NELLCMDVVKLSVEEGQAAPLGEDPALETLSSGTSFDFHRQIDHMFLVGTEDGTILKCSKAYSSQFLDTYDAHHMAVEAVRWNPFHTRVFASCSADWSLKIWEHTAKWAPVFTFDLGA-AVGDVAWAPYSSTVFAAVTADGKVHVFDVNVNKYEALCTQSVSTKKHTKLTHVAFNPSQPVLIVGDDRGVVSSLKLSPNLRRVPKEKKGQEAA 498          
BLAST of WD repeat domain 78 vs. Ensembl Sea Lamprey
Match: dync1i2a (dynein, cytoplasmic 1, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-060929-1086])

HSP 1 Score: 135.961 bits (341), Expect = 1.723e-33
Identity = 106/368 (28.80%), Postives = 168/368 (45.65%), Query Frame = 1
Query: 1414 YHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLK-NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIK----WSPF-MNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNE-GAVEVWNLQLSTLDPLIVENI--CPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKN 2484
            Y   ++K R + +  W+ Q P++L   Y + + +  +P G+   W+ K     PE  F   S   + S+++ H NL+  G ++G I ++D R      V  T  ++  H  PV    + + V G    H+  LIS+S+DGR+  WS+             D++   + +  +    KQ K+ A+       +C  F   D N ++ G EEG ++  C         + F GH  PV GI       P   + +FL+ S DWTIKLW  +   P+ +F+     V  + WSP    +FA V+  G +++WNL   T  P     I  CP    L  V +T SG  L VGDS+G L  + +      P+N
Sbjct:  235 YDERWSKRRVITSLDWSAQYPELLVATYNNNEDSPHEPDGVALVWNTKFKKTTPEYVFHCQSAVMSASFARFHPNLVVGGTYSGQIVLWDNRSNRMTPVQRTPLSAAAHTHPV----YCVNVVGTQNAHN--LISVSTDGRMCSWSL-------------DMLSQPQDSMEL--VHKQSKSIAV-------TCMTFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEVFEGHQGPVTGIHSHSAAGPIDFSHLFLTSSFDWTIKLWTTKNNKPLYSFEDNSDYVYDVMWSPVHPSLFASVDGMGRLDLWNLNSDTEVPAASVTIDGCP---ALNRVRWTHSGRELAVGDSEGHLWIYEIGEQLALPRN 571          
BLAST of WD repeat domain 78 vs. Ensembl Sea Lamprey
Match: wdr34 (WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-070928-9])

HSP 1 Score: 80.8777 bits (198), Expect = 3.594e-16
Identity = 86/370 (23.24%), Postives = 159/370 (42.97%), Query Frame = 1
Query: 1429 TKGRNVAAFAWNRQNPDILAVCYG---DFDYANQKPGLVCCWSLKN----IDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISS--DGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASG-SCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQ--------------YLDNFFGHTAPVYGIKWSPF-MNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFAC-VNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLI-VGDSDGILHTFAL 2457
            T+G    A  W+     ++ V +G   D D+  +   ++C W++       D P+RT  +P     +S+  T   ++A G  +G + V+D  ++ D  +  +   +  H  PV Q++WV      S   S VL+ +S+  DG V  W V    E S      +  ++  +A  +P      K   + S+   G + F+ + +D ++ +AG+E G + +C     EQ               L  F  H  PVY + +SPF    V +    D  ++++     +PV+  ++A   V + AWSP   ++ A    EG + +++L +    P+      P  + ++ + F      L+ VG   G    + L
Sbjct:  132 TRGLAATAVGWSCTG-AMIGVAFGRLNDGDWTVEN-SMICLWNVCRRGLIPDMPDRTLDVPGCLLCLSFHPTWPAVIAGGASSGEVFVWDTSQEEDPLLAHSGVNATTHQQPVTQVQWV-----HSPGQSRVLLLMSAGLDGCVMTWRV----ELSTRKITPN-NRVVLLAKHLPSTSTLSKK--VQSELPLGITAFSLS-EDSSMCVAGLEGGQVVRCLLEPLEQPTRKDQPPLNRKSPALFPFVKHQGPVYAVNFSPFNRRGVSVQAGTDGQVRVFSALLHDPVLVVRAATSYVLAAAWSPARPLVLAASTAEGELLLFDLAIKDSGPVHCIQASPSLSPVSCLAFNPKQPGLLAVGLQSGAARVWTL 486          
BLAST of WD repeat domain 78 vs. Ensembl Sea Lamprey
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 72.4034 bits (176), Expect = 9.210e-14
Identity = 64/264 (24.24%), Postives = 112/264 (42.42%), Query Frame = 1
Query: 1663 ISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGR-VTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYN---EQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIE-RQNPVINFQSAVKSVNSIAWSP-KSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDG 2436
            ++ +D RK      V+T      H  PV ++ W    +G          S S+DG+ V  W VR+  E            ++R+A         KK D  +      +C  F P  P  ++ G E+G +  C+       E+ +  + GH  PVY ++  PF    FL+   DWT ++W  E R + ++  +  +  +    WSP + +V F    +G+++VW+L     +  +   +  E   L S+   ++G  L  G  +G
Sbjct:    1 VAYWDTRKGC--QPVETTAIEHSHRDPVYKVIWQQSKTGTE------FFSCSTDGQHVLWWDVRRMTEP-----------MERLAL-----DPAKKGD--LDNAMGATCLEFEPTMPTKFMVGTEQGMVVSCNRKAKTPAEKIVGTYSGHHGPVYALQRHPFFPKNFLTI-GDWTARIWSEEIRDSSIMWTKYHMSYLTDGCWSPVRPAVFFTTKMDGSLDVWDLLFKQNNATLTLQVSDE--PLHSLRIQDNGRFLACGSQNG 235          
BLAST of WD repeat domain 78 vs. Ensembl Yeast
Match: SWD2 (Subunit of the COMPASS (Set1C) histone H3K4 methyltransferase complex; required for Set1C stability and optimal activity; COMPASS methylates histone H3 on lys 4 and is involved in telomeric silencing; subunit of CPF (cleavage and polyadenylation factor), a complex involved in RNAP II transcription termination [Source:SGD;Acc:S000001501])

HSP 1 Score: 56.225 bits (134), Expect = 8.593e-9
Identity = 42/124 (33.87%), Postives = 66/124 (53.23%), Query Frame = 1
Query: 2074 QYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEV--WNLQLSTLDPLIVENIC-PEYTVLTSVTFTESGECLIVGDSDG 2436
            QYL  F GH A V  +K +P +ND FLS S D +++LW ++   P +   S V   N IA+ P S ++FA  N    E+  +NL+     P ++  I    ++    + F+ +G+ L+VG S G
Sbjct:  104 QYLRYFSGHGALVNDLKMNP-VNDTFLSSSYDESVRLWDLKISKPQVIIPSLVP--NCIAYDP-SGLVFALGNPENFEIGLYNLKKIQEGPFLIIKINDATFSQWNKLEFSNNGKYLLVGSSIG 223          
BLAST of WD repeat domain 78 vs. Ensembl Yeast
Match: YMR102C_mRNA (Protein of unknown function; transcription is activated by paralogous transcription factors Yrm1p and Yrr1p along with genes involved in multidrug resistance; mutant shows increased resistance to azoles; not an essential gene; YMR102C has a paralog, DGR2, that arose from the whole genome duplication [Source:SGD;Acc:S000004708])

HSP 1 Score: 47.7506 bits (112), Expect = 6.512e-6
Identity = 38/128 (29.69%), Postives = 60/128 (46.88%), Query Frame = 1
Query: 2098 HTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIF--ACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFT-ESGECLIVGDSDGILHTFALRNMPP 2472
            H   V  I WS   N+  LS S D T+KLWH +R+N +  F      V  + + P     F   C++     +W++     D +  E  C +  ++TSVT + E G+  I+G  +G +H    R + P
Sbjct:  277 HVQDVLDINWSK--NNFILSASMDKTVKLWHPDRKNSLKTFIHP-DFVTCVEFHPTDDRFFISGCLDH-KCRLWSI---LDDEVSFEYDCQD--LITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTP 395          
BLAST of WD repeat domain 78 vs. Ensembl Nematostella
Match: EDO34474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP67])

HSP 1 Score: 344.354 bits (882), Expect = 7.056e-112
Identity = 158/305 (51.80%), Postives = 222/305 (72.79%), Query Frame = 1
Query: 1564 YPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIR-VSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIAT---RIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNM 2466
            YPER F L +G TA+ +S  H NLLA+G+++GTI+++++R   D   +D+  + G+H  PV QL+WV R   G  +EH E+L+SIS+DGRVT+WS+RKGFES+      DLMKLKRI     +  G G ++K+DALIS++A+G CF F+P D NIYLAG EEGH+HKCSCSYNEQYL++F GHT P+Y +KW+P   + FL+CSADW+++LWH +RQ PV++F S+ KSVN I+WSP  + +FACVN+ AVE+W+L L+TLDP +V  +  +   LT+V F  +   ++VGDS+G +  + LR M
Sbjct:    9 YPERVFHLNTGVTALDFSGAHPNLLAVGLYDGTIAIYNIRCTDDSPALDSSESVGKHTSPVWQLQWVDREQGGNGDEHDEILVSISADGRVTKWSIRKGFESA------DLMKLKRINVTKQKAGGGGSERKSDALISRFAAGFCFDFSPNDANIYLAGTEEGHVHKCSCSYNEQYLESFHGHTGPIYQVKWNPLYPEAFLTCSADWSVRLWHCDRQFPVMSFLSSTKSVNDISWSPDCATLFACVNDRAVEIWDLSLNTLDP-VVSFVPVQDCKLTTVLFALNTATILVGDSEGQVTVYQLRGM 306          
BLAST of WD repeat domain 78 vs. Ensembl Nematostella
Match: EDO36198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC7])

HSP 1 Score: 202.216 bits (513), Expect = 3.889e-55
Identity = 115/365 (31.51%), Postives = 187/365 (51.23%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPG-LVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIF-ACVNEGAVEVWNLQLSTLDPLIVEN-ICPEYTVLTSVTFTESGECLIVGDSDGILHTFAL 2457
            EF      L PLWK+    +K   V +  WN    D+ +V +G +D+  Q  G  +  +SLKN  YPE   +  SG   +     H ++LA G ++G+++V+ + +K ++ +  +   +G+H  PV Q++W         +++    S+SSDGRV QW++ K   S     H D++ L+         G Q      I     G+ F F+     ++L G EEG IHKCS +Y   YLD F  H   VY ++W+PF    F+SCSADWT+K+W      P+  F     SV  + W+P +S +F AC  +G + V++L ++  +PL  ++ +  + + LT + F      LIVGDS G +++  +
Sbjct:  279 EFREPDGTLLPLWKFSWEKSKRLAVTSLCWNPIYNDLFSVAHGSYDFLKQDGGGAMSFFSLKNPSYPEYGIKTESGVMCLDIHPEHPHMLAAGFYDGSVAVYSISEKMNKPLHQSTAKTGKHTDPVWQVKW----QKDDLDNNLNFFSVSSDGRVVQWTIVKSELS-----HTDIINLELPEKSEGPEGTQ------IKSLGCGTSFDFHKTINYLFLVGTEEGKIHKCSKTYTSTYLDTFDAHHMSVYSVRWNPFHPKTFISCSADWTVKIWDHTHLEPMFTF-DLNSSVGDVQWAPYASTVFAACTADGKIHVYDLNVNKYEPLCEQSVVAKKKSKLTHLAFNPDHPILIVGDSRGYVNSLKV 627          
BLAST of WD repeat domain 78 vs. Ensembl Nematostella
Match: EDO49079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI29])

HSP 1 Score: 139.813 bits (351), Expect = 4.631e-35
Identity = 109/382 (28.53%), Postives = 179/382 (46.86%), Query Frame = 1
Query: 1414 YHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLKNIDY-PERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIKW----SPF-MNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKN-QTEALDKTIQSCIAS 2529
            Y   +++ R V    W+ Q P++L   Y + + A  +P G+   W+LK     PE  F   S   + +++K H NL+  G ++G I ++D R      V  T  ++  H  PV    + + V G    H+  LIS+S+DG++  WS+    +  +S      M+L+          KQ K+ A+       +C +F   D N ++ G EEG ++  C         D F GH  PV GI       P   + +FL+ S DWT+KLW  +   P  +F+     +  + WSP    +FA V+  G +++WNL   T  P I        T L +V +T+SG+ + VGD DG ++ + +      P+N +   L +T+Q   A+
Sbjct:  125 YDERWSRHRTVTCLDWSNQYPELLVASYNNNEDAPHEPDGVALIWNLKFAKTTPEYIFHCQSAVMSATFAKFHPNLIIGGTYSGQIVLWDNRSSKRTPVQRTPLSATAHTHPV----YCVNVVGTQNAHN--LISVSTDGKMCSWSLDMLSQPQDS------MELQY---------KQSKSVAV-------TCMSFLAGDVNNFVVGSEEGTVYTACRHGSKAGISDVFEGHYGPVTGIDTHSASGPIDFSHLFLTSSFDWTLKLWSHKSPRPYYSFEDNGDYIYDVKWSPIHPALFATVDGTGRLDLWNLNSDTEVP-IASTATESLTALNNVQWTQSGQQISVGDDDGRVYIYDVGEQLATPRNDEWSRLQRTLQDIQAN 477          
BLAST of WD repeat domain 78 vs. Ensembl Nematostella
Match: EDO43231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ65])

HSP 1 Score: 109.383 bits (272), Expect = 5.500e-25
Identity = 81/368 (22.01%), Postives = 172/368 (46.74%), Query Frame = 1
Query: 1444 VAAFAWNRQNPDILAVCYGDFDYAN---QKPGLVCCWSLK----NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASG------SCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDN--------------FFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFA-CVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRN 2463
            + + +WN     ++A  YG  D+ +    K  L C W+L     N++  + T  L S   ++++      L+A G FNG + ++D+  + +  V  +   +  H  PV ++ W++    + +++   ++S S DG+V  W V    ES +         L+ +   I   G   ++  L +  A G      +  +F+ +D  +++ G E G I KCS +     + N              F  H  PV+ +  SP+  ++FL+C  D TI+L+ + +  P+++ + A   + +I WSP   ++F+    +G + +++++++ ++P+   ++  +  V T        + +  GDS+G++  + L +
Sbjct:  124 ITSLSWNSTG-SVIAAAYGRLDHEDWCTHKSSL-CTWNLDRRGINVNKADTTVDLSSCLLSLAFHPKSPALIAGGTFNGEVHLWDLSCEDEMLVASSGMGNDSHREPVNKIMWLLDPDSKGKKYQ--ILSASGDGKVLLWQVPP-IESQD---------LRLVGGYILQTGAVPRS--LRTSKAKGDMEMGVTTLSFSHEDKTLFVLGSEAGGIFKCSVNSRGPPVGNVTSSVPLGSPVTFAFAPHVGPVFSVNCSPYHRNLFLTCGTDGTIRLYTMLQAKPLLSLEPAAGYLFAIRWSPVRPLVFSVATGDGRLLIYDMKVNHINPVTTIDVSDKKPVHTLEYNIHRRQLVATGDSEGVIKIWRLSD 475          
BLAST of WD repeat domain 78 vs. Ensembl Nematostella
Match: EDO40075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B8])

HSP 1 Score: 90.8929 bits (224), Expect = 6.835e-19
Identity = 79/349 (22.64%), Postives = 140/349 (40.11%), Query Frame = 1
Query: 1438 RNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVC----CWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYN---EQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIE-RQNPVINFQSAVKSVNSIAWSP-KSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFAL 2457
            R   + +W       LAV Y   ++  QK   +C     W + N   P+   +  S    + ++    +LL  G +NG +  +D RK S    V+       H  P+ +  ++   SG          S S+DG+V  W +RK  E +ES     L+   +   R  G                G    F P  P  ++ G E+G +  C+       ++ + ++ GH  PVY ++ +PF    FL+   DW  ++W  + R++ ++  +  +  +    WSP +  V F    +G ++VW+       P +   +C     L S+   + G  +  G  DG +    L
Sbjct:  162 RTATSISWYPDGTQKLAVAYSVLEF--QKSTDICMDSYIWDIDNPTKPDMVLKPVSPLICLEYNPKDPHLLIGGCYNGQLGFWDTRKGS--HPVEMTPIEKSHRDPIYKTIFLQSKSGTD------CFSTSTDGQVLWWDIRKLGEPTESL----LLCPNKKDPRPLG----------------GVSLEFEPTMPTKFMVGTEQGSVLSCNRKAKTPADKIVASYAGHYGPVYSVQRNPFFPKNFLTI-GDWQARIWSEDLRESSIMWTKCGMSYLTDGCWSPSRPGVFFTTKMDGTLDVWDCMFKQNCPTLSIQVCD--MSLNSLRVQDHGRLVACGSHDGTVTLLEL 477          
BLAST of WD repeat domain 78 vs. Ensembl Medaka
Match: wdr78 (WD repeat domain 78 [Source:NCBI gene;Acc:101174321])

HSP 1 Score: 328.561 bits (841), Expect = 8.556e-100
Identity = 200/613 (32.63%), Postives = 315/613 (51.39%), Query Frame = 1
Query:  712 DKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRS-KVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESV-VDTKHASGRHLGPVRQLEWVIRVSGR-SEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGS-CFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQ 2538
            DKY++    T      +K +Q++ +   DAG   +   ++D                            T +E+R  K + KPI+VD ++  + +  GG         +++  T S  +   +  + +       TH  +   E I  S++  +S  ++E+ +  +    ++  YR LP  K+ + E++ +       E  ++E S+T                   P LE LW +    T+G +V++ AWN++NPD+LAV YG+FD  N++ GLVCCWSLKN  +PER  R  S  T++ +S T  + LA+G+F+G+I+++D++     S+ +D+     RHLGPV QL W  +  G  +EE  EVLIS+ +DGR+ +W V  G     +  H +LMKLKR   + P A   +     +      + C  F+P +P IYL G  EG IHKCSCS N+QYLD +  H   V  + W P  +D+FLSCSAD TI+LW   + NP+++F +  K V+ I WSPK + +FA V +  +EVW+L LS L P+IV+   P    L S+ F    +C++VGDS G +  + LRN+      Q   L   + S  +S L+
Sbjct:  206 DKYVDGSSQTLHGTSKNKHVQSDGLFLVDAGIAVSTSIMYDD---------------------------TELEERQDKPEPKPISVDFTL--VDSDDGGSLLSPLRSAERSMSTGSMTTAVSVSSSLKDIEICENTH--KPVLELIRLSKKFQHSLLVVEKTILQSLLQPQLAVYRQLPSLKDWIVELERE-------EQRDAEISET-------------------PALEGLWAFSCELTRGFSVSSMAWNKKNPDLLAVGYGEFDSTNERAGLVCCWSLKNPTWPERVVRCESAVTSLDFSATRPSHLAVGLFDGSIAIYDIQNPDSISLFLDSSKCPSRHLGPVWQLRWNQQEFGLPAEERLEVLISVGADGRIIKWVVCTG-----NLGHTELMKLKRTIYKNPDAKTTESISQSLISSLIPALCLDFHPTEPGIYLTGTWEGLIHKCSCSNNQQYLDTYRKHYCAVNYVAWCPLSDDIFLSCSADCTIQLWTQNQHNPMLSFSTTRKVVHDIKWSPKWATVFAAVYDEQLEVWDLNLSCLSPVIVQPALPGVR-LASLLFASHTDCVVVGDSCGQVTVYHLRNLGVGGSKQVNILHDLLHSAASSTLK 755          
BLAST of WD repeat domain 78 vs. Ensembl Medaka
Match: ENSORLT00000002152.2 (WD repeat-containing protein 78 [Source:NCBI gene;Acc:101160807])

HSP 1 Score: 271.166 bits (692), Expect = 1.370e-78
Identity = 149/445 (33.48%), Postives = 247/445 (55.51%), Query Frame = 1
Query: 1141 EILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTK-HASGRHLGPVRQLEWVIRVSGRSE-EHSEVLISISSDGRVTQWS-VRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKT-DALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRN 2463
            E+L SE       +ME+ +    ++ ++  +R LP  +  ++          S   E+ +S+  +  EE ++S          P ++PLW +    T GR + +  WN++N +ILAV Y D D ++ +   +CCWSL N  +P+R F  PS   ++ +S +    LA+GM++G++++++V+ +   + V T      RHL PV Q+ W  + S  S  E  EVL+S+S+DGR++ W       E        DLMK++RI     G G  K   + ++S+ + G C  F+PK+ +IYL G  +G IHKCS + N+Q+LD++  H   V  I+WSPF  D+FLSCS+D TI+LW     +P+++F+S    V ++ WSP+ S +FA +    VEVW L  + L P++V +     T LT++ F    +C++VGDS+G +  + L+N
Sbjct:  319 EVLLSESFQKILLVMEKTIATILHWPELAAFRQLPALEGELQS---------SLHPEDLDSAVKQVHEEESSS----------PTIKPLWTFDSELTTGRMITSMTWNKKNLNILAVSYSDCDPSSSRASFICCWSLNNPLWPQRIFSCPSRVASMDFSSSDHGHLAVGMYDGSVAIYNVQIQDRGACVATSSKCPNRHLRPVWQVAWNKQESKFSGLEAEEVLVSMSADGRISMWQRCNNHLECI------DLMKIRRIHDDKRGNGVSKMVGETILSEVSPGHCLDFHPKESDIYLVGSWDGLIHKCSLNNNQQFLDSYQKHLLAVNDIQWSPFSPDLFLSCSSDCTIQLWRHTCLSPLLSFKSVHSQVCAVRWSPERSTVFAAIYRQQVEVWELSSNILSPVVVHHAAAGVT-LTALLFARGTDCVLVGDSEGKVTVYQLKN 737          
BLAST of WD repeat domain 78 vs. Ensembl Medaka
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 145.976 bits (367), Expect = 4.821e-37
Identity = 108/387 (27.91%), Postives = 178/387 (45.99%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQK-PGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQY------ASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTV------LTSVTFTESGECLIVGDSDGILHTFALR-NMPPYPKNQ 2487
            EF   +  L PLW +    TK   V+A  WNR+  D+ AV  G  DY +Q+  G+V  +SLKN  YPE  ++  SG   +      S L+A G ++G ++V++++ +  + V  +   +G+H+ PV QL W  +    +  H+    S+S DG++  W+                  L ++   +           + SQY            +F+P    +Y   +      +CS +Y    ++ +  H   V  +KW+PF   VF+SCS D T+K+W      P+ N     + V  +A+SP +S +FA V   G V  +++ +S     I E IC +  V      LT + F      +I+GD  G +H+F L  N+   PKN+
Sbjct:   69 EFIGHEGTLMPLWNFRYKGTKHLTVSALCWNRRYLDMFAVGMGTEDYFDQQCGGMVLIYSLKNPTYPEYAYKTASGVRCVDIHPHKSYLVAAGFYDGNVAVYNLKVEKLKPVCASSPETGKHMDPVIQLCW--QKDDINNNHN--FYSVSLDGQIVSWT------------------LVKVNMHV----------YVFSQYLEVLQLYLLLNLSFDP----LYGQILVFFFFFQCSMTYTGHPMEVYDAHLLSVGTVKWNPFHPKVFISCSCDMTVKIWDHTVTTPISNIDLK-EPVEDVAFSPHTSTVFAAVTRRGTVYFYDVSIS-----IYEAICQQEVVNKRKGQLTKLEFNPIHLIIIIGDGKGCIHSFKLSPNLRKRPKNK 413          
BLAST of WD repeat domain 78 vs. Ensembl Medaka
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 134.806 bits (338), Expect = 2.582e-33
Identity = 109/394 (27.66%), Postives = 171/394 (43.40%), Query Frame = 1
Query: 1372 EFAVSQPHLEPLWKYHVSFTKGRNVAAFAWN---------RQNPDIL----AVCYGDFDYANQK-PGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTV------LTSVTFTESGECLIVGDSDGILHTFALR-NMPPYPKNQ 2487
            EF   +  L PLW +    TK   V+A  W          ++N  I     +V     DY +Q+  G+V  +SLKN  YPE  ++  SG   +      S L+A G ++G ++V++++ +  + V  +   +G+H+ PV QL W  +    +  H+    S+S D   T             DFH D+                                      PN++L G  EG I KCS +Y    ++ +  H   V  +KW+PF   VF+SCS D T+K+W      P+ N     + V  +A+SP +S +FA V   G V  +++ +S     I E IC +  V      LT + F      +I+GD  G +H+F L  N+   PKN+
Sbjct:   70 EFIGHEGTLMPLWNFRYKGTKHLTVSALCWMQSIHTCTNLKKNVFICVFVSSVLLFPEDYFDQQCGGMVLIYSLKNPTYPEYAYKTASGVRCVDIHPHKSYLVAAGFYDGNVAVYNLKVEKLKPVCASSPETGKHMDPVIQLCW--QKDDINNNHN--FYSVSLDVSCTS-----------IDFHKDI--------------------------------------PNLFLVGTLEGMILKCSMTYTGHPMEVYDAHLLSVGTVKWNPFHPKVFISCSCDMTVKIWDHTVTTPISNIDLK-EPVEDVAFSPHTSTVFAAVTRRGTVYFYDVSIS-----IYEAICQQEVVNKRKGQLTKLEFNPIHLIIIIGDGKGCIHSFKLSPNLRKRPKNK 404          
BLAST of WD repeat domain 78 vs. Ensembl Medaka
Match: dync1i2b (cytoplasmic dynein 1 intermediate chain 2 [Source:NCBI gene;Acc:101158306])

HSP 1 Score: 131.339 bits (329), Expect = 2.365e-31
Identity = 102/361 (28.25%), Postives = 162/361 (44.88%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKP-GLVCCWSLK-NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH-KCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDV-----FLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPK 2481
            +TK R V    W+ Q P++L   Y + + A  +P G+   W+LK     PE  F   S   +  ++K H NL+  G ++G I ++D R      V  T  ++  H  PV    + + V G    H+  LISIS+DG++  WS+             D++   + +  +    KQ K  A+ S        AF   D N ++ G E+G ++  C         + F GH  PV G+     +  V     F+S S DWT+KLW      P+ +F+ +   V    WSP    +FACV+  G ++VWNL   T  P     +      L  V ++ +G  + +GDS+G +H + +      PK
Sbjct:  241 WTKNRVVTCLDWSPQYPELLVASYNNNEDAPHEPDGVALVWNLKYKKPTPEYIFHCQSEVMSAGFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPV----YCVNVVGSQNAHN--LISISTDGKMCSWSL-------------DMLSQPQDSLEL--VFKQSKAVAVTS-------MAFPLGDVNNFVVGSEDGSVYTACRHGSKAGITEVFEGHHGPVTGLSCHSAVGPVDFSHLFISSSFDWTVKLWSTRSTRPLYSFEDSCDYVYDAMWSPTHPALFACVDLSGRLDVWNLNNDTEVPTASVGV-DGGAALNRVRWSHTGREIAIGDSEGHVHIYDVGEQICVPK 572          
BLAST of WD repeat domain 78 vs. Planmine SMEST
Match: SMESG000047563.1 (SMESG000047563.1)

HSP 1 Score: 1539.24 bits (3984), Expect = 0.000e+0
Identity = 801/801 (100.00%), Postives = 801/801 (100.00%), Query Frame = 1
Query:  139 MSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTXXXXXXXXXXXXENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQN 2541
            MSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTPLPLLSDDKKLKENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKSQQSSSGFTAESSSSMSDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIEKKNKLYELLLNSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDEEKEKTEGIKEENIEINASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQN
Sbjct:    1 MSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTPLPLLSDDKKLKENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKSQQSSSGFTAESSSSMSDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIEKKNKLYELLLNSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDEEKEKTEGIKEENIEINASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQN 801          
BLAST of WD repeat domain 78 vs. Planmine SMEST
Match: SMESG000047563.1 (SMESG000047563.1)

HSP 1 Score: 1533.47 bits (3969), Expect = 0.000e+0
Identity = 802/808 (99.26%), Postives = 802/808 (99.26%), Query Frame = 1
Query:  118 MNQSTIRMSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTXXXXXXXXXXXXENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKXXXXXXXXXXXXXXXXXDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIXXXXXXXXXXXXSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDXXXXXXXXXXXXXXXXNASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQN 2541
            MNQSTIRMSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTPLPLLSDDKKLKENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKSQQSSSGFTAESSSSMSDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIEKKNKLYELLLNSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDEEKEKTEGIKEENIEINASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESS      DLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQN
Sbjct:    1 MNQSTIRMSMYTTNASKTQSILSKKAESESKRSLKVPVRLVDANGTDYTPLPLLSDDKKLKENEKDTPTDNISQGSFYTQSISSFLGTNPLGFTRSKSQQSSSGFTAESSSSMSDEFNEGNAPSLNVYTEVKTIKQESNLILKDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIEKKNKLYELLLNSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYRNMDEEKEKTEGIKEENIEINASPNATAVEDRSKVQSKPIAVDSSVPELTASKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEEILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKTVSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESS------DLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQN 802          
BLAST of WD repeat domain 78 vs. Planmine SMEST
Match: SMESG000066594.1 (SMESG000066594.1)

HSP 1 Score: 161.77 bits (408), Expect = 4.502e-41
Identity = 109/390 (27.95%), Postives = 194/390 (49.74%), Query Frame = 1
Query: 1396 LEPLWKYHVSFTKGRNVAAFAWNRQNPDILAVCYGDFDYAN-QKPGLVCCWSLKNIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVV---DTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIH---------KCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENI--CPEYTVLTSVTFTESGECLIVGDSDGILHTFA----LRNMPPYPKNQTEALDK 2505
            L PLWK+    T+   V +  W+    D+  V +G ++  + ++ G +C +SLKN  YPE T    S   AI  +     L+  G+ +G + +  + +KS  + V    +   S +H  P  Q++W+       +++     SISSDGR+ +WSV K   + +     D++ L++I   I     +   D  +    SG+C A +PK  + +L G ++G+I+         K +  Y+  + +N   H   +Y + WS +  D+F SCSADWTI +W+  + NP+        +V SIAW+P SS + A V  +  V V++  ++ L+PL+ + +        LT + F+++   +++GDS G  H+      LR +P   K++   +D+
Sbjct:  304 LLPLWKFSFDKTRKLPVTSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWL----PIEKDNIMAFYSISSDGRICEWSVNKYELNCQ-----DIVALRQINLPI---DMETVADRFLE---SGTCIALHPKKYHTFLVGTQDGNIYYHLTMNSNMKSNSDYSMTFNENI--HKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQSNPLFVLDLGF-AVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSKHKVSLTQIVFSDNYPIILIGDSRGNTHSMKLSPNLRKIPKVKKDELFNMDE 675          
BLAST of WD repeat domain 78 vs. Planmine SMEST
Match: SMESG000024276.1 (SMESG000024276.1)

HSP 1 Score: 112.079 bits (279), Expect = 2.585e-25
Identity = 99/353 (28.05%), Postives = 152/353 (43.06%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCC-WSLK-NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSES-DFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHI-----HKCSCSYNEQYLDNFFGHTAPVYGIKWSPF-----MNDVFLSCSADWTIKLW--HIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDG 2436
            ++K R V    W+   P++L   Y   D A  +P  VC  W+LK   D PE      S   +      H +L+  G ++G I ++D+R      +  T   +  H  PV  L     V G    H+  LIS+SSDG++  WS+      SE+ +F                +GKQ K+ A+       +C  F   D N +L G E+G +     H      +E     F GH  P+ G+           + +FL+ S DWT+KLW        P+ +F+     V  +AWSP    +FA V+ +G ++VW L   T  P     + P  T L   ++ ++G  + VGD  G
Sbjct:  235 WSKHRVVTCLDWSPMYPELLLGAYHCNDEAPHEPDGVCLIWNLKYKKDSPEYVLHCQSPLVSACMPNYHPSLVVGGTYSGQIVLWDIRTNKRTPIQRTPLNAASHTHPVCAL----TVLGTQNAHN--LISVSSDGKMCAWSLEMLNAPSETREF----------------SGKQAKSIAV-------TCMDFLSNDVNNFLVGSEDGMVYPGIRHGVKAGLSE----GFEGHLGPISGLSSHKVPGAVDFSHLFLTSSFDWTVKLWSGRDSGSRPLHSFEDNGDYVYDVAWSPVHPAVFASVDGQGLLDVWKLTADTEVPFSRTQVNP-LTALNKCSWHKTGAHIAVGDDSG 553          
BLAST of WD repeat domain 78 vs. Planmine SMEST
Match: SMESG000024276.1 (SMESG000024276.1)

HSP 1 Score: 112.079 bits (279), Expect = 2.878e-25
Identity = 99/353 (28.05%), Postives = 152/353 (43.06%), Query Frame = 1
Query: 1426 FTKGRNVAAFAWNRQNPDILAVCYGDFDYANQKPGLVCC-WSLK-NIDYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSES-DFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHI-----HKCSCSYNEQYLDNFFGHTAPVYGIKWSPF-----MNDVFLSCSADWTIKLW--HIERQNPVINFQSAVKSVNSIAWSPKSSVIFACVN-EGAVEVWNLQLSTLDPLIVENICPEYTVLTSVTFTESGECLIVGDSDG 2436
            ++K R V    W+   P++L   Y   D A  +P  VC  W+LK   D PE      S   +      H +L+  G ++G I ++D+R      +  T   +  H  PV  L     V G    H+  LIS+SSDG++  WS+      SE+ +F                +GKQ K+ A+       +C  F   D N +L G E+G +     H      +E     F GH  P+ G+           + +FL+ S DWT+KLW        P+ +F+     V  +AWSP    +FA V+ +G ++VW L   T  P     + P  T L   ++ ++G  + VGD  G
Sbjct:  242 WSKHRVVTCLDWSPMYPELLLGAYHCNDEAPHEPDGVCLIWNLKYKKDSPEYVLHCQSPLVSACMPNYHPSLVVGGTYSGQIVLWDIRTNKRTPIQRTPLNAASHTHPVCAL----TVLGTQNAHN--LISVSSDGKMCAWSLEMLNAPSETREF----------------SGKQAKSIAV-------TCMDFLSNDVNNFLVGSEDGMVYPGIRHGVKAGLSE----GFEGHLGPISGLSSHKVPGAVDFSHLFLTSSFDWTVKLWSGRDSGSRPLHSFEDNGDYVYDVAWSPVHPAVFASVDGQGLLDVWKLTADTEVPFSRTQVNP-LTALNKCSWHKTGAHIAVGDDSG 560          
The following BLAST results are available for this feature:
BLAST of WD repeat domain 78 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR783.463e-15440.27WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR782.130e-12136.58WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DNAI11.705e-5330.35dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
DNAI11.761e-5330.35dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
WDR788.569e-4231.46WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyci-11.684e-2225.00DYnein Chain, light Intermediate [Source:UniProtK... [more]
cor-15.615e-733.73Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
cor-15.771e-733.73Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
cor-15.771e-733.73Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
cor-16.973e-733.73Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG93133.838e-5129.56gene:FBgn0034566 transcript:FBtr0342788[more]
CG93134.411e-5129.56gene:FBgn0034566 transcript:FBtr0071521[more]
CG93134.411e-5129.56gene:FBgn0034566 transcript:FBtr0345666[more]
Dic61B1.163e-4028.80gene:FBgn0263988 transcript:FBtr0072538[more]
Dic61B1.995e-4028.80gene:FBgn0263988 transcript:FBtr0072539[more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr785.165e-13134.56WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
wdr785.165e-13134.56WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
dnai1.23.912e-5431.73dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dnai1.13.829e-4428.19dynein, axonemal, intermediate chain 1, paralog 1 ... [more]
dnai1.14.160e-4428.00dynein, axonemal, intermediate chain 1, paralog 1 ... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creb51.531e-14835.01cAMP responsive element binding protein 5 [Source:... [more]
creb58.137e-14635.26cAMP responsive element binding protein 5 [Source:... [more]
creb53.801e-14134.97cAMP responsive element binding protein 5 [Source:... [more]
csrnp29.690e-3227.40cysteine-serine-rich nuclear protein 2 [Source:Xen... [more]
csrnp21.477e-3127.40cysteine-serine-rich nuclear protein 2 [Source:Xen... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr789.441e-15038.35WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Wdr785.765e-7131.67WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Wdr785.765e-7131.67WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Wdr782.762e-6135.99WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Dnaic12.460e-5231.17dynein, axonemal, intermediate chain 1 [Source:MGI... [more]
back to top
BLAST of WD repeat domain 78 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5VTH9|WDR78_HUMAN1.663e-15340.27WD repeat-containing protein 78 OS=Homo sapiens OX... [more]
sp|E9PYY5|WDR78_MOUSE6.604e-14938.35WD repeat-containing protein 78 OS=Mus musculus OX... [more]
sp|Q4V8G4|WDR78_RAT1.151e-14637.95WD repeat-containing protein 78 OS=Rattus norvegic... [more]
sp|Q16959|DYI2_HELCR1.346e-5631.13Dynein intermediate chain 2, ciliary OS=Heliocidar... [more]
sp|Q9UI46|DNAI1_HUMAN8.456e-5330.35Dynein intermediate chain 1, axonemal OS=Homo sapi... [more]
back to top
BLAST of WD repeat domain 78 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|161779090.000e+042.63tr|A0A4S2LYK1|A0A4S2LYK1_OPIFE WD_REPEATS_REGION d... [more]
gnl|BL_ORD_ID|204039080.000e+042.49tr|H2KQB6|H2KQB6_CLOSI WD repeat-containing protei... [more]
gnl|BL_ORD_ID|191447220.000e+042.25tr|A0A4E0R9X7|A0A4E0R9X7_FASHE WD repeat-containin... [more]
gnl|BL_ORD_ID|235369200.000e+040.36tr|A0A210QJC3|A0A210QJC3_MIZYE WD repeat-containin... [more]
gnl|BL_ORD_ID|239148780.000e+042.31tr|K1Q316|K1Q316_CRAGI WD repeat-containing protei... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.21.877e-5430.50dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dync1i2a8.495e-3128.10dynein cytoplasmic 1 intermediate chain 2 [Source:... [more]
dync1i2a1.044e-3028.10dynein cytoplasmic 1 intermediate chain 2 [Source:... [more]
dync1i2a6.889e-3028.82dynein cytoplasmic 1 intermediate chain 2 [Source:... [more]
dync1i2b9.795e-2926.92dynein, cytoplasmic 1, intermediate chain 2b [Sour... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000105.18.996e-6443.31pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 ... [more]
ENSPMAT00000004773.11.199e-5330.50pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 g... [more]
dync1i2a1.723e-3328.80dynein, cytoplasmic 1, intermediate chain 2a [Sour... [more]
wdr343.594e-1623.24WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
dnai2b9.210e-1424.24dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SWD28.593e-933.87Subunit of the COMPASS (Set1C) histone H3K4 methyl... [more]
YMR102C_mRNA6.512e-629.69Protein of unknown function; transcription is acti... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO344747.056e-11251.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361983.889e-5531.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490794.631e-3528.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432315.500e-2522.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400756.835e-1922.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat domain 78 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr788.556e-10032.63WD repeat domain 78 [Source:NCBI gene;Acc:10117432... [more]
ENSORLT00000002152.21.370e-7833.48WD repeat-containing protein 78 [Source:NCBI gene;... [more]
dnai1.24.821e-3727.91dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dnai1.22.582e-3327.66dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dync1i2b2.365e-3128.25cytoplasmic dynein 1 intermediate chain 2 [Source:... [more]
back to top
BLAST of WD repeat domain 78 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047563.10.000e+0100.00SMESG000047563.1[more]
SMESG000047563.10.000e+099.26SMESG000047563.1[more]
SMESG000066594.14.502e-4127.95SMESG000066594.1[more]
SMESG000024276.12.585e-2528.05SMESG000024276.1[more]
SMESG000024276.12.878e-2528.05SMESG000024276.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013441 ID=SMED30013441|Name=WD repeat domain 78|organism=Schmidtea mediterranea sexual|type=transcript|length=2597bp
AAAACTTTAAATATTTAGATTTCTATAGTAACGTAATTAATTTTTTAAAG
TGAAAATATTAATTAATTTAAAACTACAATATTTAACTACAACATGCTAT
CTTCTACAAGAAGAAATATGAATCAAAGTACTATTCGAATGAGTATGTAC
ACCACAAATGCATCTAAAACTCAATCAATTTTATCCAAAAAGGCAGAATC
TGAATCCAAAAGAAGTTTGAAAGTCCCCGTGAGATTAGTCGATGCTAATG
GAACTGATTATACGCCATTACCATTATTAAGTGATGACAAAAAATTGAAG
GAAAATGAAAAGGACACACCGACTGATAATATATCTCAAGGCTCATTTTA
CACTCAGAGTATTAGTAGTTTCCTCGGTACTAATCCCCTTGGTTTTACTC
GCTCTAAATCTCAGCAAAGCAGTTCTGGATTTACTGCTGAAAGCAGTTCT
AGTATGAGTGATGAATTCAATGAAGGAAATGCTCCATCTTTAAATGTTTA
CACTGAAGTTAAAACTATTAAACAAGAAAGTAATCTAATATTAAAAGACG
AAGAGTTAGATAAACCGGTGGATATTGTTTTGGAGGAGACTGAGACGATT
TGGATCTTTGACATGGCTCCAATTCTTTTCACTCGGGATGGAGACGATAG
CGCTGAAATTGAAAAGAAAAATAAACTTTATGAATTACTACTGAATTCAC
GAGCTGGCAATGATAAATATCTTGAAAGGGGTATGAACACATTTGGAAAT
GCTCAGATTTCAAAATCTATCCAAACCAATCGAATTGGGCACAATGATGC
TGGTTCGATGGCAACAATGTGGGATATACATGACCAATATCGCAACATGG
ACGAAGAGAAAGAAAAAACTGAAGGAATAAAAGAAGAAAATATTGAAATC
AATGCATCGCCAAATGCAACGGCAGTTGAAGACCGATCAAAAGTCCAAAG
TAAACCTATAGCTGTGGACTCATCAGTGCCCGAATTAACCGCCTCAAAAG
GCGGCCAACAAAGCCGATCACCAACAGTAATTGATAAAACTCAAGAAACT
GCCTCAGCCAATTCGGATTCAGACCTGTTCGGAACACGCCAATCATCCGT
CACTGCGTCAACAACTCATGATTCTCAAGCCAAAAACGAAGAAATTCTAA
ATTCAGAAAGGATGAGTTACAGCTGTTTTATAATGGAGCGCGCTCTGAAT
ATGAATTTCTATTTTGAAAAAATGCTTTACTACAGAAATTTACCATTCTA
CAAAGAATTAATGGAGGAAATAAAAGTCAAACAGATCAAAACTGTGAGTA
CAGAGGACGAAAATTCGGAAAGTTCCAAAACAAAAAGCGCTGAAGAATTA
GCTGCAAGCATTTTGAAACCCGAATTTGCAGTATCCCAGCCACATCTGGA
ACCGTTGTGGAAATATCATGTTTCATTCACAAAGGGGAGGAATGTCGCAG
CATTCGCTTGGAATCGACAAAATCCAGATATTCTAGCAGTCTGTTATGGA
GATTTCGATTATGCCAACCAAAAGCCTGGGTTGGTGTGTTGCTGGTCATT
AAAAAACATAGATTATCCAGAGAGAACATTTCGTCTGCCATCGGGTGCCA
CGGCAATCAGTTGGTCGAAAACCCACTCGAACCTATTGGCGATTGGCATG
TTTAATGGGACGATATCCGTTTTTGATGTCCGCAAGAAATCGGACGAGTC
CGTCGTCGACACCAAACATGCATCTGGAAGACATTTGGGGCCAGTTCGAC
AACTTGAATGGGTGATTCGAGTTTCAGGTCGATCTGAAGAACATTCTGAA
GTTTTGATATCTATTTCATCTGACGGAAGGGTCACTCAATGGTCAGTTCG
AAAGGGGTTTGAAAGTTCAGAATCTGATTTTCATCATGACCTAATGAAGC
TAAAGAGAATAGCGACTAGAATACCAGGAGCTGGGAAGCAAAAGAAAACG
GATGCTCTCATCTCCCAATATGCTTCTGGCTCATGCTTTGCATTTAATCC
TAAAGATCCAAATATATATCTGGCGGGAGTAGAAGAAGGTCATATACACA
AATGCTCTTGCTCTTACAATGAACAATATCTTGACAACTTTTTTGGTCAC
ACGGCCCCAGTTTATGGAATTAAATGGTCACCTTTTATGAATGATGTTTT
CCTCAGTTGTTCTGCCGACTGGACTATTAAATTGTGGCACATTGAGCGCC
AGAACCCAGTTATTAACTTTCAATCTGCCGTTAAATCTGTTAATTCAATT
GCTTGGTCCCCAAAATCGTCGGTCATTTTTGCGTGTGTCAATGAGGGTGC
TGTAGAAGTTTGGAATCTGCAACTCTCCACTCTTGATCCTCTAATTGTGG
AGAATATATGCCCTGAATACACTGTTTTGACTTCTGTCACATTTACCGAG
TCTGGAGAATGCTTGATAGTCGGTGACAGTGATGGAATCCTTCATACGTT
TGCACTGAGAAATATGCCACCATATCCTAAAAATCAAACGGAAGCTCTGG
ATAAAACCATTCAGTCTTGTATTGCTAGCCAACTCCAGAACTAAGGTCCG
TCGGTGATTTGCGTTTCAAAATTCAACTGTCGTTGTAAAATTGTTGA
back to top

protein sequence of SMED30013441-orf-1

>SMED30013441-orf-1 ID=SMED30013441-orf-1|Name=SMED30013441-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=817bp
MLSSTRRNMNQSTIRMSMYTTNASKTQSILSKKAESESKRSLKVPVRLVD
ANGTDYTPLPLLSDDKKLKENEKDTPTDNISQGSFYTQSISSFLGTNPLG
FTRSKSQQSSSGFTAESSSSMSDEFNEGNAPSLNVYTEVKTIKQESNLIL
KDEELDKPVDIVLEETETIWIFDMAPILFTRDGDDSAEIEKKNKLYELLL
NSRAGNDKYLERGMNTFGNAQISKSIQTNRIGHNDAGSMATMWDIHDQYR
NMDEEKEKTEGIKEENIEINASPNATAVEDRSKVQSKPIAVDSSVPELTA
SKGGQQSRSPTVIDKTQETASANSDSDLFGTRQSSVTASTTHDSQAKNEE
ILNSERMSYSCFIMERALNMNFYFEKMLYYRNLPFYKELMEEIKVKQIKT
VSTEDENSESSKTKSAEELAASILKPEFAVSQPHLEPLWKYHVSFTKGRN
VAAFAWNRQNPDILAVCYGDFDYANQKPGLVCCWSLKNIDYPERTFRLPS
GATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGP
VRQLEWVIRVSGRSEEHSEVLISISSDGRVTQWSVRKGFESSESDFHHDL
MKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGH
IHKCSCSYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHI
ERQNPVINFQSAVKSVNSIAWSPKSSVIFACVNEGAVEVWNLQLSTLDPL
IVENICPEYTVLTSVTFTESGECLIVGDSDGILHTFALRNMPPYPKNQTE
ALDKTIQSCIASQLQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0002244hematopoietic progenitor cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 365..398
e-value: 190.0
score: 2.7
coord: 100..139
e-value: 2.2
score: 14.8
coord: 313..352
e-value: 0.19
score: 20.9
coord: 270..310
e-value: 5.8E-7
score: 39.1
coord: 149..195
e-value: 96.0
score: 4.5
IPR001680WD40 repeatPFAMPF00400WD40coord: 274..309
e-value: 0.016
score: 16.1
coord: 317..352
e-value: 0.16
score: 12.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 320..354
score: 9.506
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 277..319
score: 11.778
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 224..424
e-value: 1.7E-27
score: 98.2
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 3..216
e-value: 1.2E-18
score: 69.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availablePANTHERPTHR12442:SF12WD REPEAT-CONTAINING PROTEIN 78coord: 9..416
NoneNo IPR availablePANTHERPTHR12442DYNEIN INTERMEDIATE CHAINcoord: 9..416
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 277..407
score: 17.904
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 60..397