WD repeat domain 60

Overview
NameWD repeat domain 60
Smed IDSMED30013424
Uniprot Best hitWD repeat-containing protein 60 OS=Mus musculus OX=10090 GN=Wdr60 PE=1 SV=1 (E=2.94667e-34)
Length (bp)3146
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat domain 60 (SMED30013424) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat domain 60 (SMED30013424) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat domain 60 (SMED30013424) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat domain 60 (SMED30013424) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013424

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013424SMESG000040271.1 SmedASXL_014320SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013424SMESG000040271.1 dd_Smed_v4_10032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013424SMESG000040271.1 dd_Smed_v4_10032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013424SMESG000040271.1 dd_Smed_v4_10032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013424SMESG000040271.1 dd_Smed_v4_10032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30013424SMESG000040271.1 dd_Smed_v4_10032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013424SMESG000040271.1 dd_Smed_v6_10032_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013424SMESG000040271.1 dd_Smed_v4_10032_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013424SMESG000040271.1 dd_Smed_v4_10032_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013424SMESG000040271.1 dd_Smed_v4_10032_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat domain 60 vs. Ensembl Human
Match: WDR60 (WD repeat domain 60 [Source:HGNC Symbol;Acc:HGNC:21862])

HSP 1 Score: 145.591 bits (366), Expect = 1.222e-34
Identity = 164/648 (25.31%), Postives = 275/648 (42.44%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSS-------GILIQTLTMVENILEEE---AWCDVEIKMSDSQQVISKGYSKF--SMPDGVDCLIARFAVA--NSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENS--HSKSRRIDLLPAYLTSA-STDDV--ELFHKGPIVGLQPIIN-----------------EMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLN----PSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGS-AILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKA-----RLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSLI 3084
            F++F  A  +      A +   R+  L RLI+LD    + +L++ PV E+  Y+R FGK        Q   DNV RD QTE I  R VWTQ P                 G+  +V   S G E    SD VV+           L     ++  +LEE+   A     ++  D     S   S+   S+P   +  ++    +     +  +VH   +    P    + +  + +W + + +G P   L C      +S V+    SP   A  +  G + G++ +WDLRE+S  H      D    + T+  STD +   + H+ P+  ++PI                   EM   S+ + SLD  G + +W+V  + + +     +GS++DL L PG R +L   A + L  S++   N +  T+ TLN    PS  +    GT+ G +I H    + RV  +  + +P+  G   +     V  +DF PF EP  LAG  DG+IR+  +  +  LL +     S A+   +WS + PA+F   D   N+  W++L +   P+  Q +                P+R  +   +    KA      L+L    G +++  L   ++ P++D+  ++  L+Q  +
Sbjct:  467 FVDFASASHRQKSRTQALKQKMRSTKLLRLIDLDFSFTFSLLDLPPVNEYDMYIRNFGKKNTKQAYVQCNEDNVERDIQTEEIETREVWTQHP-----------------GESTVV---SGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVHDLPEKSFVPLLDSKYV--LCVWDIWQPSG-PQKVLIC------ESQVTCCCLSP-LKAFLLFAGTAHGSVVVWDLREDSRLHYSVTLSDGFWTFRTATFSTDGILTSVNHRSPLQAVEPISTSVHKKQSFVLSPFSTQEEMSGLSFHIASLDESGVLNVWVVVELPKAD----IAGSISDLGLMPGGRVKLVHSALIQLGDSLSHKGNEFWGTTQTLNVKFLPSDPNHFIIGTDMG-LISHGTRQDLRV--APKLFKPQQHGIRPV----KVNVIDFSPFGEPIFLAGCSDGSIRLHQLSSAFPLLQWDSSTDSHAVTGLQWSPTRPAVFLVQDDTSNIYIWDLLQSDLGPVAKQQVS---------------PNRLVAMAAVGEPEKAGGSFLALVLARASGSIDIQHLKRRWAAPEVDECNRLRLLLQEAL 1058          
BLAST of WD repeat domain 60 vs. Ensembl Human
Match: WDR60 (WD repeat domain 60 [Source:HGNC Symbol;Acc:HGNC:21862])

HSP 1 Score: 62.3882 bits (150), Expect = 3.069e-9
Identity = 36/93 (38.71%), Postives = 48/93 (51.61%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCP 1557
            F++F  A  +      A +   R+  L RLI+LD    + +L++ PV E+  Y+R FGK        Q   DNV RD QTE I  R VWTQ P
Sbjct:  244 FVDFASASHRQKSRTQALKQKMRSTKLLRLIDLDFSFTFSLLDLPPVNEYDMYIRNFGKKNTKQAYVQCNEDNVERDIQTEEIETREVWTQHP 336          
BLAST of WD repeat domain 60 vs. Ensembl Human
Match: WDR60 (WD repeat domain 60 [Source:HGNC Symbol;Acc:HGNC:21862])

HSP 1 Score: 54.6842 bits (130), Expect = 1.233e-7
Identity = 50/207 (24.15%), Postives = 91/207 (43.96%), Query Frame = 1
Query: 2482 SQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGS-AILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKA-----RLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSLI 3084
            +    GT+ G +I H    + RV  +  + +P+  G   +     V  +DF PF EP  LAG  DG+IR+  +  +  LL +     S A+   +WS + PA+F   D   N+  W++L +   P+  Q +                P+R  +   +    KA      L+L    G +++  L   ++ P++D+  ++  L+Q  +
Sbjct:    4 NHFIIGTDMG-LISHGTRQDLRV--APKLFKPQQHGIRPV----KVNVIDFSPFGEPIFLAGCSDGSIRLHQLSSAFPLLQWDSSTDSHAVTGLQWSPTRPAVFLVQDDTSNIYIWDLLQSDLGPVAKQQVS---------------PNRLVAMAAVGEPEKAGGSFLALVLARASGSIDIQHLKRRWAAPEVDECNRLRLLLQEAL 188          
BLAST of WD repeat domain 60 vs. Ensembl Zebrafish
Match: wdr60 (WD repeat domain 60 [Source:ZFIN;Acc:ZDB-GENE-140821-1])

HSP 1 Score: 155.606 bits (392), Expect = 5.231e-38
Identity = 150/571 (26.27%), Postives = 248/571 (43.43%), Query Frame = 1
Query: 1267 QFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEE---EAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVH-QASKMQTQPGNQQQIISPIAIWKVSRCTG----EPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKS-----RRIDLL--PAYLTSASTDDVELFHKGPIVGLQPIINEMDSN---------------SYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATIS----NPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHK-PGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSL 2871
            Q + + I+F  A+++     VA +   R+ +L RLI+LD  + + +L++ PV E+  Y++ FG A       Q   D+  RD QTE +     WTQ PP     C       Q      + R  +D            L S   +  + + EN+ +    +  C     +S S   I    +K    +G    + +F+        +VH  +SK  +   + + ++    IW+ SR       E  +K  C              FSP    + V  G + G++ +WDLRE+S S S     + +  L  P + T A    V   H  P+V ++P+I   D +               S+QL SLD  G + +W+V  + + N     SGS TDL LRPG + +L   +S+     +   +     P V   +   PS S+  F GTN G +++H    + +V      SQ      +D +    VT LDF P  EP+ L G  DG++R+ +V R   L+ +  +  G+ IL  +WS++ PA+F  LD   +L  W++      P+  +++
Sbjct:  446 QTRGTIIDFVSAKQREISQKVARKQKKRSEELLRLIDLDFSITFSMLDLPPVNEYDMYIKNFGTANTKQAYVQCNEDSTDRDIQTEDVEMTDKWTQHPPEAKSACGGSTG-TQANAVESIARTSTDSKRLTTF-----LRSAAQVMAVLVEENMAQSNSVKKLCSKTDALSFSDGCIQLN-TKLPFLNGRQVSLLQFSQVQRQTLLSVHPPSSKNSSVRLDSETVVCVWNIWEPSRPQKILLYESEVKCCC--------------FSP-GKVTLVFAGTAVGSVIVWDLREHSGSHSNLEIGKEVWTLRYPTFSTDAVLSGV--GHLSPVVSIEPVIASADMSSTSTLTADIEECMGLSFQLGSLDENGVLTLWVVIELPKGND----SGSQTDLGLRPGGKVKLLHSSSLQTTERLPKDTIMGFGPSVSLQLKFLPSDSNHYFIGTNMG-LVRHGTRHSLKVLPKVYRSQ------SDSYRPVEVTALDFSPLGEPFFLIGCSDGSVRLHSVLREDPLMEWAGRSSGAPILSVQWSQTRPAVFCVLDAASDLHIWDLTEKDYVPVITENI 981          
BLAST of WD repeat domain 60 vs. Ensembl Zebrafish
Match: wdr60 (WD repeat domain 60 [Source:ZFIN;Acc:ZDB-GENE-140821-1])

HSP 1 Score: 144.05 bits (362), Expect = 1.856e-34
Identity = 147/567 (25.93%), Postives = 247/567 (43.56%), Query Frame = 1
Query: 1267 QFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEE---EAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVH-QASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKS-----RRIDLL--PAYLTSASTDDVELFHKGPIVGLQPIINEMDSN---------------SYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATIS----NPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHK-PGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSL 2871
            Q + + I+F  A+++     VA +   R+ +L RLI+LD  + + +L++ PV E+  Y++ FG A       Q   D+  RD QTE +     WTQ PP     C     +  E     + R  +D            L S   +  + + EN+ +    +  C     +S S   I    +K    +G    + +F+        +VH  +SK  +   + + ++    IW+ SR    P   L        +S V    FSP    + V  G + G++ +WDLRE+S S S     + +  L  P + T A    V   H  P+V ++P+I   D +               S+QL SLD  G + +W+     +++  S A   L  L LRPG + +L   +S+     +   +     P V   +   PS S+  F GTN G +++H    + +V      SQ      +D +    VT LDF P  EP+ L G  DG++R+ +V R   L+ +  +  G+ IL  +WS++ PA+F  LD   +L  W++      P+  +++
Sbjct:  343 QTRGTIIDFVSAKQREISQKVARKQKKRSEELLRLIDLDFSITFSMLDLPPVNEYDMYIKNFGTANTKQAYVQCNEDSTDRDIQTEDVEMTDKWTQHPPEAKSACGGTQANAVE----SIARTSTDSKRLTTF-----LRSAAQVMAVLVEENMAQSNSVKKLCSKTDALSFSDGCIQLN-TKLPFLNGRQVSLLQFSQVQRQTLLSVHPPSSKNSSVRLDSETVVCVWNIWEPSR----PQKILL------YESEVKCCCFSPG-KVTLVFAGTAVGSVIVWDLREHSGSHSNLEIGKEVWTLRYPTFSTDAVLSGVG--HLSPVVSIEPVIASADMSSTSTLTADIEECMGLSFQLGSLDENGVLTLWVFP--LDLHHASNAVSIL--LGLRPGGKVKLLHSSSLQTTERLPKDTIMGFGPSVSLQLKFLPSDSNHYFIGTNMG-LVRHGTRHSLKVLPKVYRSQ------SDSYRPVEVTALDFSPLGEPFFLIGCSDGSVRLHSVLREDPLMEWAGRSSGAPILSVQWSQTRPAVFCVLDAASDLHIWDLTEKDYVPVITENI 875          
BLAST of WD repeat domain 60 vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 56.9954 bits (136), Expect = 1.097e-7
Identity = 68/292 (23.29%), Postives = 115/292 (39.38%), Query Frame = 1
Query: 2026 QLTFSPDC---------AASHVICGLS-SGALALWDLRENSHSKSRRIDLLPAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAAN---QRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFF-EPYLLAGYDDGTIRIFA--VGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQP 2853
            ++T  P C           SH++ G S +G +A WD R+ S      +++ P          +E  H+ P+              Y+ I L S     I+  S   ++  W +   S       P  R  +      N+ +S+  IS  +  T  T       +   GT  G ++   R A    +++  ++S               G V  L   PFF + +L  G  D T RI++  +  S+ +   +H   + +L   WS   P++FF++ M+G L  W+IL  QN P
Sbjct:  212 EMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQP----VEMSP----------IEFSHRDPV--------------YKAIWLQSKTGTDIFSASTDGQVLWWDIRKMS------EPTERLVMDPTKKGNIDNSLGAISLEFETTMPT-------KFMVGTEQGLVVSCNRKAKTPAEKIVCTYSGHH------------GPVYALQRNPFFPKNFLTVG--DWTARIWSEDIKESSIMWTKYHI--AHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDP 446          
BLAST of WD repeat domain 60 vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 56.225 bits (134), Expect = 1.426e-7
Identity = 66/292 (22.60%), Postives = 114/292 (39.04%), Query Frame = 1
Query: 2026 QLTFSPDC---------AASHVICGLS-SGALALWDLRENSHSKSRRIDLLPAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAAN---QRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFF-EPYLLAGYDDGTIRIFA--VGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQP 2853
            ++T  P C           SH++ G S +G +A WD R+ S      +++ P          +E  H+ P+      I         + S  + GQ+  W +  ++E                 P  R  +      N+ +S+  IS  +  T  T       +   GT  G ++   R A    +++  ++S               G V  L   PFF + +L  G  D T RI++  +  S+ +   +H   + +L   WS   P++FF++ M+G L  W+IL  QN P
Sbjct:   70 EMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQP----VEMSP----------IEFSHRDPVYK---AIWLQSKTGTDIFSASTDGQVLWWDIRKMSE-----------------PTERLVMDPTKKGNIDNSLGAISLEFETTMPT-------KFMVGTEQGLVVSCNRKAKTPAEKIVCTYSGHH------------GPVYALQRNPFFPKNFLTVG--DWTARIWSEDIKESSIMWTKYHI--AHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDP 304          
BLAST of WD repeat domain 60 vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 56.225 bits (134), Expect = 1.591e-7
Identity = 68/292 (23.29%), Postives = 115/292 (39.38%), Query Frame = 1
Query: 2026 QLTFSPDC---------AASHVICGLS-SGALALWDLRENSHSKSRRIDLLPAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAAN---QRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFF-EPYLLAGYDDGTIRIFA--VGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQP 2853
            ++T  P C           SH++ G S +G +A WD R+ S      +++ P          +E  H+ P+              Y+ I L S     I+  S   ++  W +   S       P  R  +      N+ +S+  IS  +  T  T       +   GT  G ++   R A    +++  ++S               G V  L   PFF + +L  G  D T RI++  +  S+ +   +H   + +L   WS   P++FF++ M+G L  W+IL  QN P
Sbjct:  212 EMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQP----VEMSP----------IEFSHRDPV--------------YKAIWLQSKTGTDIFSASTDGQVLWWDIRKMS------EPTERLVMDPTKKGNIDNSLGAISLEFETTMPT-------KFMVGTEQGLVVSCNRKAKTPAEKIVCTYSGHH------------GPVYALQRNPFFPKNFLTVG--DWTARIWSEDIKESSIMWTKYHI--AHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDP 446          
BLAST of WD repeat domain 60 vs. Ensembl Xenopus
Match: ENSXETT00000025126.1 (WD repeat domain 60 [Source:NCBI gene;Acc:100496380])

HSP 1 Score: 146.747 bits (369), Expect = 3.945e-35
Identity = 147/574 (25.61%), Postives = 243/574 (42.33%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTL----TMVENILEE---EAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIAR------FAVANSNIFATVHQASKMQTQPG----NQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENS--HSKSRRIDLLPAYLTSA-STDDV--ELFHKGPIVGLQPIIN---------------EMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSS-----VATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKP-GSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSL 2871
            FI+F  A+++  +  +A++   R+ ++ +L++LD      +L++ PV E+  Y+R FG+        Q   DNV RD QTE I+    WTQ P                 G+  +   G   D S  +     + S  L   L     ++  +LEE   E   D  ++  +    IS G   F +   +  L AR      F+    ++  TVH   K    PG    +   II    +W+ S     P   L C       + V    FSP  AA  V  G   G +A+WDLRE+   H   +  D    +  +  STD V  +  H   +  ++P+ +               E+   S+Q+ SLD    + +W+V  + +++ W   +GS  DL L PG + +LS  AS+ L S+     V ++  P  + ++   P  S+  F GT+ G +     A   R   +    Q +   G        +T +DF PF  P  LAG  DG IR+ ++     ++ +     G ++   +WS + P +FF LD    +  W+++ N  QP+   S+
Sbjct:  529 FIDFVSAKQRQVNCQIASKQKKRSTEILQLVDLDFSTTLSLLDLHPVKEYEMYIRNFGRTNTKQAYVQCNEDNVDRDVQTEDIDFEEKWTQHP-----------------GEGAVASGGQKNDASQKMMTVTKIDSQRLTNFLQSACQVIAVLLEEDRAEKQSDWNVQSKEPCMSISNGC--FQLNTSLPFLQARPVYHLHFSPTQRHMLLTVHGLCK---DPGIVHLDNSYIICVWNVWEPS----TPQKVLVC------DAEVKCCCFSPGRAAL-VFAGTIDGTVAVWDLREDPALHHTMKIADTSWTFRAATFSTDGVFDQQTHTCSVRAIEPLSSAAAKDHGMSLLSSQEEVSGFSFQIASLDESAHLILWVVVELRKVD-W---AGSQNDLGLIPGGKIKLSHSASIRLGSNFFSKDVLSLGVPETL-NIKFLPQDSNHFFTGTDIGIV-----ARGTRYGLAEPPKQYKPRHGK--LRPSKITAIDFSPFSVPAFLAGCSDGCIRLHSLHAEFPIMQWSDSTSGHSVTALQWSLTRPTVFFVLDAACCIYIWDLMQNDLQPVAKDSV 1057          
BLAST of WD repeat domain 60 vs. Ensembl Xenopus
Match: ENSXETT00000025141.1 (WD repeat domain 60 [Source:NCBI gene;Acc:100496380])

HSP 1 Score: 146.747 bits (369), Expect = 4.654e-35
Identity = 147/574 (25.61%), Postives = 243/574 (42.33%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTL----TMVENILEE---EAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIAR------FAVANSNIFATVHQASKMQTQPG----NQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENS--HSKSRRIDLLPAYLTSA-STDDV--ELFHKGPIVGLQPIIN---------------EMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSS-----VATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKP-GSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSL 2871
            FI+F  A+++  +  +A++   R+ ++ +L++LD      +L++ PV E+  Y+R FG+        Q   DNV RD QTE I+    WTQ P                 G+  +   G   D S  +     + S  L   L     ++  +LEE   E   D  ++  +    IS G   F +   +  L AR      F+    ++  TVH   K    PG    +   II    +W+ S     P   L C       + V    FSP  AA  V  G   G +A+WDLRE+   H   +  D    +  +  STD V  +  H   +  ++P+ +               E+   S+Q+ SLD    + +W+V  + +++ W   +GS  DL L PG + +LS  AS+ L S+     V ++  P  + ++   P  S+  F GT+ G +     A   R   +    Q +   G        +T +DF PF  P  LAG  DG IR+ ++     ++ +     G ++   +WS + P +FF LD    +  W+++ N  QP+   S+
Sbjct:  528 FIDFVSAKQRQVNCQIASKQKKRSTEILQLVDLDFSTTLSLLDLHPVKEYEMYIRNFGRTNTKQAYVQCNEDNVDRDVQTEDIDFEEKWTQHP-----------------GEGAVASGGQKNDASQKMMTVTKIDSQRLTNFLQSACQVIAVLLEEDRAEKQSDWNVQSKEPCMSISNGC--FQLNTSLPFLQARPVYHLHFSPTQRHMLLTVHGLCK---DPGIVHLDNSYIICVWNVWEPS----TPQKVLVC------DAEVKCCCFSPGRAAL-VFAGTIDGTVAVWDLREDPALHHTMKIADTSWTFRAATFSTDGVFDQQTHTCSVRAIEPLSSAAAKDHGMSLLSSQEEVSGFSFQIASLDESAHLILWVVVELRKVD-W---AGSQNDLGLIPGGKIKLSHSASIRLGSNFFSKDVLSLGVPETL-NIKFLPQDSNHFFTGTDIGIV-----ARGTRYGLAEPPKQYKPRHGK--LRPSKITAIDFSPFSVPAFLAGCSDGCIRLHSLHAEFPIMQWSDSTSGHSVTALQWSLTRPTVFFVLDAACCIYIWDLMQNDLQPVAKDSV 1056          
BLAST of WD repeat domain 60 vs. Ensembl Xenopus
Match: ENSXETT00000037636.1 (WD repeat domain 60 [Source:NCBI gene;Acc:100496380])

HSP 1 Score: 115.546 bits (288), Expect = 2.245e-25
Identity = 135/574 (23.52%), Postives = 227/574 (39.55%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTL----TMVENILEE---EAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIAR------FAVANSNIFATVHQASKMQTQPG----NQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENS--HSKSRRIDLLPAYLTSA-STDDV--ELFHKGPIVGLQPIIN---------------EMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSS-----VATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKP-GSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSL 2871
            FI+F  A+++  +  +A++   R+ ++ +L++LD      +L++ PV E+  Y+R FG+        Q   DNV RD QTE I+    WTQ P                 G+  +   G   D S  +     + S  L   L     ++  +LEE   E   D  ++  +    IS G   F +   +  L AR      F+    ++  TVH   K    PG    +   II    +W+ S     P   L C       + V    FSP  AA  V  G   G +A+WDLRE+   H   +  D    +  +  STD V  +  H   +  ++P+ +               E+   S+Q+ SLD    + +W+V  + +++ W   +GS  DL L PG + +LS  AS+ L S+     V ++  P  + ++   P  S+  F GT+                                                   +AG  DG IR+ ++     ++ +     G ++   +WS + P +FF LD    +  W+++ N  QP+   S+
Sbjct:  528 FIDFVSAKQRQVNCQIASKQKKRSTEILQLVDLDFSTTLSLLDLHPVKEYEMYIRNFGRTNTKQAYVQCNEDNVDRDVQTEDIDFEEKWTQHP-----------------GEGAVASGGQKNDASQKMMTVTKIDSQRLTNFLQSACQVIAVLLEEDRAEKQSDWNVQSKEPCMSISNGC--FQLNTSLPFLQARPVYHLHFSPTQRHMLLTVHGLCK---DPGIVHLDNSYIICVWNVWEPS----TPQKVLVC------DAEVKCCCFSPGRAAL-VFAGTIDGTVAVWDLREDPALHHTMKIADTSWTFRAATFSTDGVFDQQTHTCSVRAIEPLSSAAAKDHGMSLLSSQEEVSGFSFQIASLDESAHLILWVVVELRKVD-W---AGSQNDLGLIPGGKIKLSHSASIRLGSNFFSKDVLSLGVPETL-NIKFLPQDSNHFFTGTD---------------------------------------------------IAGCSDGCIRLHSLHAEFPIMQWSDSTSGHSVTALQWSLTRPTVFFVLDAACCIYIWDLMQNDLQPVAKDSV 1012          
BLAST of WD repeat domain 60 vs. Ensembl Mouse
Match: Wdr60 (WD repeat domain 60 [Source:MGI Symbol;Acc:MGI:2445085])

HSP 1 Score: 146.362 bits (368), Expect = 4.213e-35
Identity = 164/645 (25.43%), Postives = 273/645 (42.33%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSD----GDESIVLSDEVVLSSGILIQTLTMVENILEEE------AWC----DVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENS--HSKSRRIDLLPAYLT-SASTDDV--ELFHKGPIVGLQPII-----------------NEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLN----PSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKP-GSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKAR-----LLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQ 3075
            F++F  A  +      A +  +R+  L RLI+LD    + +L++ PV E+  Y+R FGK        Q   DNV RD QTE I  R VWTQ P                 G+   V  GS+     D ++V   +    +  L     +V  +LEE+      +W     D  + +SDS   ++     F     V CL A  +        +VH   +    P    + +  + +W + + +G P   L C      +S V+   FSP   A  +  G   G++ +WDLRE+S  H   R  +   A+ T + STD +   + H+ P+  ++P+                   EM   S+ + SLD  G + +W+V  + + +     SGS++DL L PG R +L     + L +S++   +    ++ TL+    PS  +    GT+ G +I H    + RV  S  + +P   G   I     V  +DF PF E   LAG  DG+IR+  +     ++ + +   G A+   +WS + PA+F   D    +  W++L N   P+  Q +                PD+  + T +    K       L+L    G ++V  L   ++ P +D+  ++  L+Q
Sbjct:  410 FVDFATASHRQKSRSQALKQKTRSSKLLRLIDLDFSFTFSLLDLPPVNEYDMYIRNFGKKNTKQAYVQYNEDNVERDIQTEDIETREVWTQHP-----------------GEGTAVSGGSEEKDFSDVTVVPKIDTPRLANFLRAACQVVAVLLEEDRLAAGPSWIPRAQDKALNISDSSSQLNTSLP-FLQSRKVSCLHA--SRVQRQTVVSVHDLPEKAFAPSLDSRHL--LCVWDIWQPSG-PQKVLIC------ESKVTCCCFSP-LKAFLLFAGTVHGSVVVWDLREDSRIHHYVRLSNCFWAFRTPTFSTDGILTSVNHRSPLQAIEPVATSAYKKQSFVLSPFSTQEEMAGLSFHIASLDETGVLNVWVVVELPKAD----ISGSMSDLGLIPGGRIKLVHSTVIQLGNSLSHKDSELWGSTQTLSVKFLPSDPNHFVVGTDMG-LISHSTRQDWRV--SPRVFKPEQHGVRPI----KVNVIDFSPFEETVFLAGCSDGSIRLHQLTSERPIMQWDNSTSGHAVTSLQWSPTRPAVFLVQDDASRIYVWDLLENDLGPVAQQPIS---------------PDKLVAMTIVGEPEKTSGSFVALVLARTSGTVDVQNLKRRWTTPAVDEHSQLRLLLQ 998          
BLAST of WD repeat domain 60 vs. UniProt
Match: sp|Q8C761|WDR60_MOUSE (WD repeat-containing protein 60 OS=Mus musculus OX=10090 GN=Wdr60 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.947e-34
Identity = 164/645 (25.43%), Postives = 273/645 (42.33%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSD----GDESIVLSDEVVLSSGILIQTLTMVENILEEE------AWC----DVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENS--HSKSRRIDLLPAYLT-SASTDDV--ELFHKGPIVGLQPII-----------------NEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLN----PSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKP-GSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKAR-----LLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQ 3075
            F++F  A  +      A +  +R+  L RLI+LD    + +L++ PV E+  Y+R FGK        Q   DNV RD QTE I  R VWTQ P                 G+   V  GS+     D ++V   +    +  L     +V  +LEE+      +W     D  + +SDS   ++     F     V CL A  +        +VH   +    P    + +  + +W + + +G P   L C      +S V+   FSP   A  +  G   G++ +WDLRE+S  H   R  +   A+ T + STD +   + H+ P+  ++P+                   EM   S+ + SLD  G + +W+V  + + +     SGS++DL L PG R +L     + L +S++   +    ++ TL+    PS  +    GT+ G +I H    + RV  S  + +P   G   I     V  +DF PF E   LAG  DG+IR+  +     ++ + +   G A+   +WS + PA+F   D    +  W++L N   P+  Q +                PD+  + T +    K       L+L    G ++V  L   ++ P +D+  ++  L+Q
Sbjct:  410 FVDFATASHRQKSRSQALKQKTRSSKLLRLIDLDFSFTFSLLDLPPVNEYDMYIRNFGKKNTKQAYVQYNEDNVERDIQTEDIETREVWTQHP-----------------GEGTAVSGGSEEKDFSDVTVVPKIDTPRLANFLRAACQVVAVLLEEDRLAAGPSWIPRAQDKALNISDSSSQLNTSLP-FLQSRKVSCLHA--SRVQRQTVVSVHDLPEKAFAPSLDSRHL--LCVWDIWQPSG-PQKVLIC------ESKVTCCCFSP-LKAFLLFAGTVHGSVVVWDLREDSRIHHYVRLSNCFWAFRTPTFSTDGILTSVNHRSPLQAIEPVATSAYKKQSFVLSPFSTQEEMAGLSFHIASLDETGVLNVWVVVELPKAD----ISGSMSDLGLIPGGRIKLVHSTVIQLGNSLSHKDSELWGSTQTLSVKFLPSDPNHFVVGTDMG-LISHSTRQDWRV--SPRVFKPEQHGVRPI----KVNVIDFSPFEETVFLAGCSDGSIRLHQLTSERPIMQWDNSTSGHAVTSLQWSPTRPAVFLVQDDASRIYVWDLLENDLGPVAQQPIS---------------PDKLVAMTIVGEPEKTSGSFVALVLARTSGTVDVQNLKRRWTTPAVDEHSQLRLLLQ 998          
BLAST of WD repeat domain 60 vs. UniProt
Match: sp|Q8WVS4|WDR60_HUMAN (WD repeat-containing protein 60 OS=Homo sapiens OX=9606 GN=WDR60 PE=1 SV=3)

HSP 1 Score: 145.591 bits (366), Expect = 5.866e-34
Identity = 164/648 (25.31%), Postives = 275/648 (42.44%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSS-------GILIQTLTMVENILEEE---AWCDVEIKMSDSQQVISKGYSKF--SMPDGVDCLIARFAVA--NSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENS--HSKSRRIDLLPAYLTSA-STDDV--ELFHKGPIVGLQPIIN-----------------EMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLN----PSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGS-AILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKA-----RLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSLI 3084
            F++F  A  +      A +   R+  L RLI+LD    + +L++ PV E+  Y+R FGK        Q   DNV RD QTE I  R VWTQ P                 G+  +V   S G E    SD VV+           L     ++  +LEE+   A     ++  D     S   S+   S+P   +  ++    +     +  +VH   +    P    + +  + +W + + +G P   L C      +S V+    SP   A  +  G + G++ +WDLRE+S  H      D    + T+  STD +   + H+ P+  ++PI                   EM   S+ + SLD  G + +W+V  + + +     +GS++DL L PG R +L   A + L  S++   N +  T+ TLN    PS  +    GT+ G +I H    + RV  +  + +P+  G   +     V  +DF PF EP  LAG  DG+IR+  +  +  LL +     S A+   +WS + PA+F   D   N+  W++L +   P+  Q +                P+R  +   +    KA      L+L    G +++  L   ++ P++D+  ++  L+Q  +
Sbjct:  467 FVDFASASHRQKSRTQALKQKMRSTKLLRLIDLDFSFTFSLLDLPPVNEYDMYIRNFGKKNTKQAYVQCNEDNVERDIQTEEIETREVWTQHP-----------------GESTVV---SGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVHDLPEKSFVPLLDSKYV--LCVWDIWQPSG-PQKVLIC------ESQVTCCCLSP-LKAFLLFAGTAHGSVVVWDLREDSRLHYSVTLSDGFWTFRTATFSTDGILTSVNHRSPLQAVEPISTSVHKKQSFVLSPFSTQEEMSGLSFHIASLDESGVLNVWVVVELPKAD----IAGSISDLGLMPGGRVKLVHSALIQLGDSLSHKGNEFWGTTQTLNVKFLPSDPNHFIIGTDMG-LISHGTRQDLRV--APKLFKPQQHGIRPV----KVNVIDFSPFGEPIFLAGCSDGSIRLHQLSSAFPLLQWDSSTDSHAVTGLQWSPTRPAVFLVQDDTSNIYIWDLLQSDLGPVAKQQVS---------------PNRLVAMAAVGEPEKAGGSFLALVLARASGSIDIQHLKRRWAAPEVDECNRLRLLLQEAL 1058          
BLAST of WD repeat domain 60 vs. UniProt
Match: sp|P54703|DYIN_DICDI (Cytoplasmic dynein 1 intermediate chain OS=Dictyostelium discoideum OX=44689 GN=dicA PE=2 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 6.792e-6
Identity = 65/307 (21.17%), Postives = 125/307 (40.72%), Query Frame = 1
Query: 1942 IWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKSRRIDLLPAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPF-----FEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQN 2847
            +W V+    +P     C      QS V   TF     ++ ++ G  SG + +WD R    ++++ +   P  L+S         H  P+  +  ++   ++NS  L+S+ +  ++  W + ++++          +  ++L        ++            +S    +TS+    +  +  + GT  G I Q  R  N+ V N       R  G       G +T +D +P      F  Y L+   D T ++++  + T L +F       +  ++WS  HP+IF + D  G L  W+  LNQ+
Sbjct:  315 VWSVNNYFQKPEYVFTC------QSPV-MTTFFSKFHSTLIVGGTYSGQIVIWDTR----AEAKPVQKTP--LSSVG-------HTHPVYSMA-VVGSANANS--LVSISTDAKLCSWNLENLSQ---------PIETIELNSSNTNSANKAGGGGSGGGAPNMS--IAVTSLVFPENELNHFYIGTEEGVICQAGRHGNRIVMNE------RYKG-----HFGPITSVDLHPSKGGADFSQYFLSSSTDWTCKLWSSKKETPLYSFEDYV-DYVYDARWSPVHPSIFSTGDGSGTLSLWD--LNQD 573          
BLAST of WD repeat domain 60 vs. TrEMBL
Match: gnl|BL_ORD_ID|18338356 (tr|A0A267GS72|A0A267GS72_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016516g1 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 5.961e-47
Identity = 176/619 (28.43%), Postives = 283/619 (45.72%), Query Frame = 1
Query: 1279 SFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQE-----LGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKSRR-IDLL----PAYLTSASTDDVELFHKGPIVGLQPIINEMDS-NSYQLISLDSFGQMFIWMVS-HVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNS--HSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGY----IGFDVSSDSKWEFPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSL 3081
            +FI+F  A+++ ++   A+R   R  +LSRLI+LD+V YD+ ++AP+ E++ YMR +G++       QT  D + R++ T+ I     WTQ PP D  EC  +   N E       D +  +       + + S  +  S+  L +TL +V  +LEE++   V     ++   +S G++  +         + +  A+  +F     A  +   P +     S + +W       EP + L   +A G    V+   ++PD     V  GL  GAL LWD  E + S  R   D +    P Y T+ S     L   G +VGL  +   + S  +YQL+S+DS G++  W+ S HV   +     +GS +DL LRPG R  L R + + L S+ A +  P +  S   N         G   G +I+    A     +   HSI      G  +     +VT +D  P     LL GY DG +R+     ++ LL    K  S I++  WSRS PA+F+SLD  G L  +++    + P+ V +  G     +G D  S  +    DR+             +L+ A  G  EVH L++  S  +LD+ +++S LI  L
Sbjct:  313 AFIDFFGAKRRQANTAAASRTQRRWDELSRLIDLDKVSYDLFQLAPLEEYALYMRQYGRSNAHQAAVQTNEDAIDREAMTDDIEFSTRWTQNPPGDLVECAGVAAANDEDSADEDYDSKDKKKHKKKQTAQLPSKPIQPSAKSLQRTLDLVRRVLEEQSRPRVPNGRREAAGHLSSGFTPLTA-------SSTYGPASRALFDPKRSAKLLTMHPNS-----STLLLWNAH----EPELPLCVLSAPG---GVACACWTPD---EFVCAGLDDGALCLWDPTEPAESHGRYDADGVSIRGPTYSTAWSPVGNHL--GGGVVGLAAVGRALHSGGAYQLVSMDSSGRLQAWVASTHVGPAD----PAGSASDLGLRPGGRVSLMRSSRLELPSASAPL--PPLCMSAGAN---GDGAIVGGADGCLIRVNVGAGGSSGSRRCHSI-----CGDFEHRLPASVTAIDASPHGNGLLLIGYADGHVRLMTSSSTSPLLTVQPKSDS-IVRLLWSRSRPAVFYSLDSSGRLLVYDLTQKSSGPVSVFAESGVSDFALGEDYHSTGRGSKSDRA-----------VCVLVRANSGEAEVHTLAETLSAAELDEGYRLSQLIDQL 881          
BLAST of WD repeat domain 60 vs. TrEMBL
Match: gnl|BL_ORD_ID|15776576 (tr|A0A267GY92|A0A267GY92_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026569g1 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 5.478e-46
Identity = 176/619 (28.43%), Postives = 282/619 (45.56%), Query Frame = 1
Query: 1279 SFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQE-----LGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKSRR-IDLL----PAYLTSASTDDVELFHKGPIVGLQPIINEMDS-NSYQLISLDSFGQMFIWMVS-HVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNS--HSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGY----IGFDVSSDSKWEFPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSL 3081
            + I+F  A+++ ++   A+R   R  +LSRLI+LD+V YD+ ++AP+ E++ YMR +G++       QT  D V R++ T+ I     WTQ PP D  EC  +   N E       D +  +       + + S  +  S+  L +TL +V  +LEE++   V     ++   +S G++  +         + +  A+  +F     A  +   P +     S + +W       EP + L   +A G    V+   ++PD     V  GL  GAL LWD  E + S  R   D +    P Y T+ S     L   G +VGL  +   + S  +YQL+S+DS G++  W+ S HV   +     +GS +DL LRPG R  L R + + L S+ A +  P +  S   N         G   G +I+    A     +   HSI      G  +     +VT +D  P     LL GY DG +R+     ++ LL    K  S I++  WSRS PA+F+SLD  G L  +++    + P+ V +  G     +G D  S  +    DR+             +L+ A  G  EVH L++  S  +LD+ +++S LI  L
Sbjct:  340 ALIDFFGAKRRQANTAAASRTQRRWDELSRLIDLDKVSYDLFQLAPLEEYALYMRQYGRSNAHQAAVQTNEDAVDREAMTDDIEFSTRWTQNPPGDLVECAGVAAANDEDSADEDYDSKDKKKHKKKQTAQLPSKPIQPSAKSLQRTLDLVRRVLEEQSRPRVPNGRREAAGHLSSGFTPLTA-------SSTYGPASRALFDPKRSAKLLTMHPNS-----STLLLWNAH----EPELPLCVLSAPG---GVACACWTPD---EFVCAGLDDGALCLWDPTEPAESHGRYDADGVSIRGPTYSTAWSPVGNHL--GGGVVGLAAVGRALHSGGAYQLVSMDSSGRLQAWVASTHVGPAD----PAGSASDLGLRPGGRVSLMRSSRLELPSASAPL--PPLCMSAGAN---GDGAIVGGADGCLIRVNVGAGGSSGSRRCHSI-----CGDFEHRLPASVTAIDASPHGNGLLLIGYADGHVRLMTSSSTSPLLTVQPKSDS-IVRLLWSRSRPAVFYSLDSSGRLLVYDLTQKSSGPVSVFAESGVSDFALGEDYHSTGRGSKSDRA-----------VCVLVRANSGEAEVHTLAETLSAAELDEGYRLSQLIDQL 908          
BLAST of WD repeat domain 60 vs. TrEMBL
Match: gnl|BL_ORD_ID|20338098 (tr|A0A1S3JXF2|A0A1S3JXF2_LINUN WD repeat-containing protein 60 OS=Lingula unguis OX=7574 GN=LOC106177020 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.365e-41
Identity = 165/620 (26.61%), Postives = 279/620 (45.00%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSD-----EVVLSSGILIQTLTMVENILEEE--AWCDVEIKMSDSQQVISKGYSKFSMPDGV---DCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISP--IAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSH----SKSRRIDLL---PAYLTSASTDDVELFHKGPIVGLQPIINEMDSN----------------SYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATI--SNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAF-HHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLP--GYIGFDVSSDSKWEFPDRSPSATPIHI-NNKARLLLWALDGRLEVHELS 3018
            FINF  A+++   D  A++   R  +L +LIELD   + + ++ PV E+  YMR FG         QT  DN+ RD QTE I  +  W Q PP D                  L   G D +E+    D     + V  +  L Q+L +V  +LEE+      VE+  S S    S+     + P  +     L   F+   +N+   VH         G++ ++ +   I++W  +  +  P   L C      +S  +   FSP+  A+    G++ G+L +WDLRE +      ++R  + L   P Y T+      E  H  P+  + PI++  DS                 S+QL S +    + +W+V+ ++  ++    +GS +DL L PG R +L + +S  L +    +   +      + L+P+  S  + GT++G +    R+  + V        PR+  G ++     VT LDF PF     LAG  DG+IR+ ++   T L+ + +   G+A+   +WSRS P++F+ LD    L  W++L +   P++ ++        F +SSD          SAT + + N KA++++    G ++VH LS
Sbjct:  574 FINFVSAKQRQISDKAASKARRRGQELLQLIELDVANFSLFDLPPVKEYELYMRNFGSMNTKQAYIQTNEDNIDRDIQTEEIETKEKWCQHPPED------------------LKGSGGDDEETEKSVDSSGKVDSVRLTKFLQQSLQVVAILLEEDQAERNQVEVLASRSNTSFSESTISLTQPSFLADRPVLQCHFSPVQNNLLLAVHGPPAG----GSRMELANKGMISLWNTNEPS-RPKQILTC------ESQPTCCCFSPE-KATLAFAGMTDGSLVVWDLREPASMHHVYRTREEEWLLRKPTYFTAGILG--EENHHSPVTTVIPIVSAADSAKASVMSAKETDFGTGLSFQLASAEENAWVHLWVVAEISNPDE----AGSESDLGLAPGGRVKLLKSSSCKLENPTRDVRLKSSLRAHELALSPANPSNFYVGTDSGYVYHGVRSGGKAV--------PRTYKG-EVDAPVPVTCLDFPPFSHQCFLAGCADGSIRLHSLHLETPLVTWLNSTNGNAVQVIRWSRSRPSVFYVLDAAAKLHVWDLLKDDAAPVNTETFSQDSSCTFSLSSDH---------SATGMGLPNRKAQMVVSFKRGGMDVHTLS 1139          
BLAST of WD repeat domain 60 vs. TrEMBL
Match: gnl|BL_ORD_ID|20317805 (tr|A0A1S3I0W6|A0A1S3I0W6_LINUN WD repeat-containing protein 60-like OS=Lingula unguis OX=7574 GN=LOC106159965 PE=4 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 1.174e-40
Identity = 164/615 (26.67%), Postives = 275/615 (44.72%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEE--AWCDVEIKMSDSQQVISKGYSKFSMPDGV---DCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISP--IAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSH----SKSRRIDLL---PAYLTSASTDDVELFHKGPIVGLQPIINEMDSN----------------SYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSV--ATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAF-HHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLP--GYIGFDVSSDSKWEFPDRSPSATPIHI-NNKARLLLWALDGRLEVHELS 3018
            FINF  A+++   D  A++   R  +L +LIELD   + + ++ PV E+  YMR FG         QT  DN+ RD QTE I  +  W Q PP D              GD +      D    +   D V L+   L Q+L +V  +LEE+       E+  S S    S+     + P  +     L   F+   +N+   VH         G+  ++ +   I++W  +  +  P   L C      +S  +   FSP+  A+    G++ G+L +WDLRE +      ++R  + L   P Y T+      E  H  P+  + PI++  DS                 S+QL S +    + +W+V+ ++  ++    +GS +DL L PG R +L + +S  L +      + +      + L+P+  S  + GT++G +    R+  + V        PR+  G ++     VT LDF PF     LAG  DG+IR+  +   T L+ + +   G+A+   +WSRS P++F+ LD    L  W++L +   P++ ++        F +SSD          SAT + + N KA++++    G ++VH LS
Sbjct:   54 FINFVSAKQRQISDKAASKARRRGQELLQLIELDVANFSLFDLPPVKEYELYMRNFGSMNTKQAYIQTNEDNIDRDIQTEEIETKEKWCQHPPED---------LKGSGGDDEETEKSVDSSGKV---DSVRLTK-FLQQSLQVVAILLEEDQAERNQAEVLASRSNTSFSESTISLTQPSFLADRPVLQCHFSPVQNNLLLAVHGPPSG----GSCMELANKGMISLWNTNEPS-RPKQILTC------ESQPTCCCFSPE-KATLAFAGMTDGSLVVWDLREPASMHHVYRTREEEWLLRKPTYFTAGILG--EENHHSPVTTVIPIVSAADSAKASVMSAKETDFGTGLSFQLASAEENAWVHLWVVAEISNPDE----AGSESDLGLAPGGRVKLLKSSSCKLENPTRDVRLKSSLRAHELALSPANPSNFYVGTDSGYVYHGVRSGGKAV--------PRTYKG-EVDAPVPVTCLDFPPFSHQCFLAGCADGSIRLHNLHLETPLVTWLNSTNGNAVQVIRWSRSRPSVFYVLDAAAKLHVWDLLKDDAAPVNTETFSQDSLCTFSLSSDH---------SATGMGLPNRKAQMVVSFKRGGMDVHTLS 619          
BLAST of WD repeat domain 60 vs. TrEMBL
Match: gnl|BL_ORD_ID|23858968 (tr|V4AE21|V4AE21_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_199790 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.490e-39
Identity = 153/566 (27.03%), Postives = 261/566 (46.11%), Query Frame = 1
Query: 1279 SFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLS--DEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVD---CLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKSRRIDL--------LPAYLTSASTDDVELFHKGPIVGLQPII---------NEMDSN--SYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSV------ATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETG-TVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHH----KPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSL 2871
            +FINF  A+++     V+++   R  DL +LIE D   +DI ++ PV E+  Y+R FG+        QT  DN+ RD QTE I     WTQ P  D   C     DN E   +++    S+ + + ++S   +   + GIL+   +   N   E+    ++  +S      S GY +  MP  +       A ++ +  N   T +    + ++  + Q+ I  I +W +   +  P   LAC      +S  +   FSP+   S V  G++ G+L +WDLRE  +   R I L         P Y T+  ++     H  P+  L P+           E D++  S+QL S++  G + +W+V+ +   +    ++GS  DL L PG + +L + +++ L S +      +  +  + +++  LN       + GT+TG +I   R          S + PR  G T + +T   V  +DF PF   YLLAG  DG+I ++       L++++     +P   I   +WSRS  A+FF LD   NL  +++L   ++P+HV  +
Sbjct:   49 TFINFVNAKQRAVDQKVSDKTRKRGKDLLKLIEFDHASFDIFDLPPVKEYELYIRSFGRTDTRQAYIQTNEDNLDRDIQTEEIELLDKWTQYPAEDLLGCGG---DNVESVKQEMKTPASELESTRMVSFLSKAAQAIGILLNEESTTSN---EDGEKGIKSNLS-----ASDGYHQLGMPLILKDRYVTYANYSPSQPNYLLTCYSMPSLNSENTSMQKGI--ICVWNIMEPSS-PQKYLAC------ESQPNCCCFSPN-RTSLVCAGMTDGSLVIWDLREQGYMH-RMIKLDQEEYLFRFPTYNTAGVSESEN--HHSPVQSLVPVFPDPTSSQYKEETDNSGLSFQLASVEKNGCVNLWVVTEIPSPD----SAGSEVDLGLSPGGKIKLVKSSTIKLNSPLKLDKGDSLQAFEFKLSTCDLN-----HFYVGTDTGYVIHGVRFG--------SSAFPR--GHTSVIDTPLKVNSIDFSPFGYSYLLAGCSDGSIHLYHTKLENPLVSWNDLSDGQP-CCIQSVRWSRSRAAVFFVLDDHSNLYTFDLLEGDSRPVHVDKI 570          
BLAST of WD repeat domain 60 vs. Ensembl Cavefish
Match: wdr60 (WD repeat domain 60 [Source:ZFIN;Acc:ZDB-GENE-140821-1])

HSP 1 Score: 138.658 bits (348), Expect = 3.234e-33
Identity = 166/647 (25.66%), Postives = 263/647 (40.65%), Query Frame = 1
Query: 1246 KSATKIGQFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKG----YSKFSMPDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKS------RRIDL-LPAYLTSASTDDVELF---------HKGPIVGLQPIINEMDSNS----YQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSC--------SSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGSA-ILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSLI 3084
            +S TK G+     I+F  A+++      A++   R+ +L RLI+LD  V   +L++ PV E+  Y++ FG A       Q   DN  RD+QTE  +    WTQ PP  +  C      +Q+  D  +VR   D            L S   +  + + EN  E           +DS    S+G     +K     G    +  F+   ++   +VH      ++   Q +  + I +W V   +    I +        ++ V    FSP   A+ V  G + G++ LWDLRE+S + S          L  P + T A       F               G++    E    S    +QL SLD  G + +W+V+ + + +     SGS TDL LRPG + +L   +S+      +  S  + +T VT   S         S+  F GTN G + +  R   + V        P+     D      +T LDF P  EP+ L G  DGT+R+ +V R   +  +    G   +L   WSR+ P++F  LD    L  W++      P+  +S   +    V++ + +    R         N  + + L    GRLE+H L    + P   DS K+  L Q  I
Sbjct:  115 ESHTKKGRTHGRVIDFTAARQREVSQQTADKQKKRSAELLRLIDLDYSVTMCLLDLPPVSEYDMYIKSFGMANTKQAYVQCNEDNTDRDTQTEETDTVDKWTQHPPESNTACGGPKA-SQDTSDESVVRMNIDSKRLTTF-----LRSAAQVMAVLLEENRAENRNSVKQLHSQTDSLS-FSEGCLHLNTKLPFLQGRQVTLLHFSQVQTHTLLSVHAPRSGSSE--EQLESKTLICVWNVWEPSAPQRILI-------YEAEVRCCCFSPG-KATLVFAGTAVGSVVLWDLREHSGAHSSLSADGEEFTLRYPTFSTDAVLAGAGHFSSVVSVEPVVVNVESGIRGSFLEDQEESLGLLFQLGSLDENGLLNLWVVTELPKADD----SGSQTDLGLRPGGKVKLLHSSSIQ----TSDRSTRHGVTGVTPLLSLLLKFLPSDSNHYFIGTNMGVVRRGTRHGLRAV--------PKLYRPEDGERPADITALDFCPSGEPFFLVGCSDGTVRLHSVLREEPVSEWSTGSGDVPVLSVLWSRTRPSVFCVLDAASVLHIWDLAEKDMCPVITES---FQTDRVNAMAVFGEATRQ--------NRYSGMALAKQSGRLEIHFLKPPLTVPQPSDSEKLHLLAQDNI 717          
BLAST of WD repeat domain 60 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004941.1 (pep scaffold:Pmarinus_7.0:GL478425:75639:87045:1 gene:ENSPMAG00000004478.1 transcript:ENSPMAT00000004941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 6.115e-13
Identity = 61/265 (23.02%), Postives = 119/265 (44.91%), Query Frame = 1
Query: 1252 ATKIGQFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCP---------PLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCL----IARFAVA--NSNIFATVHQ--ASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACP 1995
            A++ G    +FI+F  A ++ +   V  +   R  ++ R+I+LD V +D+L+M PV E+  Y+  +G++       Q G D+V R+ QTE I     W+Q P         P DD        + Q+L  ++L R                L+S   + ++ + E   E+EA  ++E + S     +S G S + +   +  L    ++R  V+    ++  +VH    S++Q      + ++  + +W + + +    + L+ P
Sbjct:  420 ASRSGGSGKTFIDFTGAGERTATRKVVAKQRKRGLEVLRMIQLDTVTFDLLDMPPVSEYDAYISTYGRSNTKQAYVQCGEDDVEREVQTEEIETEEKWSQHPGEGPIVCAGPADDAGGGVGTREEQQLDAQRLQR---------------FLASAFQVVSVLLEEEWTEKEASRNLETRTSS----LSVGSSFYPLHTDLPFLHGRTVSRLHVSEVQRHMLLSVHPPGPSRLQVDAVLARCVV--LCVWDLRQPSQPQRVLLSEP 663          
BLAST of WD repeat domain 60 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004938.1 (pep scaffold:Pmarinus_7.0:GL478425:75639:87045:1 gene:ENSPMAG00000004478.1 transcript:ENSPMAT00000004938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.895e-11
Identity = 33/102 (32.35%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 1252 ATKIGQFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCP 1557
            A++ G    +FI+F  A ++ +   V  +   R  ++ R+I+LD V +D+L+M PV E+  Y+  +G++       Q G D+V R+ QTE I     W+Q P
Sbjct:  435 ASRSGGSGKTFIDFTGAGERTATRKVVAKQRKRGLEVLRMIQLDTVTFDLLDMPPVSEYDAYISTYGRSNTKQAYVQCGEDDVEREVQTEEIETEEKWSQHP 536          
BLAST of WD repeat domain 60 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004924.1 (pep scaffold:Pmarinus_7.0:GL478425:44510:49458:1 gene:ENSPMAG00000004474.1 transcript:ENSPMAT00000004924.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 6.886e-10
Identity = 47/162 (29.01%), Postives = 77/162 (47.53%), Query Frame = 1
Query: 2626 LDFYPFFE---PYLLA-GYDDGTIRIFAVGRSTHLLAFHHKPGS--------AILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQ 3075
            ++FYP      P ++  G  DG IR+ ++G    L ++   PG         A+   +WS S PA+FF LD  G + +W++L ++   L V+  P   G  V+  +   F D      P      + L+L    G +EVH+LS   S PD D+  ++ +L+ 
Sbjct:   34 VEFYPLISLRVPRVVQMGSGDGGIRLHSLGHEEPLESW---PGEREGLAESRALRAVRWSLSRPAVFFVLDGAGQVRSWDLLKSRGGALGVEK-PTRCGRVVAMAA---FGDPEKPGLP------SGLVLAKEGGAVEVHQLSSKLSTPDEDEVSRLETLLH 182          
BLAST of WD repeat domain 60 vs. Ensembl Sea Lamprey
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 48.9062 bits (115), Expect = 4.187e-6
Identity = 40/155 (25.81%), Postives = 64/155 (41.29%), Query Frame = 1
Query: 2431 ISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFA--VGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQN----------QPLH 2859
            + N    T +   P+  ++   GT  G ++   R A          +    + GT     G V  L  +PFF P       D T RI++  +  S+ +   +H   S +    WS   PA+FF+  M+G+L  W++L  QN          +PLH
Sbjct:   75 LDNAMGATCLEFEPTMPTKFMVGTEQGMVVSCNRKAK---------TPAEKIVGTYSGHHGPVYALQRHPFF-PKNFLTIGDWTARIWSEEIRDSSIMWTKYHM--SYLTDGCWSPVRPAVFFTTKMDGSLDVWDLLFKQNNATLTLQVSDEPLH 217          
BLAST of WD repeat domain 60 vs. Ensembl Nematostella
Match: EDO49529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGI4])

HSP 1 Score: 147.517 bits (371), Expect = 9.127e-37
Identity = 168/641 (26.21%), Postives = 280/641 (43.68%), Query Frame = 1
Query: 1285 INFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQL-----VRHGS----DGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWC----DVEIKMSDSQQVISKGYSKFSM---PDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRE-----NSHSKSRRIDLL--PAYLTSAS-TDDVELFHKGPIVGLQPIINEMDSN------------------SYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATIS--NPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAF-HHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLP-GYI-GFDVSSDSKWE--FPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFS--NPDLDDSF 3054
            INF  A++K     VA++   R  +L RLI+LD   +++ ++ P+ E+  Y++ FG++       Q   DNV R+ QTE I  R +WTQ P      C +     + L  +       VR  S     G   +VL +E ++      QT     +I+ +E+ C    D  ++++  Q ++  G S  S+   P     ++A    A   I     Q  + ++Q GN  +    + +W ++  + EP   L C      +S       SP   A+    GL  G++  WDLRE     +S+    R  +L  P + T+   T D    H  P+V L P++   DS                   S+QL SL+    M IW+V  +   +     +GS +DL L PG + +L + AS+ L      +     +  + +   P   +  +  T+TG ++   R   +        S P++   T I     ++ +D  P+  P +L G  DG +R++ +     L  + H   G  IL  +WSRS P +FF LD +  L  W++L N++ P  V+    G +  F++SSD + +   P RSP            ++L    G +EVH ++  FS  +PD  D F
Sbjct:   45 INFVAAKQKQISQKVASKTRKRGQELMRLIDLDVSAFEMFDLPPMNEYELYIKNFGRSDTKQAYVQCNDDNVDRELQTEDIEIRTIWTQHPAEGLAGCGESFTTEEFLSTKSSSHIDSVRMTSFLKKAGQACLVLLEEALVE-----QT-----SIMLKESKCLACTDGYVQLATKQPLLG-GRSIRSVHISPVQTHLMLA----ALGPIEGPPSQQVQYKSQDGNVAKR-GLVCLWNINEPS-EPQKVLVC------ESLPRCCCLSPS-KATLAFAGLEDGSVVAWDLREPASLHHSYKIGDRDVVLRSPTFSTAGVLTQDA---HHSPVVTLLPVVMPGDSVRASSGSSGILGSDDIVGLSFQLASLERDAMMNIWVVVEMETAD----VAGSESDLGLAPGGKIKLIQSASLPLEPPFREVRRLGGFQTSVMHFLPQDPNHFYIATDTGYVLHRYRHGGR--------STPKAYQPT-IECLVEISAMDVSPWQLPCILVGSKDGILRLYNIRNEFPLSTWSHFTRGIPILSVRWSRSRPGVFFVLDEDSGLYIWDLLENESGPAAVERFKHGRVTSFELSSDMQHQAGIPGRSP-----------EMVLAYESGVIEVHRINSKFSECSPDEFDKF 634          
BLAST of WD repeat domain 60 vs. Ensembl Medaka
Match: wdr60 (WD repeat domain 60 [Source:NCBI gene;Acc:101160028])

HSP 1 Score: 80.4925 bits (197), Expect = 6.143e-15
Identity = 80/285 (28.07%), Postives = 117/285 (41.05%), Query Frame = 1
Query: 1282 FINFRIAQKKYSHDLVANRMLSRAFDLSRLIELD-RVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIAR------FAVANSNIFATVHQA-SKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRE 2112
            FI+F  A+++      A + + R  DL RLI+LD  V + +L++ PV E+  Y+R FG A      +Q   DN  RD QTE I     WTQ P      C          GD  L +   +     +  D   L+S +   +  M+  + E++A    +IK+      +S       +   +  L  R      F+    +   +VH   SK      +   II    IW+ SR    P   L        +S V    FSP  A   V  G S G++ LWDLRE
Sbjct:  464 FIDFVAAKRREVSKKDAVKQMRRCTDLRRLIDLDFSVTFSLLDLPPVSEYELYIRNFGSANTKQAYAQCNEDNTERDIQTEGIEMCEKWTQHPSQHSGAC----------GDSNLAQGARERTRQDLNFDSQRLTSFLQSASQVMLVLLEEDQAERKSQIKLKTQPDSLSFSEGSLQINTKLPFLFGRQVSLVHFSQVQRHTMLSVHMPISKPSAVRLDSNAIICIWNIWEPSR----PQKILL------YESEVQCCCFSPGKAIL-VFAGTSVGSVVLWDLRE 727          
BLAST of WD repeat domain 60 vs. Ensembl Medaka
Match: ENSORLT00000035192.1 (pep primary_assembly:ASM223467v1:20:19901313:19902756:1 gene:ENSORLG00000027898.1 transcript:ENSORLT00000035192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 3.228e-7
Identity = 25/86 (29.07%), Postives = 43/86 (50.00%), Query Frame = 1
Query: 2617 VTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFH-HKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSL 2871
            V  + F PF     L G  DG+IR+  V R   +  +     G  +L  +W+++ P +F  LD   NL  W+++ N+ QP+  + +
Sbjct:   13 VCSIHFSPFRPDCFLVGCMDGSIRMHTVSRERPVAEWSGSTAGEPVLSVEWAQTRPTVFCVLDAASNLQIWDLMKNEAQPVITERM 98          
BLAST of WD repeat domain 60 vs. Planmine SMEST
Match: SMESG000040271.1 (SMESG000040271.1)

HSP 1 Score: 1842.4 bits (4771), Expect = 0.000e+0
Identity = 993/1012 (98.12%), Postives = 994/1012 (98.22%), Query Frame = 1
Query:   49 MSSKDRKHSKIRTSESGDFELNSDRPNKHSSSKERSDKKHPVVDKEIDSEYKYKIKKSAEVGKEDKHRRRIKEEYSNENRKVREIDSDNKQRQRSDKNDEKIERDSMQRRRNEEEFNDSKRNRKREKEVKHNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVKDKEKEARHHRKDNEDELGEREKRHKRNKEVELKESTLHHRRGSDARREDSGNLXXXXXXXXXXXXXXXXXXXXXXXLIDRANVEGKRGSLVNAERNAERKGGKETVAERTQQIDGEREQEDREHRARAGGNQRNSQADVDQEVAYXXXXXXXXXXXXXGAAVESPGGSNGPVNICCVVPDGIDERYCQADTTESSSNGIIATKSRSNQARVPLCXXXXXXXXXXXXXXLKSATKIGQFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKSRRIDLLPAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSLI 3084
            MSSKDRKHSKIRTSESGDFELNSDR NKHSSSKERSDKKHPVVDKEIDSEYKYKIKKSAEVGKEDKHRRRIK+EYSNENRKVREIDSDNKQRQRSDKNDEKIERDSMQRRRNEEEFNDSKRNRKREKEVKHNEQERREKKEPIEERNELKRLRKKEKDEEDDGRDRRHVKDKEKEARHHRKDNEDELGEREKRHKRNKEVELKESTLHHRRGSDARREDSGNLREKDKEKIRARRKRDKDEENREELIDRANVEGKRGSLVNAERNAERKGGKETVAERTQQIDGEREQEDREHRARAGGNQRNSQADVDQEVAYDDDFENYDEEELEGAAVESPGGSNGP                 ADTTESSSNGIIATKSRSNQARVPLCPPPAAATAGTQQATLKSATKIGQFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKSRRIDLLPAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSLI
Sbjct:    1 MSSKDRKHSKIRTSESGDFELNSDRLNKHSSSKERSDKKHPVVDKEIDSEYKYKIKKSAEVGKEDKHRRRIKDEYSNENRKVREIDSDNKQRQRSDKNDEKIERDSMQRRRNEEEFNDSKRNRKREKEVKHNEQERREKKEPIEERNELKRLRKKEKDEEDDGRDRRHVKDKEKEARHHRKDNEDELGEREKRHKRNKEVELKESTLHHRRGSDARREDSGNLREKDKEKIRARRKRDKDEENREELIDRANVEGKRGSLVNAERNAERKGGKETVAERTQQIDGEREQEDREHRARAGGNQRNSQADVDQEVAYDDDFENYDEEELEGAAVESPGGSNGP-----------------ADTTESSSNGIIATKSRSNQARVPLCPPPAAATAGTQQATLKSATKIGQFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYDILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWTQCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILIQTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFAVANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPNAGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKSRRIDLLPAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVSSDSKWEFPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFSNPDLDDSFKVSSLIQSLI 995          
BLAST of WD repeat domain 60 vs. Planmine SMEST
Match: SMESG000075110.1 (SMESG000075110.1)

HSP 1 Score: 54.6842 bits (130), Expect = 3.422e-7
Identity = 68/272 (25.00%), Postives = 108/272 (39.71%), Query Frame = 1
Query: 2062 VICGLSSGALALWDLRENSHSKSRRIDLLPAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWMVSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYVITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTDIFETGTVTQLDFYPFF-EPYLLAGYDDGTIRIFA--VGRSTHLLAFHHKPGSAILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQP-LHVQ 2865
            +I G  +G LALWD R+ S          P  ++      VE  H+ P   +  I ++  +  +   S  + GQ+F W V  +AE  +  +         L P  +  L +      +   +TI                ++   GT  G I+   R          +I  P  L        G V  L   PFF + +L  G  D T RI++  +  S+ +   +H   SA+    WS   PA+FF+  M+G L  W+I+  Q +P L +Q
Sbjct:  231 LIGGCYNGQLALWDRRKGSQ---------PTEVSP-----VENSHRDPAWKVIWIQSKTGTECF---SASTDGQVFWWDVRKMAEPTEIMI---------LDPTKKQDLEKAQGAYALEYESTI---------------PTKFMAGTEQGSIMSCNRKGKTPADKIAAI-YPGHL--------GPVYALQRNPFFPKNFLTVG--DWTARIWSEDIRDSSIMWTKYHL--SALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQ 448          
The following BLAST results are available for this feature:
BLAST of WD repeat domain 60 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
WDR601.222e-3425.31WD repeat domain 60 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR603.069e-938.71WD repeat domain 60 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR601.233e-724.15WD repeat domain 60 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat domain 60 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat domain 60 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat domain 60 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr605.231e-3826.27WD repeat domain 60 [Source:ZFIN;Acc:ZDB-GENE-1408... [more]
wdr601.856e-3425.93WD repeat domain 60 [Source:ZFIN;Acc:ZDB-GENE-1408... [more]
dnai2b1.097e-723.29dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b1.426e-722.60dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b1.591e-723.29dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
back to top
BLAST of WD repeat domain 60 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000025126.13.945e-3525.61WD repeat domain 60 [Source:NCBI gene;Acc:10049638... [more]
ENSXETT00000025141.14.654e-3525.61WD repeat domain 60 [Source:NCBI gene;Acc:10049638... [more]
ENSXETT00000037636.12.245e-2523.52WD repeat domain 60 [Source:NCBI gene;Acc:10049638... [more]
back to top
BLAST of WD repeat domain 60 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Wdr604.213e-3525.43WD repeat domain 60 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of WD repeat domain 60 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8C761|WDR60_MOUSE2.947e-3425.43WD repeat-containing protein 60 OS=Mus musculus OX... [more]
sp|Q8WVS4|WDR60_HUMAN5.866e-3425.31WD repeat-containing protein 60 OS=Homo sapiens OX... [more]
sp|P54703|DYIN_DICDI6.792e-621.17Cytoplasmic dynein 1 intermediate chain OS=Dictyos... [more]
back to top
BLAST of WD repeat domain 60 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|183383565.961e-4728.43tr|A0A267GS72|A0A267GS72_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157765765.478e-4628.43tr|A0A267GY92|A0A267GY92_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|203380983.365e-4126.61tr|A0A1S3JXF2|A0A1S3JXF2_LINUN WD repeat-containin... [more]
gnl|BL_ORD_ID|203178051.174e-4026.67tr|A0A1S3I0W6|A0A1S3I0W6_LINUN WD repeat-containin... [more]
gnl|BL_ORD_ID|238589684.490e-3927.03tr|V4AE21|V4AE21_LOTGI Uncharacterized protein OS=... [more]
back to top
BLAST of WD repeat domain 60 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wdr603.234e-3325.66WD repeat domain 60 [Source:ZFIN;Acc:ZDB-GENE-1408... [more]
back to top
BLAST of WD repeat domain 60 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004941.16.115e-1323.02pep scaffold:Pmarinus_7.0:GL478425:75639:87045:1 g... [more]
ENSPMAT00000004938.11.895e-1132.35pep scaffold:Pmarinus_7.0:GL478425:75639:87045:1 g... [more]
ENSPMAT00000004924.16.886e-1029.01pep scaffold:Pmarinus_7.0:GL478425:44510:49458:1 g... [more]
dnai2b4.187e-625.81dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
back to top
BLAST of WD repeat domain 60 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat domain 60 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO495299.127e-3726.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat domain 60 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wdr606.143e-1528.07WD repeat domain 60 [Source:NCBI gene;Acc:10116002... [more]
ENSORLT00000035192.13.228e-729.07pep primary_assembly:ASM223467v1:20:19901313:19902... [more]
back to top
BLAST of WD repeat domain 60 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000040271.10.000e+098.12SMESG000040271.1[more]
SMESG000075110.13.422e-725.00SMESG000075110.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013424 ID=SMED30013424|Name=WD repeat domain 60|organism=Schmidtea mediterranea sexual|type=transcript|length=3146bp
TAATTATTTATCATAGTTTTACTCTTTCACTAAGTTTTAGATATTTGAAT
GAGTTCGAAAGACAGAAAACATAGCAAAATTCGAACATCAGAATCAGGAG
ATTTTGAATTGAATTCAGATAGACCAAATAAGCATTCATCTAGTAAGGAA
CGGTCTGATAAAAAGCATCCGGTAGTCGATAAGGAAATTGATTCTGAATA
TAAATATAAAATTAAAAAGTCTGCCGAAGTTGGTAAAGAGGATAAGCACA
GACGAAGAATAAAAGAGGAATATTCAAATGAAAATAGAAAAGTAAGAGAA
ATAGATTCAGACAACAAGCAGCGCCAAAGGTCTGATAAGAACGATGAAAA
GATAGAGAGGGACAGCATGCAAAGGAGAAGAAATGAAGAAGAGTTTAATG
ATTCGAAGAGAAATAGAAAAAGGGAAAAAGAGGTCAAACACAATGAGCAA
GAAAGACGTGAGAAAAAGGAACCGATTGAAGAACGGAATGAGTTAAAACG
GCTTCGGAAGAAAGAGAAAGATGAGGAGGATGACGGCCGAGATAGGCGGC
ATGTAAAGGACAAGGAGAAAGAGGCAAGGCACCACAGGAAAGACAATGAA
GATGAATTAGGTGAGCGAGAAAAGCGGCATAAGAGAAATAAAGAAGTGGA
GTTGAAGGAGTCAACTCTGCACCATAGGAGAGGCAGTGATGCCAGGAGGG
AGGACAGTGGCAATTTGAGGGAGAAAGACAAGGAGAAAATTCGGGCTAGG
AGGAAACGGGACAAAGATGAGGAGAATCGAGAGGAGTTAATCGACAGAGC
GAATGTGGAGGGGAAACGTGGCTCATTGGTTAATGCCGAACGGAATGCCG
AGCGGAAGGGAGGCAAGGAAACGGTGGCAGAAAGGACGCAGCAGATCGAT
GGAGAGAGGGAGCAGGAGGACCGCGAGCACAGAGCAAGGGCGGGCGGGAA
CCAGCGCAATTCCCAGGCCGACGTTGACCAGGAGGTTGCCTATGACGACG
ATTTTGAGAATTACGATGAGGAGGAGTTGGAGGGAGCCGCGGTGGAATCA
CCTGGGGGATCAAACGGGCCGGTAAATATATGTTGCGTTGTTCCCGATGG
GATTGATGAGAGATATTGCCAGGCCGACACCACCGAGAGTTCATCCAATG
GAATCATCGCAACCAAATCGCGCTCCAACCAAGCCCGCGTCCCGTTATGC
CCTCCTCCTGCCGCAGCAACCGCCGGCACGCAGCAAGCAACATTGAAATC
AGCCACAAAAATTGGACAGTTTCAGAGTTCATTTATCAATTTCCGAATTG
CTCAGAAGAAATATTCTCATGATTTGGTGGCCAATCGGATGCTGTCAAGG
GCGTTTGACTTGTCGCGGTTGATAGAATTGGATCGGGTTGAATATGATAT
CCTGGAAATGGCCCCGGTTCTCGAGCACAGCCAGTACATGCGGCTATTTG
GGAAAGCGGGCTGCCTGCACGAGACCAGTCAAACTGGATCAGATAATGTC
AGCCGAGACAGTCAGACAGAGATGATCAATGAGAGAGTTGTCTGGACCCA
ATGTCCCCCTCTGGATGACCATGAATGCGTCCAGATAGTTTGTGACAACC
AGGAACTCGGGGACCGGCAGCTTGTCCGACACGGATCGGATGGAGATGAA
TCGATAGTGCTCAGTGATGAGGTGGTTTTGTCGTCAGGTATATTGATCCA
GACATTGACAATGGTGGAAAACATTCTCGAGGAGGAAGCCTGGTGCGATG
TGGAGATCAAAATGTCAGATTCCCAGCAAGTGATCAGCAAGGGTTACAGC
AAATTCTCCATGCCCGATGGGGTCGATTGCTTGATTGCTCGATTTGCGGT
CGCCAATAGCAACATATTTGCAACGGTCCATCAAGCCTCAAAAATGCAAA
CCCAACCGGGAAATCAGCAACAAATAATTTCTCCAATCGCAATCTGGAAA
GTGTCCAGATGCACCGGTGAACCTTACATAAAGCTGGCATGCCCGAATGC
AGGAGGAATGCAGTCGACTGTGAGCCAGCTGACATTCAGCCCGGATTGTG
CAGCATCTCATGTCATTTGCGGATTGAGCAGTGGAGCTCTTGCGCTGTGG
GATTTGAGGGAAAATTCCCATTCAAAGTCCCGTCGTATCGATTTACTGCC
AGCATATCTGACGAGTGCCTCGACCGACGATGTAGAATTGTTTCATAAGG
GTCCAATAGTTGGTTTGCAGCCAATCATTAATGAGATGGATTCCAATTCG
TATCAATTGATTTCCCTGGATTCGTTTGGGCAAATGTTCATTTGGATGGT
GAGTCATGTCGCTGAGATCAATCAGTGGAGCCTCGCGTCAGGATCATTGA
CTGATCTCCAGTTGCGTCCGGGGGCACGCTACCGGTTGTCAAGGGTAGCA
TCGATGAATCTGGTATCCAGTGTCGCGACCATCTCCAATCCATATGTCAT
CACATCGGTTACCTTGAACCCCTCGTGTTCCTCCCAATTGTTCTGCGGCA
CCAACACCGGACAGATTATCCAACACAAACGGGCAGCCAATCAGCGTGTC
ACAAACAGCCATTCAATCTCACAACCGAGATCATTAGGTGGAACCGATAT
TTTTGAAACTGGAACGGTGACGCAGCTCGATTTCTATCCATTTTTTGAGC
CGTATTTGCTGGCAGGATACGATGATGGCACAATTAGGATATTTGCTGTC
GGCCGATCAACACATCTATTGGCATTCCATCACAAACCCGGCAGTGCCAT
TCTACAGTCGAAATGGTCACGCAGTCATCCAGCAATTTTTTTCTCTTTGG
ACATGGAAGGAAATCTCTGCGCATGGAACATTCTGCTCAATCAGAATCAA
CCGTTGCACGTACAGTCGTTGCCTGGATACATCGGTTTCGATGTGAGCTC
CGACTCCAAATGGGAATTCCCTGACCGATCACCATCGGCAACACCAATCC
ACATCAATAACAAGGCAAGGCTGCTCCTGTGGGCGCTTGACGGCCGCCTG
GAGGTGCACGAATTATCAGACGCTTTCAGCAACCCTGATCTTGATGACAG
CTTTAAAGTGTCCTCGTTAATCCAATCTCTAATCTGAGTGCAAATATATT
ATCCCAACAAGCCGCTCAAATGATTTGTGTAATTAAATTATTAAAC
back to top

protein sequence of SMED30013424-orf-1

>SMED30013424-orf-1 ID=SMED30013424-orf-1|Name=SMED30013424-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1013bp
MSSKDRKHSKIRTSESGDFELNSDRPNKHSSSKERSDKKHPVVDKEIDSE
YKYKIKKSAEVGKEDKHRRRIKEEYSNENRKVREIDSDNKQRQRSDKNDE
KIERDSMQRRRNEEEFNDSKRNRKREKEVKHNEQERREKKEPIEERNELK
RLRKKEKDEEDDGRDRRHVKDKEKEARHHRKDNEDELGEREKRHKRNKEV
ELKESTLHHRRGSDARREDSGNLREKDKEKIRARRKRDKDEENREELIDR
ANVEGKRGSLVNAERNAERKGGKETVAERTQQIDGEREQEDREHRARAGG
NQRNSQADVDQEVAYDDDFENYDEEELEGAAVESPGGSNGPVNICCVVPD
GIDERYCQADTTESSSNGIIATKSRSNQARVPLCPPPAAATAGTQQATLK
SATKIGQFQSSFINFRIAQKKYSHDLVANRMLSRAFDLSRLIELDRVEYD
ILEMAPVLEHSQYMRLFGKAGCLHETSQTGSDNVSRDSQTEMINERVVWT
QCPPLDDHECVQIVCDNQELGDRQLVRHGSDGDESIVLSDEVVLSSGILI
QTLTMVENILEEEAWCDVEIKMSDSQQVISKGYSKFSMPDGVDCLIARFA
VANSNIFATVHQASKMQTQPGNQQQIISPIAIWKVSRCTGEPYIKLACPN
AGGMQSTVSQLTFSPDCAASHVICGLSSGALALWDLRENSHSKSRRIDLL
PAYLTSASTDDVELFHKGPIVGLQPIINEMDSNSYQLISLDSFGQMFIWM
VSHVAEINQWSLASGSLTDLQLRPGARYRLSRVASMNLVSSVATISNPYV
ITSVTLNPSCSSQLFCGTNTGQIIQHKRAANQRVTNSHSISQPRSLGGTD
IFETGTVTQLDFYPFFEPYLLAGYDDGTIRIFAVGRSTHLLAFHHKPGSA
ILQSKWSRSHPAIFFSLDMEGNLCAWNILLNQNQPLHVQSLPGYIGFDVS
SDSKWEFPDRSPSATPIHINNKARLLLWALDGRLEVHELSDAFSNPDLDD
SFKVSSLIQSLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005813centrosome
GO:0031021interphase microtubule organizing center
GO:0000242pericentriolar material
GO:0005615extracellular space
GO:0005868cytoplasmic dynein complex
GO:0005929cilium
GO:0042995cell projection
GO:0070062extracellular exosome
GO:0097542ciliary tip
GO:0097546ciliary base
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0045503dynein light chain binding
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0035735intraciliary transport involved in cilium assembly
GO:0048704embryonic skeletal system morphogenesis
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 223..250
NoneNo IPR availableCOILSCoilCoilcoord: 117..137
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..310
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..253
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 261..299
NoneNo IPR availablePANTHERPTHR12442:SF30WD REPEAT-CONTAINING PROTEIN 60coord: 131..1009
NoneNo IPR availablePANTHERPTHR12442DYNEIN INTERMEDIATE CHAINcoord: 131..1009
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 887..927
e-value: 82.0
score: 4.9
coord: 639..685
e-value: 5.1
score: 12.5
coord: 845..883
e-value: 2.9
score: 14.1
coord: 788..827
e-value: 55.0
score: 6.0
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 651..694
score: 8.737
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 851..957
e-value: 3.8E-6
score: 28.1
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 628..846
e-value: 2.0E-8
score: 35.4
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 651..694
score: 8.756
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 630..941