Cadherin like and PC-esterase domain containing 1

Overview
NameCadherin like and PC-esterase domain containing 1
Smed IDSMED30013417
Length (bp)1498
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cadherin like and PC-esterase domain containing 1 (SMED30013417) t-SNE clustered cells

Violin plots show distribution of expression levels for Cadherin like and PC-esterase domain containing 1 (SMED30013417) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cadherin like and PC-esterase domain containing 1 (SMED30013417) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cadherin like and PC-esterase domain containing 1 (SMED30013417) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013417

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013417SMESG000016689.1 SmedASXL_011145SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013417SMESG000016689.1 dd_Smed_v4_14757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013417SMESG000016689.1 dd_Smed_v6_14757_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30013417SMESG000016689.1 OX_Smed_1.0.05173ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Human
Match: CPED1 (cadherin like and PC-esterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26159])

HSP 1 Score: 139.813 bits (351), Expect = 1.767e-34
Identity = 99/294 (33.67%), Postives = 142/294 (48.30%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDP--QNYSIGLGHNQILKKVYLQTNRYYKMMIQ----IIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF V+ +TI +E   KC     L     P   +Y +GLG N+I   V  ++  + + +I     I R++R  P L    E  +      C  +Q C  +I   + C + QP    +  D++  I  + L   P+        W VPC+ C  + TC W +  W  HN C    L K +    L   KILFIGDST RG+ Y LIE LN +L +W K H    +   N     + YSYYP+FW     RP     L+++L R   ++ +   +L+VGGVQWLNSNHL  I + L
Sbjct:  600 VPFDVVTVTIGVE-TPKCLCKVHLYEQAGPSFASYPLGLGMNKISIFVVDESPAHGETLITYKLTIYREDR--PSLP-LFEAFTA-----CGFVQDCGLLIHPEETCGL-QP----ISSDYIEAILQSELKRCPSGDM--KGQWIVPCLSCSDNRTCDWREITWQPHN-CQYGVLTKPQLQQCLGGRKILFIGDSTNRGIMYYLIERLNETLQEWQKVHGTKFYHNVNGGKTLISYSYYPQFWISPSLRPTFENALEHLLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVL 876          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Human
Match: CPED1 (cadherin like and PC-esterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26159])

HSP 1 Score: 53.1434 bits (126), Expect = 1.148e-6
Identity = 49/179 (27.37%), Postives = 77/179 (43.02%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDP--QNYSIGLGHNQILKKVYLQTNRYYKMMIQ----IIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTK 1066
            +PF V+ +TI +E   KC     L     P   +Y +GLG N+I   V  ++  + + +I     I R++R  P L    E  +      C  +Q C  +I   + C + QP    +  D++  I  + L   P+        W VPC+ C  + TC W +  W  HN C    L K +
Sbjct:  600 VPFDVVTVTIGVE-TPKCLCKVHLYEQAGPSFASYPLGLGMNKISIFVVDESPAHGETLITYKLTIYREDR--PSLP-LFEAFTA-----CGFVQDCGLLIHPEETCGL-QP----ISSDYIEAILQSELKRCPSGDM--KGQWIVPCLSCSDNRTCDWREITWQPHN-CQYGVLTKPQ 761          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Human
Match: CPED1 (cadherin like and PC-esterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26159])

HSP 1 Score: 52.7582 bits (125), Expect = 1.167e-6
Identity = 49/179 (27.37%), Postives = 77/179 (43.02%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDPQ--NYSIGLGHNQILKKVYLQTNRYYKMMIQ----IIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTK 1066
            +PF V+ +TI +E   KC     L     P   +Y +GLG N+I   V  ++  + + +I     I R++R  P L    E  +      C  +Q C  +I   + C + QP    +  D++  I  + L   P+        W VPC+ C  + TC W +  W  HN C    L K +
Sbjct:  380 VPFDVVTVTIGVE-TPKCLCKVHLYEQAGPSFASYPLGLGMNKISIFVVDESPAHGETLITYKLTIYREDR--PSLP-LFEAFTA-----CGFVQDCGLLIHPEETCGL-QP----ISSDYIEAILQSELKRCPSGDM--KGQWIVPCLSCSDNRTCDWREITWQPHN-CQYGVLTKPQ 541          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Zebrafish
Match: cped1 (cadherin-like and PC-esterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041210-247])

HSP 1 Score: 132.88 bits (333), Expect = 2.134e-32
Identity = 88/297 (29.63%), Postives = 141/297 (47.47%), Query Frame = 2
Query:  548 IPFSVLYITIKIE-FDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCES---PNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF V+ I I+ E     C  +    R     NY +GLG+++I   V  ++     +M    + I R+ R  LP   +++          C+ +Q C  ++   +PC           ++ +  + S+   ++   P     E   W VPC+ C  + TC W +  W   N C    LD+ +    +   K+LFIGDST RG+ Y L+E +N +L  W K+H+ + +   N     + YSYYP+FW  +  RP     L+ +L R   ++ S   +L+ GGVQWLN NHL  I+Q L
Sbjct:  540 VPFDVITIQIRPEPVMPHCHIHLDEHRGPRMANYPVGLGNSRINILVMDESEAEPVVMTIYTLNIYRESRPSLPMFDEYV---------MCSFVQDCGLVVRPDQPCG----------LEPIPGVRSSGEAQASLRPCLSGDEPGRWVVPCLSCSDNRTCDWREVSWQPDN-CYHPLLDQPQLQSCMMERKVLFIGDSTNRGMMYYLMERVNTTLEDWDKAHNTIVYHNLNQGRTIVSYSYYPQFWLPKSHRPTFQRALQQLLERSQPLENSPQTVLVAGGVQWLNLNHLRTIRQVL 816          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Zebrafish
Match: cped1 (cadherin-like and PC-esterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041210-247])

HSP 1 Score: 103.99 bits (258), Expect = 5.403e-23
Identity = 73/265 (27.55%), Postives = 121/265 (45.66%), Query Frame = 2
Query:  548 IPFSVLYITIKIE-FDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCES---PNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLR 1315
            +PF V+ I I+ E     C  +    R     NY +GLG+++I   V  ++     +M    + I R+ R  LP   +++          C+ +Q C  ++   +PC           ++ +  + S+   ++   P     E   W VPC+ C  + TC W +  W   N C    LD+ +    +   K+LFIGDST RG+ Y L+E +N +L  W K+H+ + +   N     + YSYYP+FW  +  RP     L+ +L R
Sbjct:  527 VPFDVITIQIRPEPVMPHCHIHLDEHRGPRMANYPVGLGNSRINILVMDESEAEPVVMTIYTLNIYRESRPSLPMFDEYV---------MCSFVQDCGLVVRPDQPCG----------LEPIPGVRSSGEAQASLRPCLSGDEPGRWVVPCLSCSDNRTCDWREVSWQPDN-CYHPLLDQPQLQSCMMERKVLFIGDSTNRGMMYYLMERVNTTLEDWDKAHNTIVYHNLNQGRTIVSYSYYPQFWLPKSHRPTFQRALQQLLER 771          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Xenopus
Match: CPED1 (cadherin like and PC-esterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26159])

HSP 1 Score: 137.502 bits (345), Expect = 3.433e-34
Identity = 102/319 (31.97%), Postives = 153/319 (47.96%), Query Frame = 2
Query:  509 VILDNSSRTIKKL---IPFSVLYITIKIEFDRKCSNYSQLVRLNDPQN-----YSIGLGHNQI---------LKKVYLQTNRYYKMMIQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNS-IDSENIILIVGGVQWLNSNHLNEIKQFL 1408
            V++   S TIK     +PF ++ + I  E     ++    VRL + +      +++GLG NQI         L  + L++ R     I + R+ER  LP    ++          C  +Q C  II  GKPC ++        +    K      C+S +        W VPC+ C  + TC W    W  +  C    L K +    ++  KILFIGDST RG+ Y LIE +N +L +W KSH+ + F   N    ++ YSYYP+FW +  +RP   +TL+ ++ R    I+S   +L+VGGVQWLNSNH+  I   L
Sbjct:  190 VLVPAFSPTIKDYYVEVPFDMVMVEIGAE----AAHCDCKVRLEEKEGQGTVAFALGLGINQITIYVTDKSELTPIVLRSYR-----ISVHREERPSLPLFDHYI---------ICGFVQDCGLIIHSGKPCGLYP-------LSSFPKAPQKK-CDSGD----AKGQWIVPCLSCADNRTCDWRAISWYPYK-CQHPILIKPELQECMQERKILFIGDSTNRGIMYYLIERVNETLQEWQKSHA-MKFYNINKGRTAISYSYYPQFWIEATKRPTFESTLEQLIERSRPIINSHKTVLVVGGVQWLNSNHMQIINNIL 476          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Xenopus
Match: CPED1 (cadherin like and PC-esterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26159])

HSP 1 Score: 137.502 bits (345), Expect = 5.027e-34
Identity = 102/319 (31.97%), Postives = 153/319 (47.96%), Query Frame = 2
Query:  509 VILDNSSRTIKKL---IPFSVLYITIKIEFDRKCSNYSQLVRLNDPQN-----YSIGLGHNQI---------LKKVYLQTNRYYKMMIQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNS-IDSENIILIVGGVQWLNSNHLNEIKQFL 1408
            V++   S TIK     +PF ++ + I  E     ++    VRL + +      +++GLG NQI         L  + L++ R     I + R+ER  LP    ++          C  +Q C  II  GKPC ++        +    K      C+S +        W VPC+ C  + TC W    W  +  C    L K +    ++  KILFIGDST RG+ Y LIE +N +L +W KSH+ + F   N    ++ YSYYP+FW +  +RP   +TL+ ++ R    I+S   +L+VGGVQWLNSNH+  I   L
Sbjct:  265 VLVPAFSPTIKDYYVEVPFDMVMVEIGAE----AAHCDCKVRLEEKEGQGTVAFALGLGINQITIYVTDKSELTPIVLRSYR-----ISVHREERPSLPLFDHYI---------ICGFVQDCGLIIHSGKPCGLYP-------LSSFPKAPQKK-CDSGD----AKGQWIVPCLSCADNRTCDWRAISWYPYK-CQHPILIKPELQECMQERKILFIGDSTNRGIMYYLIERVNETLQEWQKSHA-MKFYNINKGRTAISYSYYPQFWIEATKRPTFESTLEQLIERSRPIINSHKTVLVVGGVQWLNSNHMQIINNIL 551          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Mouse
Match: Cped1 (cadherin-like and PC-esterase domain containing 1 [Source:MGI Symbol;Acc:MGI:2444814])

HSP 1 Score: 142.124 bits (357), Expect = 2.083e-35
Identity = 99/295 (33.56%), Postives = 146/295 (49.49%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDPQ--NYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF VL + I  E   KC   + L     P    Y +G+G N+I   V  +++     +    + I R++R  LP  +D+           C  +Q C  +I   + C + QP   E +I  +S+ E  + C S +        W VPC+ C  + TC W +  W  HN C  + L K +    L+  KILFIGDST RG+ Y LIE LN +L +W K H    +   N     + YSYYP+FW +   RP     L+++L R   ++ ++  +L+VGGVQWLNSNHL  I + L
Sbjct:  596 VPFDVLTVRIGAETS-KCQCKAHLQEQAGPSFATYPLGIGMNRISVLVVDESHAGGAALTTYKLTIYREDRPSLPFFEDFTA---------CGFVQDCDLLIHPEETCGL-QPISAE-YIKAISQPEIES-CPSGDT----KGQWIVPCLTCSDNRTCDWREITWQPHN-CQHNILTKPELQQCLQGRKILFIGDSTNRGMMYYLIERLNETLQEWQKLHGTKLYPSVNGGKSPISYSYYPQFWIRPSLRPAFEKALEHLLQRSQPLENTDQTVLVVGGVQWLNSNHLQIIHKVL 872          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Mouse
Match: Cped1 (cadherin-like and PC-esterase domain containing 1 [Source:MGI Symbol;Acc:MGI:2444814])

HSP 1 Score: 141.739 bits (356), Expect = 2.374e-35
Identity = 99/295 (33.56%), Postives = 146/295 (49.49%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDP--QNYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF VL + I  E   KC   + L     P    Y +G+G N+I   V  +++     +    + I R++R  LP  +D+           C  +Q C  +I   + C + QP   E +I  +S+ E  + C S +        W VPC+ C  + TC W +  W  HN C  + L K +    L+  KILFIGDST RG+ Y LIE LN +L +W K H    +   N     + YSYYP+FW +   RP     L+++L R   ++ ++  +L+VGGVQWLNSNHL  I + L
Sbjct:  459 VPFDVLTVRIGAE-TSKCQCKAHLQEQAGPSFATYPLGIGMNRISVLVVDESHAGGAALTTYKLTIYREDRPSLPFFEDF---------TACGFVQDCDLLIHPEETCGL-QPISAE-YIKAISQPEIES-CPSGDT----KGQWIVPCLTCSDNRTCDWREITWQPHN-CQHNILTKPELQQCLQGRKILFIGDSTNRGMMYYLIERLNETLQEWQKLHGTKLYPSVNGGKSPISYSYYPQFWIRPSLRPAFEKALEHLLQRSQPLENTDQTVLVVGGVQWLNSNHLQIIHKVL 735          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. UniProt/SwissProt
Match: sp|A4D0V7|CPED1_HUMAN (Cadherin-like and PC-esterase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CPED1 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 8.484e-34
Identity = 99/294 (33.67%), Postives = 142/294 (48.30%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDP--QNYSIGLGHNQILKKVYLQTNRYYKMMIQ----IIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF V+ +TI +E   KC     L     P   +Y +GLG N+I   V  ++  + + +I     I R++R  P L    E  +      C  +Q C  +I   + C + QP    +  D++  I  + L   P+        W VPC+ C  + TC W +  W  HN C    L K +    L   KILFIGDST RG+ Y LIE LN +L +W K H    +   N     + YSYYP+FW     RP     L+++L R   ++ +   +L+VGGVQWLNSNHL  I + L
Sbjct:  600 VPFDVVTVTIGVE-TPKCLCKVHLYEQAGPSFASYPLGLGMNKISIFVVDESPAHGETLITYKLTIYREDR--PSLP-LFEAFTA-----CGFVQDCGLLIHPEETCGL-QP----ISSDYIEAILQSELKRCPSGDM--KGQWIVPCLSCSDNRTCDWREITWQPHN-CQYGVLTKPQLQQCLGGRKILFIGDSTNRGIMYYLIERLNETLQEWQKVHGTKFYHNVNGGKTLISYSYYPQFWISPSLRPTFENALEHLLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVL 876          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. TrEMBL
Match: A0A4X2MBE3 (Cadherin-like domain-containing protein OS=Vombatus ursinus OX=29139 GN=CPED1 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 7.487e-34
Identity = 118/404 (29.21%), Postives = 182/404 (45.05%), Query Frame = 2
Query:  317 LLDIFKQLEIPYRHRVFEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQ-----GLTIWISHICDKCGDVILDNSSRTIKKL-------------------------IPFSVLYITIKIEFDRKCSNYSQLVRLNDPQ--NYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNL--CESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            LL++FK+L++  +       E  +  ++ +   K       + D I+ +     G  I + H+ +K  ++   N   TI  +                         +PF V+ +TI  E    C     L     P   NY +GLG N+IL  V  ++    +++    + + R++R  LP   D++          C  +Q C   I   + C + QP    L  D+++ I    L  C+S +        W VPC+ C  + TC W +  W  HN C  S L KT+    L   K+LFIGDST RG+ Y LIE +N +L +W K HS   +   N     + YSYYP+FW    +RP     L+ +L R   ++ ++  IL+VGGVQWLNSNHL  I + L
Sbjct:  511 LLNLFKELQLTNKKTQLYSLEWKHKNSLRDSPLKQANHRNLFPDNIKPRVPLDAGENIIVPHLTNKTKEIHCSNDKDTISYIKQIFTNPHLDLNPEFNPKIRYYHSEVPFDVITVTIGAE-TSNCQCKVHLDEKAGPSFANYPLGLGMNKILILVVDESQANGEVLSTYRLTVYREDRPSLPLFSDYMA---------CGFVQDCGLKIHAEETCGL-QP----LSSDYIATISQPELKICKSGD----AKGQWIVPCLSCSDNRTCDWREITWQPHN-CQYSVLSKTQLQHCLGRRKVLFIGDSTNRGIMYYLIERVNETLQEWQKVHSIKSYYNVNNGRTFISYSYYPQFWISVSQRPTFEKALEQLLQRSYPLENTDQTILVVGGVQWLNSNHLQIIHKVL 894          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. TrEMBL
Match: A0A2K6F8B7 (Cadherin like and PC-esterase domain containing 1 OS=Propithecus coquereli OX=379532 GN=CPED1 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 8.016e-34
Identity = 99/295 (33.56%), Postives = 141/295 (47.80%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDP--QNYSIGLGHNQI----LKKVYLQTNRYYKMMIQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF V+ +TI +E   KC     L     P   NY +GLG N+I    + +   Q+       + I R++R  LP  +D+           C  +Q C  +I   + C + QP    +  D++  I  + L   P+        W VPC+ C  + TC W +  W  HN C    L K +    L   KILFIGDST RG+ Y LIE LN +L +W K H    +   N     + YSYYP+FW     RP     L+++L R   ++ +   +L+VGGVQWLNSNHL  I + L
Sbjct:  301 VPFDVVTVTIGVE-TSKCQCKVHLYEQAGPSFANYPLGLGMNKISIFVVDESPAQSETLITYKLTIYREDRPSLPLFEDFTA---------CGFVQDCGLLIHPEETCGL-QP----ISSDYIEAISQSELKSCPSGDI--KGQWIVPCLSCSDNRTCDWREITWQPHN-CQYGVLTKPQLQQCLGGRKILFIGDSTNRGIMYYLIERLNETLQEWQKVHGTKFYRNVNGGKTVISYSYYPQFWISPSLRPTFEEALEHLLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVL 577          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. TrEMBL
Match: F7AFY6 (Cadherin like and PC-esterase domain containing 1 OS=Ornithorhynchus anatinus OX=9258 GN=CPED1 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.117e-33
Identity = 99/297 (33.33%), Postives = 144/297 (48.48%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDPQ--NYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNL--CESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF V+ + I  E    C     L     P   NY +GLG N+I   V  ++     ++    I I R++R  LP   D++          C  +Q C  +I   KPC     G  +L  D+++ I   +L  CES +        W VPC+ C  + TC W +  W   N C    L K +    L   K+LFIGDST RG+ Y LIE +N +L +W K H    +   N     + YSYYP+FW    +RP     L+ +L R + ++ ++  +L+VGGVQWLNSNHL  I++ L
Sbjct:  606 VPFDVVMVKIGAE-SSNCRCKVHLDERTGPSFANYPLGLGVNKITLLVVDESQVNGDILSSYRITIYREDRPSLPVFDDYVA---------CGFVQDCGLLIHSDKPC-----GLQQLSSDYIAAISQPDLRTCESGD----ARGQWIVPCLSCSDNRTCDWREITWQPQN-CQFGVLSKVQLQRCLDRRKVLFIGDSTNRGIMYYLIERVNETLQEWQKLHGTKTYPNINDGKTLISYSYYPQFWIDVTQRPTFEKALEQLLQRSSPLENTDQTVLVVGGVQWLNSNHLQIIRKVL 882          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. TrEMBL
Match: G3WJY8 (Cadherin like and PC-esterase domain containing 1 OS=Sarcophilus harrisii OX=9305 GN=CPED1 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.233e-33
Identity = 101/297 (34.01%), Postives = 145/297 (48.82%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDRKCSNYSQLVRLNDP--QNYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNL--CESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF V+ +TI  E    C     L     P   NY +GLG N+IL  V  ++    +++    + + R++R  LP   D++          C  +Q C   I   + C     G   L  D+++ I    L  C+S +        W VPC+ C  + TC W +  W  HN C    L KT+    L   K+LFIGDST RG+ Y LIE LN +L +W K HS   +   N     + YSYYP+FW    +RP     L+ +L R + ++ ++  IL+VGGVQWLNSNHL  I + L
Sbjct:  617 VPFDVITVTIGAE-TSNCQCKVHLDEKAGPSFANYPLGLGINKILILVVDESQASGEVLSTYRLTVYREDRPSLPLFNDYMA---------CGFVQDCGLKIHPEETC-----GLQHLSSDYIATISQPELKICKSGD----AKGQWIVPCLSCSDNRTCDWREITWQPHN-CQYGILSKTRLQHCLGGRKVLFIGDSTNRGIMYYLIERLNETLQEWQKVHSIKSYYNVNNGRTFISYSYYPQFWINVSQRPTFEKALEQLLQRSHPLENTDQTILVVGGVQWLNSNHLQIIHKVL 893          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. TrEMBL
Match: E1BUF0 (Cadherin like and PC-esterase domain containing 1 OS=Gallus gallus OX=9031 GN=CPED1 PE=4 SV=4)

HSP 1 Score: 146.747 bits (369), Expect = 1.266e-33
Identity = 100/296 (33.78%), Postives = 151/296 (51.01%), Query Frame = 2
Query:  548 IPFSVLYITIKIEFDR-KCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNL--CESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFL 1408
            +PF V+ + I  E    +C  +   V+     NY +GLG N+I+  V   +    +++    I+I R++R  LP   D++          C  +Q C   I   + C + QP    L  ++LS I    L  CE+ +        W VPC+ C  + TC W + +W  H  C  S LDK +    ++  KILFIGDST RG+ Y LIE +N +L +W K+H    +   N     + YSYYP+FW   ++RP     L+ +L R   ++ ++  +LIVGGVQWLNSNHL  I++ L
Sbjct:  627 VPFDVVTVKIGAEPSNCQCQVHLDEVKGPSIANYPLGLGLNKIVVLVTDDSQPSPQVVSSYKIKIYREDRPSLPVFDDYM---------ICGFVQDCGFQIHPEESCGL-QP----LSHEYLSAISQTVLKTCEAGD----AKGQWIVPCLSCSDNRTCDWREIMWQPHG-CQYSVLDKPELQQCVEGRKILFIGDSTNRGMMYYLIERVNETLQEWQKTHDIKCYDNINEGKTFISYSYYPQFWMTANQRPTFEKALEQLLQRSRPLENTDQTVLIVGGVQWLNSNHLQIIQKVL 903          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Cavefish
Match: cped1 (cadherin like and PC-esterase domain containing 1 [Source:NCBI gene;Acc:103047090])

HSP 1 Score: 126.716 bits (317), Expect = 1.611e-30
Identity = 89/306 (29.08%), Postives = 143/306 (46.73%), Query Frame = 2
Query:  548 IPFSVLYITIKIE-FDRKCSNYSQLVRLND---PQ--NYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQERI-LPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSID-SENIILIVGGVQWLNSNHLNEIKQFLAEMKDNN 1429
            +PF  + I I+ E    +C      +RL++   P+  NY +GLG+++I   V  ++     +M    + I R+ R  LP   +++          C  +Q C  ++   + C +      E      S  E     E P     E   W VPC+ C  + TC W +  W   + C    L++      +   K+LFIGDST RG+ Y L+E +N +L  W K+H  + +   N     + YSYYP+FW    +RP   + L+ ++ R   ++ S   +L+VGGVQWL  +HL  I+Q L  M+  N
Sbjct:  529 VPFDTITIRIRPEPVSAQCH-----IRLDEHRGPRMANYPVGLGNSRINILVMDESGAEPVVMTIYTLHIFRESRPSLPMFDEYV---------MCGFVQDCGLVVRPDQSCGL------EPVAGPKSSAEPQ-AAERPCSSGDEPGRWVVPCLSCSDNRTCDWREVAWQPDS-CYHPVLEQQLLQKCMMDKKVLFIGDSTNRGIMYYLMERVNTTLEDWDKAHDTIVYHNLNQGRTLISYSYYPQFWLHRSQRPTFQSALQQLIERSRPLENSPQTVLVVGGVQWLRLDHLKTIQQVLERMRLQN 812          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006825.1 (pep scaffold:Pmarinus_7.0:GL479137:14703:34435:-1 gene:ENSPMAG00000006167.1 transcript:ENSPMAT00000006825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.388e-22
Identity = 58/198 (29.29%), Postives = 90/198 (45.45%), Query Frame = 2
Query:  800 CALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNS---IDSENIILIVGGVQWLNSNH 1384
            C L Q C+  + D +PC +         +D     E    C+      HE   W +PC+ C  S +C W Q+ W     C   R  + +    +   K+L +GDST RG+ + L+E LNG+L  W + H    +   N       ++Y+P+FW     +     T+  MLL  +S   ID    +L++GGV WL  +H
Sbjct:  100 CGLQQDCAFALWDRQPCGLRPLPRGSAQLD-----EQRPPCQG-----HEQGSWVLPCLSCADSSSCDWSQAAWEVSG-CRHPRFSQQQLQQCMLGVKLLVVGDSTARGMMFYLMERLNGTLAHWEQIHGSKHYRFLNRGLTHAAFAYFPQFWVVPQHQRTFEETV--MLLIASSRPLIDGWRTVLLLGGVHWLWPHH 284          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Medaka
Match: cped1 (cadherin like and PC-esterase domain containing 1 [Source:NCBI gene;Acc:105353860])

HSP 1 Score: 129.798 bits (325), Expect = 1.749e-31
Identity = 91/298 (30.54%), Postives = 143/298 (47.99%), Query Frame = 2
Query:  560 VLYITIKIEFDRKCSNYSQLVRLNDPQ-----NYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQER-ILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTT----HNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENI-ILIVGGVQWLNSNHLNEIKQFL 1408
            V + T+ +    K  + +  V L++ Q     NY +GLG ++I   V   + ++  +M    I ++R+ R ILP L D +          C+ +Q CS ++    PC + QP     +    S +++ +   +P         W VPC+ C  + TC W +  W      H L     L        +   K+LFIGDST RG+ Y L+E LN SL  W K+H+ L +   N     + YSYYP+FW +  +RP     L  +L R   + + N+ +L+VGGVQWL + HL  I++ L
Sbjct:  481 VTFDTVLVRIRPKPVSSTCKVHLDEQQGPRLANYPVGLGTSRIRILVTGGSQQHLVVMAIYTIHVLREGRPILPMLGDHV---------MCSFLQDCSLLVQPSLPCGL-QP-----YAMSPSPVKTCSSGRAPGR-------WVVPCLSCSDNRTCDWREVAWQPDGCYHPLVKRPLLQDC-----MTDRKVLFIGDSTNRGMMYFLMERLNSSLEDWGKAHNTLIYQNLNKGRSQVSYSYYPQFWMERSQRPAFREVLLQLLDRSGPLVNSNLTVLVVGGVQWLKTKHLKTIQEVL 751          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Medaka
Match: cped1 (cadherin like and PC-esterase domain containing 1 [Source:NCBI gene;Acc:105353860])

HSP 1 Score: 129.798 bits (325), Expect = 1.793e-31
Identity = 89/294 (30.27%), Postives = 143/294 (48.64%), Query Frame = 2
Query:  560 VLYITIKIEFDRKCSNYSQLVRLNDPQ-----NYSIGLGHNQILKKVYLQTNRYYKMM----IQIIRQER-ILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENI-ILIVGGVQWLNSNHLNEIKQFL 1408
            V + T+ +    K  + +  V L++ Q     NY +GLG ++I   V   + ++  +M    I ++R+ R ILP L D +          C+ +Q CS ++    PC + QP     +    S +++ +   +P         W VPC+ C  + TC W +  W     C    + +      +   K+LFIGDST RG+ Y L+E LN SL  W K+H+ L +   N     + YSYYP+FW +  +RP     L  +L R   + + N+ +L+VGGVQWL + HL  I++ L
Sbjct:  520 VTFDTVLVRIRPKPVSSTCKVHLDEQQGPRLANYPVGLGTSRIRILVTGGSQQHLVVMAIYTIHVLREGRPILPMLGDHV---------MCSFLQDCSLLVQPSLPCGL-QP-----YAMSPSPVKTCSSGRAPGR-------WVVPCLSCSDNRTCDWREVAWQPDG-CYHPLVKRPLLQDCMTDRKVLFIGDSTNRGMMYFLMERLNSSLEDWGKAHNTLIYQNLNKGRSQVSYSYYPQFWMERSQRPAFREVLLQLLDRSGPLVNSNLTVLVVGGVQWLKTKHLKTIQEVL 790          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Planmine SMEST
Match: SMESG000016689.1 (SMESG000016689.1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 444/445 (99.78%), Postives = 444/445 (99.78%), Query Frame = 2
Query:  101 MMTNCTLSTLCMQGNMMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVFEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR 1435
            MMTNCTLSTLCMQGNMMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRV EKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR
Sbjct:    1 MMTNCTLSTLCMQGNMMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVIEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR 445          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Planmine SMEST
Match: SMESG000016689.1 (SMESG000016689.1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 433/434 (99.77%), Postives = 433/434 (99.77%), Query Frame = 2
Query:  134 MQGNMMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVFEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR 1435
            MQGNMMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRV EKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR
Sbjct:    1 MQGNMMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVIEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR 434          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Planmine SMEST
Match: SMESG000016689.1 (SMESG000016689.1)

HSP 1 Score: 879.396 bits (2271), Expect = 0.000e+0
Identity = 429/430 (99.77%), Postives = 429/430 (99.77%), Query Frame = 2
Query:  146 MMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVFEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR 1435
            MMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRV EKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR
Sbjct:    1 MMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVIEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR 430          
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Planmine SMEST
Match: SMESG000016689.1 (SMESG000016689.1)

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 428/429 (99.77%), Postives = 428/429 (99.77%), Query Frame = 2
Query:  149 MRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVFEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR 1435
            MRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRV EKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR
Sbjct:    1 MRLLGYIIWINTLFLHEYQSKASQKMPKILRVLKIFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVIEKSEEIYSKTIFNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLIPFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTNRYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPCNVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETCLWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEHLNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLKNMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQR 429          
The following BLAST results are available for this feature:
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CPED11.767e-3433.67cadherin like and PC-esterase domain containing 1 ... [more]
CPED11.148e-627.37cadherin like and PC-esterase domain containing 1 ... [more]
CPED11.167e-627.37cadherin like and PC-esterase domain containing 1 ... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cped12.134e-3229.63cadherin-like and PC-esterase domain containing 1 ... [more]
cped15.403e-2327.55cadherin-like and PC-esterase domain containing 1 ... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CPED13.433e-3431.97cadherin like and PC-esterase domain containing 1 ... [more]
CPED15.027e-3431.97cadherin like and PC-esterase domain containing 1 ... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cped12.083e-3533.56cadherin-like and PC-esterase domain containing 1 ... [more]
Cped12.374e-3533.56cadherin-like and PC-esterase domain containing 1 ... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|A4D0V7|CPED1_HUMAN8.484e-3433.67Cadherin-like and PC-esterase domain-containing pr... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4X2MBE37.487e-3429.21Cadherin-like domain-containing protein OS=Vombatu... [more]
A0A2K6F8B78.016e-3433.56Cadherin like and PC-esterase domain containing 1 ... [more]
F7AFY61.117e-3333.33Cadherin like and PC-esterase domain containing 1 ... [more]
G3WJY81.233e-3334.01Cadherin like and PC-esterase domain containing 1 ... [more]
E1BUF01.266e-3333.78Cadherin like and PC-esterase domain containing 1 ... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cped11.611e-3029.08cadherin like and PC-esterase domain containing 1 ... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006825.12.388e-2229.29pep scaffold:Pmarinus_7.0:GL479137:14703:34435:-1 ... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cped11.749e-3130.54cadherin like and PC-esterase domain containing 1 ... [more]
cped11.793e-3130.27cadherin like and PC-esterase domain containing 1 ... [more]
back to top
BLAST of Cadherin like and PC-esterase domain containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016689.10.000e+099.78SMESG000016689.1[more]
SMESG000016689.10.000e+099.77SMESG000016689.1[more]
SMESG000016689.10.000e+099.77SMESG000016689.1[more]
SMESG000016689.10.000e+099.77SMESG000016689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013417 ID=SMED30013417|Name=Cadherin like and PC-esterase domain containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1498bp
CTGATGACAAATTATAAGAAAACAAACTTTTCTAACAATCAGCCGAAGGC
AATGAAACCGAGCAATCTGATTGGCTGATGAGAGTATTGTTTTAGTTTTA
ATGATGACCAATTGTACATTATCTACACTGTGTATGCAAGGTAATATGAT
GCGACTATTAGGATATATAATTTGGATAAATACGCTATTTCTCCATGAAT
ACCAGTCGAAAGCTTCTCAAAAAATGCCGAAAATCCTCCGAGTTCTCAAA
ATATTTATTTCAATTGTAATTTTAATTGGATTTCTTTGTACAATCAAATA
TTTATCAGGCATGATTCTACTCGATATATTTAAACAATTGGAAATTCCAT
ATCGACACCGTGTTTTTGAAAAAAGTGAAGAAATCTATTCAAAAACGATT
TTCAATTATTCTCAGAAATCTACGACAGATTCCTATGATTACGTTGACGA
AATTGAGTCCCAAGGATTAACAATATGGATATCACATATTTGTGACAAAT
GCGGAGATGTTATCTTAGACAATTCATCTCGGACAATCAAGAAACTTATT
CCGTTTTCAGTGCTTTATATAACAATTAAAATTGAATTCGATCGGAAATG
TTCTAATTACTCCCAACTTGTCAGACTGAACGATCCACAGAATTATTCAA
TCGGGTTGGGTCACAATCAGATCTTGAAAAAGGTTTACCTTCAAACAAAC
AGATACTACAAAATGATGATTCAAATTATCAGACAAGAAAGAATACTTCC
ACAGTTGAAAGACTGGTTGGAGGTTTTGTCGACAATGAAATTGAAAAGAT
GTGCATTAATTCAAAGTTGCTCTCACATTATTGACGATGGGAAACCGTGT
AATGTCTTTCAGCCAGGTGAAACTGAGCTATGGATAGATTTTCTGTCAAA
AATAGAATCAAATAATTTGTGCGAATCTCCCAATGATCTATTCCATGAAG
ATGCTCTTTGGTCAGTACCTTGCATTCAATGTGATCTGTCAGAAACGTGC
CTATGGGAGCAATCCATTTGGACGACTCACAATCTTTGTTCCTTGAGTCG
ACTCGACAAAACAAAAGATTATTTTCAATTAAAATCTACTAAGATATTAT
TCATCGGAGATTCCACAATGCGAGGTCTTTATTATAGCCTGATTGAACAC
CTGAACGGCTCCCTTCATCAATGGAGCAAATCGCACAGTCACCTAGATTT
CACAATATCAAATCTCATCAATGTTTCACTGGGGTATTCATATTATCCAA
GATTCTGGGAGAAAGAAGACCGACGACCAGGACTATCAACAACATTAAAA
AATATGCTCTTGCGGCTTAACAGTATAGACAGTGAAAATATCATCCTAAT
TGTCGGAGGGGTTCAATGGCTGAATTCTAATCATTTGAATGAAATTAAAC
AATTTTTGGCGGAAATGAAGGACAACAATCAAAGAAATCTCGACTGCAAC
TCACAACTCAAAATGCTCAATTAGCAGAATCCGTCAACAATTTTGGAT
back to top

protein sequence of SMED30013417-orf-1

>SMED30013417-orf-1 ID=SMED30013417-orf-1|Name=SMED30013417-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=458bp
MMTNCTLSTLCMQGNMMRLLGYIIWINTLFLHEYQSKASQKMPKILRVLK
IFISIVILIGFLCTIKYLSGMILLDIFKQLEIPYRHRVFEKSEEIYSKTI
FNYSQKSTTDSYDYVDEIESQGLTIWISHICDKCGDVILDNSSRTIKKLI
PFSVLYITIKIEFDRKCSNYSQLVRLNDPQNYSIGLGHNQILKKVYLQTN
RYYKMMIQIIRQERILPQLKDWLEVLSTMKLKRCALIQSCSHIIDDGKPC
NVFQPGETELWIDFLSKIESNNLCESPNDLFHEDALWSVPCIQCDLSETC
LWEQSIWTTHNLCSLSRLDKTKDYFQLKSTKILFIGDSTMRGLYYSLIEH
LNGSLHQWSKSHSHLDFTISNLINVSLGYSYYPRFWEKEDRRPGLSTTLK
NMLLRLNSIDSENIILIVGGVQWLNSNHLNEIKQFLAEMKDNNQRNLDCN
SQLKMLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR14776FAMILY NOT NAMEDcoord: 150..438
NoneNo IPR availableTMHMMTMhelixcoord: 15..32
NoneNo IPR availableTMHMMTMhelixcoord: 52..74