Reticulocalbin-1

Overview
NameReticulocalbin-1
Smed IDSMED30013416
Length (bp)6503
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reticulocalbin-1 (SMED30013416) t-SNE clustered cells

Violin plots show distribution of expression levels for Reticulocalbin-1 (SMED30013416) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reticulocalbin-1 (SMED30013416) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reticulocalbin-1 (SMED30013416) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013416

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 42

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013416SMESG000017743.1 SMESG000017744.1 Contig5428uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013416SMESG000017743.1 SMESG000017744.1 Contig5428newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013416SMESG000067728.1 SMESG000014991.1 Contig719newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013416SMESG000028452.1 Contig719newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013416SMESG000011690.1 Contig5428uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013416SMESG000011690.1 Contig5428newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X2 cellSMED30013416SMESG000060671.1 SmedASXL_018632SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000077556.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000021522.1 SMESG000018320.1 SMESG000012464.1 SMESG000007865.1 SMESG000007864.1 SMESG000007021.1 Contig20246newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000077556.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000021522.1 SMESG000018320.1 SMESG000012464.1 SMESG000007865.1 SMESG000007864.1 SMESG000007021.1 Contig20246uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000016436.1 Contig14292uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000016436.1 Contig14292newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000048843.1 Contig17789uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000048843.1 Contig17789newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000007225.1 Contig12708newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000007225.1 Contig12708uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30013416SMESG000007225.1 dd_Smed_v4_990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013416SMESG000007225.1 dd_Smed_v4_990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013416SMESG000007225.1 dd_Smed_v4_990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013416SMESG000007225.1 dd_Smed_v4_990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30013416SMESG000007225.1 dd_Smed_v4_990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013416SMESG000007225.1 dd_Smed_v4_990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30013416SMESG000007225.1 dd_Smed_v4_990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013416SMESG000067728.1 dd_Smed_v4_5235_0_7dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013416SMESG000067728.1 dd_Smed_v4_5235_0_7dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000007225.1 Contig50537uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000007225.1 Contig50537newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000011919.1 Contig49251newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000011919.1 Contig49251uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000007226.1 SMESG000007225.1 Contig34357uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000007226.1 SMESG000007225.1 Contig34357newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000081415.1 SMESG000078681.1 SMESG000077975.1 SMESG000065760.1 SMESG000064506.1 SMESG000061313.1 SMESG000056432.1 SMESG000051530.1 SMESG000036073.1 SMESG000026901.1 SMESG000022344.1 SMESG000034660.1 Contig39361uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013416SMESG000081415.1 SMESG000078681.1 SMESG000077975.1 SMESG000065760.1 SMESG000064506.1 SMESG000061313.1 SMESG000056432.1 SMESG000051530.1 SMESG000036073.1 SMESG000026901.1 SMESG000022344.1 SMESG000034660.1 Contig39361newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
whole organismSMED30013416SMESG000035468.1 Contig29728uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30013416SMESG000035468.1 Contig29728newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30013416SMESG000067728.1 dd_Smed_v6_5235_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30013416SMESG000007225.1 dd_Smed_v6_990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30013416SMESG000007225.1 dd_Smed_v6_990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30013416SMESG000007225.1 dd_Smed_v6_990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30013416SMESG000034758.1 Contig16349newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013416SMESG000034758.1 Contig16349uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013416SMESG000035468.1 Contig29728uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013416SMESG000035468.1 Contig29728newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 92.4337 bits (228), Expect = 8.090e-21
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:   48 DMYSHDGNT-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 147          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 92.4337 bits (228), Expect = 3.735e-19
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  216 DMYSHDGNT-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 92.4337 bits (228), Expect = 3.950e-19
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  216 DMYSHDGNT-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 92.4337 bits (228), Expect = 4.254e-19
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  224 DMYSHDGNT-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 323          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 92.0485 bits (227), Expect = 4.756e-19
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  224 DMYSHDGNT-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 323          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 84.7297 bits (208), Expect = 5.584e-17
Identity = 38/85 (44.71%), Postives = 59/85 (69.41%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLK 6343
            EP+W+Q E + F  +RD + D +++++E+ +WIMP  +D  E+E  HL+  AD NKD +L++DEIV   + F GSQAT+YG  L+
Sbjct:  223 EPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATDYGEQLQ 307          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 84.7297 bits (208), Expect = 5.584e-17
Identity = 38/85 (44.71%), Postives = 59/85 (69.41%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLK 6343
            EP+W+Q E + F  +RD + D +++++E+ +WIMP  +D  E+E  HL+  AD NKD +L++DEIV   + F GSQAT+YG  L+
Sbjct:  223 EPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATDYGEQLQ 307          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: scf (gene:FBgn0025682 transcript:FBtr0089941)

HSP 1 Score: 80.4925 bits (197), Expect = 1.737e-16
Identity = 35/93 (37.63%), Postives = 62/93 (66.67%), Query Frame = 2
Query: 6080 KDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            +D EPEW+  E + F+ +RD + D  ++ +E+ +WI P ++D  E+E  HL+  AD + DD+L+ +EI+++ ++F GSQAT++G  L   +E 
Sbjct:  100 EDEEPEWVANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF 192          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: scf (gene:FBgn0025682 transcript:FBtr0089942)

HSP 1 Score: 79.7221 bits (195), Expect = 3.349e-15
Identity = 35/93 (37.63%), Postives = 62/93 (66.67%), Query Frame = 2
Query: 6080 KDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            +D EPEW+  E + F+ +RD + D  ++ +E+ +WI P ++D  E+E  HL+  AD + DD+L+ +EI+++ ++F GSQAT++G  L   +E 
Sbjct:  237 EDEEPEWVANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF 329          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301907)

HSP 1 Score: 58.9214 bits (141), Expect = 2.200e-8
Identity = 33/84 (39.29%), Postives = 45/84 (53.57%), Query Frame = 2
Query: 6095 EWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKN 6346
            EW+  E + F    D+N D  +   E+  WI+PSN      EV HL    D + DD LS  EI+   + F GS+AT+YG  L+N
Sbjct:  251 EWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQN 334          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301905)

HSP 1 Score: 58.9214 bits (141), Expect = 2.200e-8
Identity = 33/84 (39.29%), Postives = 45/84 (53.57%), Query Frame = 2
Query: 6095 EWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKN 6346
            EW+  E + F    D+N D  +   E+  WI+PSN      EV HL    D + DD LS  EI+   + F GS+AT+YG  L+N
Sbjct:  251 EWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQN 334          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0079033)

HSP 1 Score: 58.9214 bits (141), Expect = 2.200e-8
Identity = 33/84 (39.29%), Postives = 45/84 (53.57%), Query Frame = 2
Query: 6095 EWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKN 6346
            EW+  E + F    D+N D  +   E+  WI+PSN      EV HL    D + DD LS  EI+   + F GS+AT+YG  L+N
Sbjct:  251 EWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQN 334          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calub (calumenin b [Source:NCBI gene;Acc:394057])

HSP 1 Score: 94.3597 bits (233), Expect = 5.965e-20
Identity = 45/100 (45.00%), Postives = 66/100 (66.00%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL*QNHLNLAIY 6388
            EPEW++ E + FT +RD N D RMD+ E  +WI+P++YD  E+E  HL+  +D +KD  L+  EIV++ +LF GSQAT++G  L+    L Q  L+L  Y
Sbjct:  226 EPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATDFGDALQR---LHQIQLDLPFY 322          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calub (calumenin b [Source:NCBI gene;Acc:394057])

HSP 1 Score: 92.0485 bits (227), Expect = 3.057e-19
Identity = 41/90 (45.56%), Postives = 61/90 (67.78%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            EPEW++ E + FT +RD N D RMD+ E  +WI+P++YD  E+E  HL+  +D +KD  L+  EIV++ +LF GSQAT++G  L   +E 
Sbjct:  226 EPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATDFGDALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 90.5077 bits (223), Expect = 1.050e-18
Identity = 40/90 (44.44%), Postives = 62/90 (68.89%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            EPEW+  E + F+ +RD N D +MDR+E  +WI+P++YD  E+E  HL+  +D NKD +L+ +EI+ + +LF GSQAT++G  L   +E 
Sbjct:  228 EPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEALVRHDEF 317          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 90.5077 bits (223), Expect = 1.050e-18
Identity = 40/90 (44.44%), Postives = 62/90 (68.89%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            EPEW+  E + F+ +RD N D +MDR+E  +WI+P++YD  E+E  HL+  +D NKD +L+ +EI+ + +LF GSQAT++G  L   +E 
Sbjct:  228 EPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEALVRHDEF 317          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: rcn1 (reticulocalbin 1, EF-hand calcium binding domain [Source:ZFIN;Acc:ZDB-GENE-080225-33])

HSP 1 Score: 89.7373 bits (221), Expect = 1.870e-18
Identity = 43/92 (46.74%), Postives = 62/92 (67.39%), Query Frame = 2
Query: 6086 PEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL-KNKEEL 6358
            PEP+W++ E   F+ +RD N D +MD +EI  WI+P +YD  ++E  HL+  +D +KD  LS +EI+E   +F GSQATNYG  L +N +EL
Sbjct:  229 PEPDWVRTERDQFSDFRDLNKDGKMDLEEIRHWILPQDYDHAQAEARHLVYESDTDKDQMLSKEEILENWNMFVGSQATNYGEDLTRNHDEL 320          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 91.2781 bits (225), Expect = 7.006e-19
Identity = 41/90 (45.56%), Postives = 64/90 (71.11%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            EPEW++ E + F  +RD N+D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  226 EPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 91.2781 bits (225), Expect = 7.341e-19
Identity = 41/90 (45.56%), Postives = 64/90 (71.11%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            EPEW++ E + F  +RD N+D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  226 EPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 90.1225 bits (222), Expect = 2.193e-18
Identity = 40/88 (45.45%), Postives = 59/88 (67.05%), Query Frame = 2
Query: 6086 PEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNK 6349
            PEP+W++ E + FT +RD N D +MDR EI +WI+P +YD  + E  HL+  +D +KD +L+  EI++   +F GSQATNYG  L  +
Sbjct:  232 PEPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQATNYGEDLTRR 319          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 90.1225 bits (222), Expect = 2.444e-18
Identity = 40/88 (45.45%), Postives = 59/88 (67.05%), Query Frame = 2
Query: 6086 PEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNK 6349
            PEP+W++ E + FT +RD N D +MDR EI +WI+P +YD  + E  HL+  +D +KD +L+  EI++   +F GSQATNYG  L  +
Sbjct:  230 PEPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQATNYGEDLTRR 317          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: fgf11 (fibroblast growth factor 11 [Source:Xenbase;Acc:XB-GENE-479522])

HSP 1 Score: 89.3521 bits (220), Expect = 4.388e-18
Identity = 40/92 (43.48%), Postives = 63/92 (68.48%), Query Frame = 2
Query: 6086 PEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL-KNKEEL 6358
            PEP+W+  E + F  +RD N D +MD++EI  WI+P +YD  ++E  HL+  +D++KD  L+ +E+++   +F GSQATNYG  L +N +EL
Sbjct:  230 PEPDWVATEREQFADFRDINKDGKMDKEEIRHWILPQDYDHAQAEARHLIYESDLDKDKVLTKEEVLQNWNMFVGSQATNYGEDLTRNHDEL 321          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 92.8189 bits (229), Expect = 6.421e-21
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:   64 DMYSHDGNA-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 163          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 92.4337 bits (228), Expect = 2.448e-19
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  216 DMYSHDGNA-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 92.4337 bits (228), Expect = 2.712e-19
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  216 DMYSHDGNA-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn1 (reticulocalbin 1 [Source:MGI Symbol;Acc:MGI:104559])

HSP 1 Score: 87.8113 bits (216), Expect = 8.841e-18
Identity = 42/92 (45.65%), Postives = 62/92 (67.39%), Query Frame = 2
Query: 6086 PEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL-KNKEEL 6358
            PEP+W+  E + F  +RD N D ++D+ EI  WI+P +YD  ++E  HL+  +D NKD+ L+ +EI++   +F GSQATNYG  L KN +EL
Sbjct:  234 PEPDWVLSEREQFNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL 325          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:MGI Symbol;Acc:MGI:1277122])

HSP 1 Score: 82.8037 bits (203), Expect = 5.031e-16
Identity = 42/99 (42.42%), Postives = 58/99 (58.59%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL 6340
            +LYS EP      + EP W+Q E + F  +RD N D R+D  E+G W++P + D    E +HL+  +D +KD  LS  EI+    +F GSQATNYG  L
Sbjct:  228 DLYSEEPG-----EEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDL 321          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|B5X4E0|CALUB_SALSA (Calumenin-B OS=Salmo salar OX=8030 GN=calub PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 9.632e-20
Identity = 46/93 (49.46%), Postives = 66/93 (70.97%), Query Frame = 2
Query: 6083 DP-EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            DP EPEW++ E + FT +RDTN D RMD++E  +WI+PS+YD  E+E  HL+  +D +KD +L+  EIVE+ +LF GSQAT++G  L   +E 
Sbjct:  224 DPSEPEWVRTEREQFTEFRDTNKDGRMDKEETKDWILPSDYDHAEAEAKHLVYESDNDKDGKLTKAEIVEKYDLFVGSQATDFGEALARHDEF 316          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q4U471|CALU_MESAU (Calumenin OS=Mesocricetus auratus OX=10036 GN=CALU PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 6.368e-19
Identity = 45/105 (42.86%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D RMD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  216 DMYSHDGNA-----DEPEWVKTEREQFVEFRDKNRDGRMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q6XLQ7|CALU_RABIT (Calumenin OS=Oryctolagus cuniculus OX=9986 GN=CALU PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 1.712e-18
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  216 DMYSHDGNA-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|O35887|CALU_MOUSE (Calumenin OS=Mus musculus OX=10090 GN=Calu PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.712e-18
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  216 DMYSHDGNA-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q5RDD8|CALU_PONAB (Calumenin OS=Pongo abelii OX=9601 GN=CALU PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.744e-18
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 6044 ELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++YS + N       EPEW++ E + F  +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D NKD +L+ +EIV++ +LF GSQAT++G  L   +E 
Sbjct:  216 DMYSHDGNT-----DEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: J9K9R5 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 567.385 bits (1461), Expect = 3.013e-176
Identity = 305/744 (40.99%), Postives = 449/744 (60.35%), Query Frame = 2
Query:  728 RGKSNVYLLGSAESDILGAKLPSHLQTFGYFMHLHKVENLTVRDSSRQTIEKVFGFWHKAGIPVRAAKHCIDKLEAFFAEWKGLQKHKNRITDGHKMKEDEFTSRLDNLFDIAHLDALTLITIPEDRAFFLSQRQEGRPGSIGAVDKVEELKTRHRQDQKKAELKRKKRSQEEIEAYSSQAALKTALSSXXXXXXXXXXXXXXXKSKTCSRSDEVCVGPKRAKINVLSPGLTSALDRTKISSQNATFVLSEVASSLGHDVNTLNINXXXXXXXXXXXXXXXXXXXXXEFSTTV--PLTVHWDGKLMEDLSTLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVVQCLEEWGLAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHHIMELIVGAAFETTSVGTSSGPEIQIFKRFRDYWQFIDRDGFQVASSDPSVELLVAPYRSDILSFARTYLQAEHPRDDYREFLELAVIFLGDVPDRGIRFQVPGAMHWARWMAKVIYSIKMFLFRSQFKMTASEERGICDVATFSVVIHLKAWMTAPLAVEAPLNDFTLMGQLRSYPH--AAISAATSKKLGLHMWYLSEELIGLALFDSRLSHDSKRLMIAAMDEEAPDHPSKRPSIKSDAFLG--KRGLEQFCTVNSKKLFQLLDLPITLVNKDPSDWEQDESYTRALGIVKSLAVVNDRAERGVALIQDFNKKLTKNEDQLQFLLQIVNEHRRQFPDCTKRNL 2941
            R  S+ +L+G   + I+G+KLPS  Q      +  +   L + +S++  I++V  FW KA IPV A ++C  KL+  + EW+ LQK + R TD    K +EF+  LD+LFDIA  DAL +I I EDR F +SQRQ+GRPGS+  +D     K +  +++ K   +R+KR+ EE E + +   + T+ + +    DE  D            S +    P R  IN ++  L SALD+ K+S ++A  +L   A +LG DVN L INR+SI   R   R  R+  +R E+  ++   + +HWDGKL+  L+  ++VDRLP+++S  G +QLLGVP L  GTG  QA A+ Q L +W + E V A C DTTASNTG R G C L+E+ L +++L+L CRHHI EL++   F+T  + T+SGP++ IFKRF+ YW  ++ + F+  + +  ++  V+  RSDI++F   YLQ + PR+DYRE LEL +IFLG VP RGI  +VPGA+H ARWMAK IY +K+FLFRSQF++T  EE  I  V  F + +++KAW  AP+A  AP  D   +  L  Y     +IS  T KK+  H+WYLS E   L+ FD  +  D+KR MIAA++ +  +    R  +     +G   +GLE F  V+S + F+   +    +  DPS W  DE + ++  IV ++ VVND AERGV LI+++N K+T +E Q Q+LLQ+V ++R ++PD  K  +
Sbjct:    8 RKDSHTFLIGYTSNQIVGSKLPSIRQALSVLFYNMREVRLNLNESAKLVIKEVSVFWQKARIPVSAEQYCAIKLQKLYNEWRNLQKLQYRKTDTQLKKNEEFSMILDDLFDIAQADALEVIKIKEDRDFLISQRQKGRPGSMLGIDLKIINKEKRAEERLKIVEERRKRTYEESEIHDTFVEMSTSSTDESTIEDEEFDKP--------GPSTKYFKQPHRGNINFITSKLASALDKCKLSDRDAVHILISTAEALGEDVNKLIINRTSIRNTRLRFRKERAENIRKEYKLSIDDAVILHWDGKLLPALTGQKNVDRLPIVVSCNGCDQLLGVPALDTGTGIDQADAIFQMLNDWCITENVQAFCCDTTASNTGRRLGACVLLENYLERNILHLPCRHHIYELVLKCVFDT-KLCTTSGPDVPIFKRFQQYWGNLNTEKFEPGTINEFIQKNVSDVRSDIINFVIDYLQIKQPREDYRELLELTIIFLGGVPPRGISLRVPGAIHHARWMAKAIYCLKIFLFRSQFRLTQREEMSIASVCVFIIRLYIKAWFVAPMASRAPYQDLNFLKDLIRYQSIDKSISEVTIKKMCGHLWYLSPEAAALSFFDPHVPVDTKRKMIAALNMDTEEDNINRYVLNPKESIGILNKGLEDFICVSSMQFFKRFKINTDFLTTDPSKWNDDEHFKKSTAIVTNINVVNDIAERGVKLIEEYNTKITNDETQKQYLLQVVCDYRNKYPDSKKSTI 742          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A2S2PCY9 (Uncharacterized protein OS=Schizaphis graminum OX=13262 GN=g.57453 PE=4 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 1.751e-173
Identity = 309/752 (41.09%), Postives = 461/752 (61.30%), Query Frame = 2
Query:  743 VYLLGSAESDILGAKLPSHLQTFGYFMHLHKVENLTVRDSSRQTIEKVFGFWHKAGIPVRAAKHCIDKLEAFFAEWKGLQKHKNRITDGHKMKEDEFTSRLDNLFDIAHLDALTLITIPEDRAFFLSQRQEGRPGSIGAVD-KVEELKTRHRQDQKKAELKRKKRSQEEIEAYSSQAALKTALSSXXXXXXXXXXXXXXXKSKTCSRSD--EVCV-GPKRAKIN-------------VLSPGLTSALDRTKISSQNATFVLSEVASSLGHDVNTLNINXXXXXXXXXXXXXXXXXXXXXEFSTTVPLTVHWDGKLMEDLSTLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVVQCLEEWGLAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHHIMELIVGAAFETTSVGTSSGPEIQIFKRFRDYWQFIDRDGFQVASSDPSVELLVAPYRSDILSFARTYLQAEHPRDDYREFLELAVIFLGDVPDRGIRFQVPGAMHWARWMAKVIYSIKMFLFRSQFKMTASEERGICDVATFSVVIHLKAWMTAPLAVEAPLNDFTLMGQLRSYPHA--AISAATSKKLGLHMWYLSEELIGLALFDSRLSHDSKRLMIAAMDEEAPDHPSKRPSIKSDAFLGKRGLEQFCTVNSKKLFQLLDLPITLVNKDPSDWEQDESYTRALGIVKSLAVVNDRAERGVALIQDFNKKLTKNEDQLQFLLQIVNEHRRQFPDCTKRNL 2941
            ++L+G     I G+KLPS  Q    F HLHK E  +++ S+  T  ++  FW KA IP +   H I+K++    +W+ ++K  +R T      E  F S  DNLFDIAH DALTLI+I ED+ F L+QR++GR GS+G +D K+ + + R +Q Q + ELK KK ++               L  D+  ++  D++   D S+ CS SD  E+ V   KR K N             +++  + SALDRTK+S +NA +VLS    SLGH++    +NR SI +AR  +R   +  +++ F TT+PLTVHWDGKL+ DL++ + VDRL V++SG G+ +LLGVPK+  GTGEAQA+AV + LEEW L E++  + FDTTASN+G ++G C L+E K+ +DLL LACRHHI+ELI+ + F    +G SSGP I+IF+RF + W  ID + ++    + +V   + P +  ++ +    L    PRDDY+E L+L++IFLGD   +  + + PGA+H ARWMAK+IYS+K+FLFRSQFK+TA E   +     F + +++K W TA     AP ND  L+ +L +Y  +   I  A +K    H+WYLSE LIGLA FDS++S + K  M+ ++ ++  D P +R ++++ A +    L  F + NS  LF+ LD+P   +N++P  WE  + +      V+ L VVND AERG++LIQ FN  +T  E+Q Q+LLQ+V +HR+++P+  K  +
Sbjct:   10 IWLIGGTLESITGSKLPSKKQMLHRFFHLHKYEKKSIQSSATITTREISAFWEKAKIPTQKECHVIEKIKKIHCKWQSIKKSASRRTSKQLEAESVFVSDFDNLFDIAHKDALTLISIKEDKEFLLAQREKGRRGSMGPIDTKLSKKEERTKQRQLQNELKIKKETER--------------LKKDEQMLNVNDNNIDCDDSQ-CSSSDNDELYVPSSKRLKKNNSPTKVNTLFNSTIVTSRVASALDRTKVSDRNAMYVLSATLQSLGHNIQNFTLNRESIRQARREYREKIADEIKTSFVTTIPLTVHWDGKLLPDLTSKDKVDRLAVIVSGDGIMKLLGVPKIPNGTGEAQATAVFELLEEWNLIERIHFMSFDTTASNSGVKAGACVLLEKKIKRDLLSLACRHHILELIIESVFNAL-MGASSGPNIKIFQRFAEKWNEIDVEKYESGIIEDAVASKLNPQKYVLVKYINDQLATFQPRDDYKELLQLSLIFLGDETAKDFKIRRPGALHRARWMAKLIYSLKIFLFRSQFKLTARELSALEAFNVFVIQVYIKYWYTASSGELAPYNDLNLLKELDNYKKSNIVIGNAAAKSFSRHLWYLSETLIGLAFFDSKVSSEMKVNMVKSLVKKGADFPLRRITVETTA-VQTVQLSDFVSKNSLILFKALDIPQDFLNQNPDTWENHKDFIDGCKRVQHLKVVNDAAERGISLIQTFNGIITNQEEQKQYLLQVVEQHRQKYPNPNKSTI 744          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: J9M593 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 537.339 bits (1383), Expect = 1.320e-165
Identity = 295/751 (39.28%), Postives = 434/751 (57.79%), Query Frame = 2
Query:  716 KMETRGKSNVYLLGSAESDILGAKLPSHLQTFG-YFMHLHKVENLTVRDSSRQTIEKVFGFWHKAGIPVRAAKHCIDKLEAFFAEWKGLQKHKNRITDGHKMKEDEFTSRLDNLFDIAHLDALTLITIPEDRAFFLSQRQEGRPGSIGAVDKVEELKTRHRQDQKKAELKRKKRSQEEIEAYSSQAALKTALSSXXXXXXXXXXXXXXXKSKTCSRSDEVCVGPKRAKINVLSPGLTSALDRTKISSQNATFVLSEVASSLGHDVNTLNINXXXXXXXXXXXXXXXXXXXXXEF--STTVPLTVHWDGKLMEDLSTLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVVQCLEEWGLAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHHIMELIVGAAFETTSVGTSSGPEIQIFKRFRDYWQFIDRDGFQVASSDPSVELLVAPYRSDILSFARTYLQAEHPRDDYREFLELAVIFLGDVPDRGIRFQVPGAMHWARWMAKVIYSIKMFLFRSQFKMTASEERGICDVATFSVVIHLKAWMTAPLAVEAPLNDFTLMGQLRSYP--HAAISAATSKKLGLHMWYLSEELIGLALFDSRLSHDSKRLMIAAMD-EEAPDHPSKRPSIKSDAF--LGKRGLEQFCTVNSKKLFQLLDLPITLVNKDPSDWEQDESYTRALGIVKSLAVVNDRAERGVALIQDFNKKLTKNEDQLQFLLQIVNEHRRQFPDCTKRNLA 2944
            K+  R  + ++L+G   + I+G+KLPS  Q     F ++ KV NL +RDS++  I +V  FW KA IPVR   H + K+E+ + EW+ LQKH  R +   +  E+ F ++L+++FDIAH  AL ++ I  D+ F ++QR +GRPG +  +D+  +      +   K +L+RKKR  E++E    +   +  L                                 R K N ++  + +ALDR KIS ++A  +L   A S G ++N L INR+S++  R   R  R   LR  F  S   P  VHWDGKL+  LS  + VDRLP++IS  G+EQLLGVP+L +GTGE QA+AV Q LE WGL + V A+C DTTASNTG   G C L+E KL +++LYL CRHHI+E+++ +AFE   +  +S P++ IFKRF+  W  I+ + F +   D  V   +   + ++L F    L+   PRDDY+E LEL +IFLG  P  GI F+VPG +H ARWM+K IYSIK+FLFR++FK+T  E   + D+  F V I++K W  A  A  AP  D   +  +  Y      IS +  KK+  H+WYL+ E   LA FD ++S  +K  M+ AM   +     +KR  +K +       + +  F ++ S   F    +P+  ++ DP  W +++ Y ++  +V ++ VVND AERGV LI+D+NK LTKNEDQ Q+LLQ+V+E+R+QFPD  K  L+
Sbjct:    6 KINLRDSNKIFLVGHISNQIIGSKLPSIKQVLSVLFFNMRKV-NLNLRDSAKLVIREVIIFWEKARIPVREEYHLLKKVESLYNEWRNLQKHSTRKSAKDRKNEEIFVNKLNDIFDIAHARALDIMKIECDKQFLIAQRTKGRPGCLLGIDRKNQKLEECIEKNLKNKLERKKRVYEDMEISEEEVIEEPNLFQL------------------------------RGKTNFITDKMAAALDRCKISDRDAVHILLATAESFGININELIINRTSVNSIRQRFRKNRIEALRVNFNPSQIGPCVVHWDGKLLPSLSEKKLVDRLPIIISYKGIEQLLGVPELISGTGENQATAVYQALENWGLTDNVQALCCDTTASNTGRLKGACILLEQKLEREILYLPCRHHILEVVLRSAFE-IKIDIASAPDVPIFKRFQKCWPNINVNNFHIGLEDTFVFQSLQNLKDELLIFCINQLKQYQPRDDYKELLELTIIFLGQTPPNGIFFKVPGPIHHARWMSKAIYSIKIFLFRNEFKLTLKENNALRDLCIFIVRIYIKQWFCARAAALAPNMDLQFIKDIILYEVIDEQISKSALKKMCGHLWYLTPEATSLAFFDDKVSSQTKIKMVKAMQSRDIESEANKRIILKPNEIYDYANKDINDFISIQSSNFFNRFGIPMDFLDLDPKLWNENDQYKKSKELVNNINVVNDIAERGVKLIEDYNKLLTKNEDQKQYLLQVVSEYRQQFPDYKKSTLS 724          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: J9LU94 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 534.258 bits (1375), Expect = 1.285e-164
Identity = 297/712 (41.71%), Postives = 439/712 (61.66%), Query Frame = 2
Query:  854 RDSSRQTIEKVFGFWHKAGIPVRAAKHCIDKLEAFFAEWKGLQKHKNRITDGHKMKEDEFTSRLDNLFDIAHLDALTLITIPEDRAFFLSQRQEGRPGSIGAVD-KVEELKTRHRQDQKKAELKRKKRSQEEIEAYSSQAALKTALSSXXXXXXXXXXXXXXXKSKTCSRSD--EVCV-GPKRAKIN-------------VLSPGLTSALDRTKISSQNATFVLSEVASSLGHDVNTLNINXXXXXXXXXXXXXXXXXXXXXEFSTTVPLTVHWDGKLMEDLSTLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVVQCLEEWGLAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHHIMELIVGAAFETTSVGTSSGPEIQIFKRFRDYWQFIDRDGFQVASSDPSVELLVAPYRSDILSFARTYLQAEHPRDDYREFLELAVIFLGDVPDRGIRFQVPGAMHWARWMAKVIYSIKMFLFRSQFKMTASEERGICDVATFSVVIHLKAWMTAPLAVEAPLNDFTLMGQLRSYPHA--AISAATSKKLGLHMWYLSEELIGLALFDSRLSHDSKRLMIAAMDEEAPDHPSKRPSIKSDAFLGKRGLEQFCTVNSKKLFQLLDLPITLVNKDPSDWEQDESYTRALGIVKSLAVVNDRAERGVALIQDFNKKLTKNEDQLQFLLQIVNEHRRQFPDCTK 2932
            RD++  T  +V  FW KA IP +   H I+K++    +W+ ++K  +R T      E  F S  DNLFDIAH DALTLI+I ED+ F L+QR++GR GS+G +D K+ + + R +Q Q + ELK KK ++               L  D+   +  D++  +D S+ CS SD  E+ V   KR K N             +++  + SALDRTK+S +NA +VLS    SLGH++    +NR SI +AR  +R   +  +++ F TT+PLTVHWDGKL+ DL++ + VDRL V++SG G+ +LLGVPK+  GTGEAQA+AV + LEEW L E++  + FDTTASN+G ++G C L+E K+ +DLL LACRHHI+ELI+ + F    +G SSGP I+IF+RF + W  ID D ++    + +V   + P +  ++ +    L    PRDDY+E L+L++IFLGD   +  + + PGA+H ARWMAK+IYS+K+FLFRSQFK+TA E   +     F + +++K W TA     AP ND  L+ +L +Y  +   I  A +K    H+WYLSE LIGLA FDS++S + K  M+ ++ ++  D P +R ++++ A +    L  F + NS  LF  LD+P   +N++P  WE  + +      V+ L VVND AERG++LIQ FN  +T  E+Q Q+LLQ+V +HR+++P+  K
Sbjct:   22 RDTATITAREVSAFWEKAKIPTQKECHVIEKIKKIHCKWQSIKKSASRRTSKQLEAESVFVSDFDNLFDIAHKDALTLISIKEDKEFLLAQREKGRRGSMGPIDTKLSKKEERTKQRQLQNELKIKKETER--------------LKKDEQMSNVNDNNIDWDDSQ-CSSSDNDELYVPSSKRLKKNNSPTKVNTLFNSTIVTSRVASALDRTKVSDRNAMYVLSATVQSLGHNIQNFTLNRESIRQARREYREKIADEIKTSFVTTIPLTVHWDGKLLPDLTSKDKVDRLAVIVSGDGIMKLLGVPKIPNGTGEAQATAVFELLEEWNLIERINFMSFDTTASNSGVKAGACVLLEKKIKRDLLSLACRHHILELIIESVFNAL-MGASSGPNIKIFQRFAEKWNEIDVDKYKSGIIEDTVASKLNPQKYVLVKYINDQLATFQPRDDYKELLQLSLIFLGDETAKDFKIRRPGALHRARWMAKLIYSLKIFLFRSQFKLTARELSALEAFNVFVIQVYIKYWYTASSGELAPYNDLNLLKELDNYKKSNIVIGNAAAKSFSRHLWYLSETLIGLAFFDSKVSSEMKVNMVKSLVKKGADFPLRRITVETTA-VQTVQLSDFVSKNSLILFTALDIPQDFLNQNPDTWENHKDFIDGCKRVQHLKVVNDAAERGISLIQTFNGIITNQEEQKQYLLQVVEQHRQKYPNPNK 716          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A0A1XM36 (NADH-quinone oxidoreductase subunit D OS=Zeugodacus cucurbitae OX=28588 GN=nuoD_1 PE=4 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 2.263e-154
Identity = 286/745 (38.39%), Postives = 442/745 (59.33%), Query Frame = 2
Query:  719 METRGKSNVYLLGSAESDILGAKLPSHLQTFG-YFMHLHKVENLTVRDSSRQTIEKVFGFWHKAGIPVRAAKHCIDKLEAFFAEWKGLQKHKNRITDGHKMKEDEFTSRLDNLFDIAHLDALTLITIPEDRAFFLSQRQEGRPGSIGAVDKVEELKTRHRQDQKKAELKRK-KRSQEEIEAYSSQAALKTALSSXXXXXXXXXXXXXXXKSKTCSRSDEVCVGPKRAKINVLSPGLTSALDRTKISSQNATFVLSEVASSLGHDVNTLNINXXXXXXXXXXXXXXXXXXXXXEF--STTVPLTVHWDGKLMEDLSTLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVVQCLEEWGLAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHHIMELIVGAAFETTSVGTSSGPEIQIFKRFRDYWQFIDRDGFQVASSDPSVELLVAPYRSDILS-FARTYLQAEHPRDDYREFLELAVIFLGDVPDRGIRFQVPGAMHWARWMAKVIYSIKMFLFRSQFKMTASEERGICDVATFSVVIHLKAWMTAPLAVEAPLNDFTLMGQLRSYP--HAAISAATSKKLGLHMWYLSEELIGLALFDSRLSHDSKRLMIAAMDEEAPDHPSKRPSIKSDAFLGKRGLEQFCTVNSKKLFQLLDLPITLVNKDPSDWEQDESYTRALGIVKSLAVVNDRAERGVALIQDFNKKLTKNEDQLQFLLQIVNEHRRQFPDCTK 2932
            M+TR    +YLL   ES I+G+KLPS+ Q     F ++ KV+ L +R S+   I++    W+KA IPVR     + K+EA + EWK LQK   R T   KM+ED+F   ++NLFDIAH +AL LI I ED+ F  +QR+EGRPG++   D+    K + R  + + E+ RK K+ +E+ + + +   L    + +   V + + D+  D++  C    +     KR   + ++  L + LD+ K+S ++A  +L   A +L HD++TL I+++SI   R   R+  ++ L ++F  S    +TVHWDGK++  ++    VDRLPV+I+  G+E LLGVP LSAGTG+ Q  A+++ L+EW L E+V A+CFDTTA+NTG   GTC L+E  LN++LLYL CRHHI EL++ +AF    +   SGP + IF+RF+  W  I++  F     D  + L +     D L+ FA  Y+  +HPR DY+E LEL++IFLG   +  +RF+ PGA+H ARWMAK IY+IK+FLFR QF M++ E   I D++ F + I+L+ W+ A +A +APLND   +  +  +   +  IS   + K   H+ YL+ E  GL+ FD+ +    KR M+  + +E  +  +KR     +  L +  +  F    +   F+  ++    +  DPS W  D  + + + IVK+L VVND AER V L++++N  LTKNE++ Q++LQ V E+R+++    K
Sbjct:    1 MDTRASEKIYLLEYDESQIVGSKLPSNGQVLKVLFYNMRKVK-LDLRSSAYLVIKEAEILWNKARIPVRQIDRSVQKVEALYKEWKNLQKTCKRSTPLQKMREDQFIKNMNNLFDIAHGNALDLIKIEEDKEFLKNQRKEGRPGAMVGCDRSLFEKEKRRNTRIEKEVIRKGKQDEEQFQVFLTANDLSDN-TEELIDVYDDNTDDNTDQTANCRFQQK---NRKRGIKHFITSKLVATLDKCKVSDRDAVRILIAAAEALEHDISTLVISKTSIRLCRKQIRSETAAKLMTDFKNSNIDQITVHWDGKILPSITGNAKVDRLPVVITTDGIEHLLGVPALSAGTGKEQTYAILELLKEWNLTEKVEALCFDTTATNTGRLQGTCILLEQHLNRELLYLPCRHHIYELLLKSAFAKYDLKL-SGPSLDIFQRFKKNWPKINQQKFASGMVDKKINLALNKAEQDQLAQFAHNYITKQHPRADYKELLELSLIFLGRNTE-PVRFKSPGAIHHARWMAKAIYTIKIFLFRHQFLMSSDEANAIQDISVFILKIYLRPWIEASIAAKAPLNDLNFIKNIIKFNELNEIISNEVTLKFSNHLLYLTPEAAGLSFFDNAVDLGEKRKMVENLKKEQTNE-NKRIVTNMNE-LNQNNISDFVNKKTVSFFERFNIQTNFLKLDPSKWHNDSEFQKGMNIVKNLHVVNDTAERFVKLMEEYNAALTKNEEEKQYILQTVTEYRKKYGSINK 736          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: calub (calumenin-B [Source:NCBI gene;Acc:103027690])

HSP 1 Score: 93.2041 bits (230), Expect = 1.129e-19
Identity = 44/96 (45.83%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 6074 RNKDP-EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            ++ DP EPEW++ E + FT +RD N D RMD++E  +WI+PS+YD  E+E  HL+  +D +KD  L+  EIV++ +LF GSQAT++G  L   +E 
Sbjct:  220 QDGDPTEPEWVRTEREQFTEFRDKNKDGRMDKEETRDWILPSDYDHAEAEAKHLLYESDTDKDGMLTKQEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:103039743])

HSP 1 Score: 89.3521 bits (220), Expect = 2.088e-18
Identity = 42/92 (45.65%), Postives = 62/92 (67.39%), Query Frame = 2
Query: 6086 PEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL-KNKEEL 6358
            PEP+W++ E   F+ +RD N D +MD +EI  WI+P +YD  ++E  HL+  +D +KD  L+ +EI+E   +F GSQATNYG  L +N +EL
Sbjct:  230 PEPDWVKTERDQFSDFRDLNKDGKMDLEEIRHWILPQDYDHAQAEARHLLLESDTDKDQMLTKEEILENWNMFVGSQATNYGEDLTRNHDEL 321          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: calua (calumenin [Source:NCBI gene;Acc:103043492])

HSP 1 Score: 89.3521 bits (220), Expect = 2.227e-18
Identity = 40/90 (44.44%), Postives = 62/90 (68.89%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            EPEW+  E + F+ +RD N D +MD++E  +WI+P++YD  E+E  HL+  +D NKD +LS +EI+ + +LF GSQAT++G  L   +E 
Sbjct:  226 EPEWVATEREQFSEFRDKNKDGKMDKEETMDWILPADYDHAEAEAKHLVYESDSNKDGKLSKEEILNKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:103045651])

HSP 1 Score: 80.8777 bits (198), Expect = 1.546e-15
Identity = 37/87 (42.53%), Postives = 53/87 (60.92%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNK 6349
            EPEW+  E K F+ +RD N D  +D  E+ +WI+P + D  + E  HL+   D + DD+++  EI+E   +F GSQATNYG  L  K
Sbjct:  223 EPEWVNTEKKQFSEFRDVNKDGFLDASEVAQWILPGDVDHADIEAKHLIHETDRDNDDKMTKKEILENWNMFVGSQATNYGEDLTRK 309          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn2 (reticulocalbin 2 [Source:NCBI gene;Acc:103045530])

HSP 1 Score: 51.2174 bits (121), Expect = 6.747e-6
Identity = 27/86 (31.40%), Postives = 43/86 (50.00%), Query Frame = 2
Query: 6083 DPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL 6340
            D   +W   E   F    D N D +++R E   W+ P++Y     E  HL+   D + D+ LS  EI++  ++F  S+ T+YG  L
Sbjct:  209 DEPSQWEAEETVRFKDLYDQNKDGKLNRDEQLRWVAPNSYGSAREEAVHLIKEMDQDGDERLSETEILKNQDIFMNSEVTDYGRQL 294          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 95.9005 bits (237), Expect = 2.473e-21
Identity = 43/90 (47.78%), Postives = 64/90 (71.11%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            EPEW++ E + FT +RDTN D +MD++E   WI+PS+YD  E+E  HL+  +D +KD +LS +EI+++ +LF GSQATN+G  L   +E 
Sbjct:  228 EPEWVKTERQQFTDFRDTNKDGKMDKEETMAWILPSDYDHAEAEARHLIYESDSDKDGKLSKEEILDKHDLFVGSQATNFGEALTRHDEF 317          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 75.8702 bits (185), Expect = 3.629e-15
Identity = 35/87 (40.23%), Postives = 53/87 (60.92%), Query Frame = 2
Query: 6098 WIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            W++ E K F   RDT+ D  M   E+  WI+P +YD  E+E  HL+   D ++D  L+ +EI+ + +LF GSQAT++G  L   +EL
Sbjct:  154 WVESERKQFAELRDTDGDGLMGHDEVAAWILPDDYDQAEAESKHLIHECDDDQDGNLTREEIIAKYDLFVGSQATDFGEALMRHDEL 240          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 72.0182 bits (175), Expect = 6.063e-14
Identity = 36/100 (36.00%), Postives = 59/100 (59.00%), Query Frame = 2
Query: 6050 YSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNK 6349
            Y R+P+  ++   +PEW+  E   FT   D ++D +++  E+  W+MP+N +  E E  HL+ H D + D +LS DE+V+  ELF  S+ T+YG  L  +
Sbjct:  126 YHRDPSTPQS---DPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGRQLGEQ 222          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 72.4034 bits (176), Expect = 7.691e-14
Identity = 36/97 (37.11%), Postives = 58/97 (59.79%), Query Frame = 2
Query: 6050 YSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL 6340
            Y R+P+  ++   +PEW+  E   FT   D ++D +++  E+  W+MP+N +  E E  HL+ H D + D +LS DE+V+  ELF  S+ T+YG  L
Sbjct:  141 YHRDPSTPQS---DPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGRQL 234          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: sdf4 (stromal cell derived factor 4 [Source:NCBI gene;Acc:406360])

HSP 1 Score: 51.9878 bits (123), Expect = 5.309e-7
Identity = 26/89 (29.21%), Postives = 51/89 (57.30%), Query Frame = 2
Query: 6074 RNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL 6340
            + +D + +W++   K F    D+N D  + R E+ E++ P++     SE   +++ AD ++D +LS+DE++  SE F GS+  +Y   +
Sbjct:  169 KEQDIDDDWVRERRKEFIEVIDSNKDGFITRSELEEYMDPTSSHNALSEAKQMISVADEDEDAQLSLDEVLRYSEYFTGSKLVDYARNV 257          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO32638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH8])

HSP 1 Score: 93.2041 bits (230), Expect = 4.806e-20
Identity = 40/92 (43.48%), Postives = 64/92 (69.57%), Query Frame = 2
Query: 6083 DPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            D EP+W++ E + F   RD N D +MD+ E+ +WI+P+++D + +EV HL+  AD+NKD  L+  EI+++ E+FAGSQAT++G  L   +E 
Sbjct:  241 DEEPDWVKTEREQFLTVRDKNRDGKMDKDEVRDWIVPADFDHVGAEVTHLINEADVNKDGYLTKSEIIDKHEVFAGSQATDFGDALTRHDEF 332          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO42789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S7])

HSP 1 Score: 68.9366 bits (167), Expect = 2.245e-12
Identity = 33/73 (45.21%), Postives = 43/73 (58.90%), Query Frame = 2
Query: 6122 FTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL 6340
            F    D N D ++D KE+ +W  P N++    E  HL+ HAD+N D +LS DEIV   E FAGS AT +G T 
Sbjct:  191 FEEKHDQNKDGKLDLKEVEDWRRPKNFNKALEEAQHLIEHADLNGDGKLSADEIVTSHEFFAGSYATQFGQTF 263          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO34762 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SND1])

HSP 1 Score: 67.0106 bits (162), Expect = 1.041e-11
Identity = 35/99 (35.35%), Postives = 59/99 (59.60%), Query Frame = 2
Query: 6047 LYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLK 6343
            L + E  L +  D  P W++ E + F    D N D ++DR+E+  W++P   + ++ E  HL+  +D N D +L +DEI+   +LF GS+AT++G TL+
Sbjct:  160 LITVEEFLGQYGDEVPGWVEKEREDFAKQFDKNKDGKLDREEVRAWVLPEKGESLD-EAKHLIDGSDENADGDLQLDEILLHWDLFVGSKATDHGETLR 257          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO31169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP9])

HSP 1 Score: 66.6254 bits (161), Expect = 1.753e-11
Identity = 33/69 (47.83%), Postives = 46/69 (66.67%), Query Frame = 2
Query: 6137 DTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLK 6343
            D + D  ++++E+  WI PS       E  HLM   D NKD+ L++DEI+E+ ELFAGS+ATNYG+ LK
Sbjct:  199 DKDKDGSLNKEELKSWIFPSGSPS-SGEAEHLMTEVDKNKDNFLTVDEIMERYELFAGSRATNYGNMLK 266          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO47673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD6])

HSP 1 Score: 66.2402 bits (160), Expect = 3.084e-11
Identity = 33/86 (38.37%), Postives = 51/86 (59.30%), Query Frame = 2
Query: 6101 IQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            I    + F  +RDTN D R+DR+E+ +++ P+ YD + +E  HL+   D N+D  L+ DEI++  E F GS+A  +G  L   EE 
Sbjct:  213 IARRRQEFLEHRDTNKDGRLDRRELKDYLFPA-YDHVGAEAQHLINEVDKNEDGMLTKDEIMDNFEKFVGSRAAEFGQALNRHEEF 297          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: calub (calumenin [Source:NCBI gene;Acc:101165303])

HSP 1 Score: 93.5893 bits (231), Expect = 8.049e-20
Identity = 41/90 (45.56%), Postives = 63/90 (70.00%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            EPEW++ E + FT +RD N D +MD++E  +WI+PS+YD  E+E  HL+  +D++KD  L+  EIV++ +LF GSQAT++G  L   +E 
Sbjct:  229 EPEWVKTEREQFTEFRDKNKDGKMDKEETKDWILPSDYDHAEAEAKHLVYESDVDKDGRLTKAEIVDKYDLFVGSQATDFGEALTRHDEF 318          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:101175141])

HSP 1 Score: 92.8189 bits (229), Expect = 2.717e-19
Identity = 41/85 (48.24%), Postives = 59/85 (69.41%), Query Frame = 2
Query: 6086 PEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTL 6340
            PEP+W++ E + F+ +RD N D +MD+ EI  WIMP +YD  ++E  HL+  +D +KD +L+ DEI+E   +F GSQATNYG  L
Sbjct:  261 PEPDWVKTEREQFSDFRDLNKDGKMDKDEIRHWIMPQDYDHAQAEARHLVYESDQDKDQKLTKDEILENWNMFVGSQATNYGEDL 345          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: rcn3 (reticulocalbin-1 [Source:NCBI gene;Acc:101175408])

HSP 1 Score: 80.1073 bits (196), Expect = 2.335e-15
Identity = 36/87 (41.38%), Postives = 53/87 (60.92%), Query Frame = 2
Query: 6089 EPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNK 6349
            EP+W+  E KHF+ +RD+N D  +D  E+  WI+P   D  ++E  HL+   D +KD +++  EI+    +F GSQATNYG  L  K
Sbjct:  228 EPDWVHTEKKHFSEFRDSNKDGYLDAGEVAHWILPGEVDHADNEAKHLIHETDTDKDGKVTKKEILANWNMFVGSQATNYGEDLTKK 314          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000028508.1 (SMESG000028508.1)

HSP 1 Score: 269.626 bits (688), Expect = 3.571e-72
Identity = 127/253 (50.20%), Postives = 169/253 (66.80%), Query Frame = 2
Query: 1829 ASNTGHRSGTCSLIEHKLNKDLLYLACRHHIMELIVGAAFETTSVGTSSGPEIQIFKRFRDYWQFIDRDGFQVASSDPSVELLVAPYRSDILSFARTYLQAEHPRDDYREFLELAVIFLGDVPDRGIRFQVPGAMHWARWMAKVIYSIKMFLFRSQFKMTASEERGICDVATFSVVIHLKAWMTAPLAVEAPLNDFTLMGQLRSYP--HAAISAATSKKLGLHMWYLSEELIGLALFDSRLSHDSKRLMIAAM 2581
            A N    +G C L+E  L  +LL LACRHHI EL++GA F+T  +G SS  E+ +FKRF+  WQFID   +     D  V  ++   R+ +L FA + LQ   PRDDYREFLEL++IFLG VP RGIRF  PGAM  ARWM+KV+YS+K+++FRSQF +  +E +G+ D+ TFSV +++K W TAP A   P ND T +  L  Y   H AIS A S K+  H+WY+SEEL+GLALFD  LS  +KR +++A+
Sbjct:  754 ALNRSLANGACVLLEQMLGINLLSLACRHHIFELVIGAVFQTC-MGPSSAQEVLMFKRFQSCWQFIDPASYSTGMDDKDVAAVLMDTRNKLLEFAESQLQIMQPRDDYREFLELSIIFLGGVPARGIRFIAPGAMQHARWMSKVLYSLKVYMFRSQFDLRPTEVKGLRDICTFSVSLYIKVWFTAPCAATGPRNDLTFLQALIDYEVVHPAISKAASAKMAKHLWYISEELVGLALFDKDLSTTTKRELVSAI 1005          

HSP 2 Score: 170.244 bits (430), Expect = 8.551e-42
Identity = 107/272 (39.34%), Postives = 151/272 (55.51%), Query Frame = 2
Query:  725 TRGKSNVYLLGSAESDILGAKLPSHLQTFGYFMHLHKVENLTVRDSSRQTIEKVFGFWHKAGIPVRAAKHCIDKLEAFFAEWKGLQKHKNRITDGHKMKEDEFTSRLDNLFDIAHLDALTLITIPEDRAFFLSQRQEGRPGSIGAVDKV---EELKTRHRQDQKKAELKRKKRSQEEIEAYSSQAALKTALSSXXXXXXXXXXXXXXXKSK--TCSRSDEVCVGPKRAKINVLSPGLTSALDRTKISSQNATFVLSEVASSLGHDVNTLNIN 1525
            TR K+ VYLL S    + G KLPS LQ  G F+H HK    T+R +S   IE    FW KA IP RA  HC  KLE+ F  W+ L+K+ +R  +  K KE  F SRLD+LFDIAH DA   I I EDR F ++QR++GR GS+  +D     +E +    +D+  A   R    Q++++A +  + L +  +S      E  D+      +  T  RS       KR ++ V+SPGL + LDRTK+S + A ++++E A SLG D+  L +N
Sbjct:  490 TRSKTKVYLLESYTEVLTGRKLPSLLQVLGLFLHEHKENGKTIRVASTIAIESTAKFWQKARIPTRAVHHCQAKLESEFDAWRLLKKNASRKAETQKAKEAAFCSRLDDLFDIAHADAHKNIKIEEDRKFLIAQREKGRRGSMLGLDVTLTNKEQRASEARDKLAARRHRAVCDQQQLDAKAELSELDSHSNSSTSESYESGDEMQGTTGRVHTPVRSQR-----KRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDMKDLALN 756          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000007225.1 (SMESG000007225.1)

HSP 1 Score: 223.016 bits (567), Expect = 1.940e-64
Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 2
Query: 6038 TDELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 6358
            TDELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL
Sbjct:  209 TDELYSREPNLVRNKDPEPEWIQYELKHFTVYRDTNNDKRMDRKEIGEWIMPSNYDGIESEVHHLMAHADINKDDELSIDEIVEQSELFAGSQATNYGSTLKNKEEL 315          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000000162.1 (SMESG000000162.1)

HSP 1 Score: 156.762 bits (395), Expect = 1.483e-40
Identity = 121/413 (29.30%), Postives = 210/413 (50.85%), Query Frame = 2
Query:  719 METRGKSNVYLLGSAESDILGAKLPSHLQTFGYFMHLHKVENLTVRDSSRQTI----EKVFGFWHKAGIPVRAAKHCIDKLEAFFAEWKGLQKHKNRITDGHKMK-EDEFTSRLDNLFDIAHLDALTLITIPEDRAFFLSQRQEGRPGSIGAVDKVEELKTRHRQDQKKAELKRKKRSQEEI---EAYSSQAALKTALSSXXXXXXXXXXXXXXXKSKTCSRSDEV--CVGPKRAKINVLSPGLTSALDRTKISSQNATFVLSEVASSLGHDVNTLNINXXXXXXXXXXXXXXXXXXXXXEFSTTVPLTVHWDGKLMEDL--STLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVVQCLEEW-GLAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHH 1918
            + TR  + ++L+G   + I   + P  L T G  +     E  T + +   T     ++V  +W KA IP  A  H + KL++   +   + KHK R     ++  E +FT ++ +L DIAH +      IPEDR F + QR              + L TR   + + A  K +KR QE++   E Y +++    A +      D+ D+D   ++ +    ++      G  R     L P    ALDRT+ +++ A  +++   ++ G DV+ L+++R+++   R + R   ++ +R      VPL   +DGKL+ ++     E  D +PV +S +G+E+LLG+PKL AGTG      VV+ + +W G+ + +AA+ FDTTASNTG  +G  ++++   ++ LL+LACR +
Sbjct:   17 VSTRSATEIWLVGQPLTSIDEVE-PRQLPTNGLALRRIYCEMKTNKATLAATFSTLADEVLSYWAKANIPTTAKPHVVAKLKSLHQDHATVSKHKQRQHSASQIGLETDFTLKMGHLLDIAHAEWEHKTFIPEDRQFLIDQR-----------GPRQMLMTREYLNYRHAAAKYRKRKQEQLDHQERYKAESTAAAATAVVLTCSDDSDEDSSLNQLQLSQSANHTPRSTGSTRD----LQPPNQPALDRTRTTTRQAMMIVTPALAAAGVDVSQLSLSRATLMETRNTSRETLAATVRQNIQPAVPLVAQFDGKLLPNIDGGKRELQDCMPVGVSSLGIEKLLGIPKLPAGTGALMGQKVVEFVRDWPGVEDHLAALYFDTTASNTGIHTGAITVVQQAFSRRLLFLACRRY 413          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000014243.1 (SMESG000014243.1)

HSP 1 Score: 132.494 bits (332), Expect = 1.033e-34
Identity = 75/179 (41.90%), Postives = 115/179 (64.25%), Query Frame = 2
Query: 1469 VLSEVASSLGHDVNTLNINXXXXXXXXXXXXXXXXXXXXXEFSTTVPLTVHWDGKLMEDLS--TLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVVQCLEEW-GLAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHHIMELIVGAAFETTSVGTSSGPEIQIF 1996
            +++    ++G D++TL++  SSI+RAR   R + +   +  F  T PL  H+DGKL+ D    T E VDR+P+++SG+ +E+LL +PKL   TGE   +AVV  L+ W G+ + +A +CFDTT SNTG   G  ++I+   +K LL+LACRHHI+E++  A F+      SSGP+I +F
Sbjct:    3 IVAPALKAVGVDIDTLSLPTSSIYRARKPVRKSLAQTQKELFVPTTPLITHFDGKLLPDNDGRTEELVDRMPIVVSGLSIEKLLAIPKLPVSTGELMGNAVVYTLQAWKGVPDWLAGLCFDTTISNTGINIGAINVIQRAFDKRLLFLACRHHILEIVSAAVFD--KFFKSSGPQIALF 179          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000033311.1 (SMESG000033311.1)

HSP 1 Score: 129.413 bits (324), Expect = 3.718e-33
Identity = 65/154 (42.21%), Postives = 96/154 (62.34%), Query Frame = 2
Query: 1589 EFSTTVPLTVHWDGKLM--EDLSTLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVVQCLEEWG-LAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHHIMELIVGAA----FETTSVGTSSGPEIQIFKRFRDYWQFID 2029
            +F  T PL  H+DGK +   D  T E VDR+ +++S + +E+LL +PKL   TGE   + VV  L+ W  +++ +A  CFDTT+SNT   +G  ++I+   +K LL+LACRHHI+E++  A     FE      SSGP+I +F RF+  W+FID
Sbjct:   43 QFVPTTPLIAHFDGKSLPDNDGRTEELVDRMTIVVSALNIEKLLVIPKLPVSTGELMGNTVVHTLQTWKCVSDWLAGQCFDTTSSNTSINTGAITVIQRAFDKRLLFLACRHHILEIVSAAVSYQFFE------SSGPQIALFGRFKQQWKFID 190          
The following BLAST results are available for this feature:
BLAST of Reticulocalbin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALU8.090e-2141.90calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU3.735e-1941.90calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU3.950e-1941.90calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU4.254e-1941.90calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU4.756e-1941.90calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
calu-15.584e-1744.71CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-15.584e-1744.71CALUmenin (Calcium-binding protein) homolog [Sour... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scf1.737e-1637.63gene:FBgn0025682 transcript:FBtr0089941[more]
scf3.349e-1537.63gene:FBgn0025682 transcript:FBtr0089942[more]
CG316502.200e-839.29gene:FBgn0031673 transcript:FBtr0301907[more]
CG316502.200e-839.29gene:FBgn0031673 transcript:FBtr0301905[more]
CG316502.200e-839.29gene:FBgn0031673 transcript:FBtr0079033[more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calub5.965e-2045.00calumenin b [Source:NCBI gene;Acc:394057][more]
calub3.057e-1945.56calumenin b [Source:NCBI gene;Acc:394057][more]
calua1.050e-1844.44calumenin a [Source:NCBI gene;Acc:415241][more]
calua1.050e-1844.44calumenin a [Source:NCBI gene;Acc:415241][more]
rcn11.870e-1846.74reticulocalbin 1, EF-hand calcium binding domain [... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calu7.006e-1945.56calumenin [Source:NCBI gene;Acc:407965][more]
calu7.341e-1945.56calumenin [Source:NCBI gene;Acc:407965][more]
rcn32.193e-1845.45reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
rcn32.444e-1845.45reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
fgf114.388e-1843.48fibroblast growth factor 11 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calu6.421e-2141.90calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Calu2.448e-1941.90calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Calu2.712e-1941.90calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Rcn18.841e-1845.65reticulocalbin 1 [Source:MGI Symbol;Acc:MGI:104559... [more]
Rcn35.031e-1642.42reticulocalbin 3, EF-hand calcium binding domain [... [more]
back to top
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B5X4E0|CALUB_SALSA9.632e-2049.46Calumenin-B OS=Salmo salar OX=8030 GN=calub PE=2 S... [more]
sp|Q4U471|CALU_MESAU6.368e-1942.86Calumenin OS=Mesocricetus auratus OX=10036 GN=CALU... [more]
sp|Q6XLQ7|CALU_RABIT1.712e-1841.90Calumenin OS=Oryctolagus cuniculus OX=9986 GN=CALU... [more]
sp|O35887|CALU_MOUSE1.712e-1841.90Calumenin OS=Mus musculus OX=10090 GN=Calu PE=1 SV... [more]
sp|Q5RDD8|CALU_PONAB1.744e-1841.90Calumenin OS=Pongo abelii OX=9601 GN=CALU PE=2 SV=... [more]
back to top
BLAST of Reticulocalbin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9K9R53.013e-17640.99Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A2S2PCY91.751e-17341.09Uncharacterized protein OS=Schizaphis graminum OX=... [more]
J9M5931.320e-16539.28Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
J9LU941.285e-16441.71Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A0A1XM362.263e-15438.39NADH-quinone oxidoreductase subunit D OS=Zeugodacu... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calub1.129e-1945.83calumenin-B [Source:NCBI gene;Acc:103027690][more]
rcn12.088e-1845.65reticulocalbin 1 [Source:NCBI gene;Acc:103039743][more]
calua2.227e-1844.44calumenin [Source:NCBI gene;Acc:103043492][more]
rcn31.546e-1542.53reticulocalbin 3 [Source:NCBI gene;Acc:103045651][more]
rcn26.747e-631.40reticulocalbin 2 [Source:NCBI gene;Acc:103045530][more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALU2.473e-2147.78calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU3.629e-1540.23calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
rcn26.063e-1436.00reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
rcn27.691e-1437.11reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
sdf45.309e-729.21stromal cell derived factor 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO326384.806e-2043.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427892.245e-1245.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347621.041e-1135.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311691.753e-1147.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476733.084e-1138.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
calub8.049e-2045.56calumenin [Source:NCBI gene;Acc:101165303][more]
rcn12.717e-1948.24reticulocalbin 1 [Source:NCBI gene;Acc:101175141][more]
rcn32.335e-1541.38reticulocalbin-1 [Source:NCBI gene;Acc:101175408][more]
back to top
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028508.13.571e-7250.20SMESG000028508.1[more]
SMESG000007225.11.940e-64100.00SMESG000007225.1[more]
SMESG000000162.11.483e-4029.30SMESG000000162.1[more]
SMESG000014243.11.033e-3441.90SMESG000014243.1[more]
SMESG000033311.13.718e-3342.21SMESG000033311.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013416 ID=SMED30013416|Name=Reticulocalbin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=6503bp
AATTCTAGTGTAGTTTTGTACTCATCAGGTTCAGGAGGGCCGGGATTAGG
GTGGCCCTTAAAACAAAAAGTTTGAAATCATCTTCTGGCACCCCACTAAT
ATGTTCCACTTACAGAAATAAAATTATGTGCAAAAAATCATGCAGATTGG
GCAATATTTAGAGGTGGCCCTCAAGCTTTGAAGTTTGACTAAATCCGTGA
AATTTAAATAAATCGTTAAGTTTTAAACCTGTTTCGTGTTCTGTATAAAT
ATGATGTATTGTAACTGTATAATATATTAACTTACTACATCATCATTGCA
TCATCCCAATGACAAAATAAATATTCCTTGGTACAGTAGACACTGTGCAA
ATTTGCAAAAAAGCTTACAACCCTTAAATAATAAATAATTTGACTGCTAT
CATTGAATTGCTTAGTCAATACTTATCTGTGTCTGCCAAGTCTTTAATTG
CAGCACTAGTGCGCTAGATTGGTCTCACTGGATTGTAGTGGATTCAAGTG
GATTGCTTGCATTCAAGGTAAATGTAATTTTTTCTATTAATCCAATTTGT
CTATTATTTGAATGGGTTTAATTACTTCTGTTAATTCATTATTCTATCAT
TCGTTACTCATTACTCAATACTCAATAGTCATTATTTGAAGTGATTAGTA
AACACCTAGTCCATAATTATGTGTTGTCACTTGTCAGTTTTTGATATGTT
TATTTTTATAGATTAAAAATGGAGACCAGAGGAAAATCAAATGTCTACTT
GCTCGGTTCAGCGGAGTCTGACATTCTGGGAGCAAAGTTGCCATCGCATC
TCCAAACTTTTGGTTATTTCATGCATCTTCACAAAGTTGAGAATCTGACC
GTTCGTGACTCTAGTCGACAAACCATCGAAAAGGTGTTTGGATTTTGGCA
TAAGGCTGGTATTCCAGTTCGAGCAGCCAAACATTGCATCGACAAGTTGG
AAGCATTTTTTGCTGAATGGAAAGGTCTCCAAAAGCACAAGAATCGGATT
ACCGATGGACACAAGATGAAGGAGGATGAATTCACTTCACGCCTAGACAA
TCTCTTTGACATCGCACATTTGGATGCACTGACTTTGATTACTATTCCTG
AAGATAGAGCGTTCTTCCTCTCTCAAAGGCAGGAAGGCCGGCCAGGTTCA
ATTGGAGCTGTTGATAAGGTGGAAGAACTGAAGACACGCCATCGTCAGGA
TCAGAAGAAGGCAGAACTAAAACGCAAGAAGCGATCACAAGAGGAAATTG
AAGCATATTCGAGCCAGGCTGCTCTTAAAACTGCTTTATCTTCAGATGAT
GATGCAGTTGATGAGTATGATGATGATGAGTACTTCGATAAAAGTAAAAC
TTGCAGTCGATCGGATGAAGTCTGTGTTGGACCCAAAAGAGCAAAAATCA
ATGTGTTGTCTCCTGGTTTAACTTCAGCTTTGGACAGAACTAAGATTTCA
TCACAGAATGCTACCTTCGTTCTCAGTGAAGTAGCTTCCAGTCTTGGCCA
TGATGTGAACACTTTAAACATCAATCGAAGCTCAATACATCGCGCTAGAG
CAAGTCATCGGGCTGCCAGATCGAGCTGTCTGCGATCAGAGTTTTCAACA
ACTGTACCTTTAACGGTTCACTGGGACGGCAAGCTGATGGAAGACTTATC
GACACTTGAACATGTAGACCGTCTTCCAGTCCTTATCTCAGGTGTTGGAG
TCGAACAGTTACTTGGCGTCCCAAAGCTGTCAGCTGGGACAGGTGAAGCA
CAAGCATCTGCAGTCGTTCAATGTTTGGAAGAGTGGGGTCTTGCAGAGCA
GGTCGCTGCAGTTTGTTTTGACACGACAGCATCTAATACTGGTCATCGTT
CAGGAACATGTTCTCTGATCGAGCACAAACTAAACAAAGATCTTCTATAC
CTGGCCTGTCGTCACCACATTATGGAGTTAATAGTTGGGGCTGCATTTGA
GACAACATCAGTTGGCACTTCATCTGGGCCGGAAATTCAGATATTCAAGA
GGTTCAGAGATTACTGGCAATTCATAGATCGTGACGGTTTTCAGGTTGCT
TCTTCAGACCCGTCGGTTGAGTTGTTAGTTGCACCATATCGTTCTGACAT
CCTGAGTTTTGCCAGAACATATTTGCAAGCTGAACATCCAAGAGATGACT
ACAGAGAATTTCTGGAGCTTGCAGTCATATTTCTTGGAGATGTTCCTGAT
CGCGGAATTCGATTTCAGGTGCCTGGTGCAATGCATTGGGCACGATGGAT
GGCGAAAGTTATCTACTCAATCAAAATGTTTCTCTTTCGCAGTCAGTTTA
AGATGACTGCTTCAGAAGAGCGTGGTATTTGTGATGTCGCCACTTTTTCC
GTTGTCATCCACCTCAAAGCCTGGATGACTGCACCACTGGCTGTTGAAGC
ACCTCTGAATGACTTCACGCTTATGGGACAACTTAGGAGCTATCCGCATG
CGGCTATTTCTGCTGCTACCAGCAAGAAGCTCGGGCTACATATGTGGTAC
TTGTCCGAAGAGCTTATTGGTCTGGCTCTGTTTGACTCCAGACTATCACA
TGACTCCAAGAGGCTAATGATTGCTGCAATGGACGAAGAAGCTCCAGATC
ATCCATCGAAGCGACCGAGCATAAAGTCCGATGCATTCCTGGGAAAACGA
GGTTTGGAACAGTTCTGCACAGTGAACTCCAAGAAACTGTTCCAGTTGCT
TGATCTACCTATAACATTGGTCAACAAGGATCCATCTGATTGGGAACAAG
ATGAGTCATACACGCGAGCGCTGGGCATTGTCAAGAGCTTGGCAGTCGTC
AATGACAGGGCTGAGCGTGGAGTTGCTCTCATTCAGGATTTTAATAAGAA
ATTGACCAAGAATGAAGATCAACTCCAGTTCCTTCTCCAAATTGTGAATG
AACATAGGCGCCAGTTCCCTGACTGTACCAAACGAAACCTGGCGACTTGT
GCTAATGGTCAACAATCTGACACTGTGAAATTGTGAATGTTGTGAAATAA
TAATACAGCGAAGAACAGTTGGCAGAGAGACATAATTCTTAACATTTTCA
GTTGGAGCTATTTCTGAATCAGTGACATTATTGCTTATTTGTTGTACAGT
AAACTAACCTGTTCAGGCTGTTGTGTGTAGAATAAATGTGATTTAAAAAT
GTAAGAAACCTTTAACAATTTGCAATATCGACTATCGAGCTTGAAATTGT
GGTACATACAAAACTTCAATGCCTGAGGGCCACCTCTAAATATTCTTCAA
TTGTAATGATGTTTTACACAATTCATTATTTCAATATTTGGCACAGATTG
GATGGGTGCCAGAATTCAAATTATGAATTTCATTTTTTTGCCCTATGCTA
AGGGCCACCCTACCATATAAAGTACCAATTCTGTCTGTATGTGTGCCACA
TCACAAATATATAACTGGCTTGCGAGTAGTTCAAACATTTATTCAAAATG
CTTAATTGAATAAGATTAATATACTCTCTGTAGACAGTAATATATCTATA
TAATTATAAAACTATTTGAATTAGAAGAGTATTGAGCTGTGACATACAGA
CAGACAGATTATTATTCAGTATAATAATTACTATGTAAAAGTATTATTTT
GTGAGTCTCATAACTGTCAAGTACATTTTTTATATTTCAAATGATATTTA
ATATGATTCAACCTAATAATTTCGATTAAACGTCACACAACAAAATTTTG
TTAGCAAACCAGATTATTTTAATTGTTTTTTCACTTATCTTCATTTAAAT
CTTGTCTGTAAACCAATTCTTTCATATTTAATAAAAATTGTCTATAATCG
AAAACTAAATGAATTCATATGATTTTGAATATATTTTAATTATTGGTGCC
AAAGTTCGTTGAATATGAATCGGTTGCAAATAATCCCAAAACTAAGCGTC
TAAATTGGCATGAGACACAATATTTAAATTCTTATAATTATTATAATAAC
GCAGCCTATTTATTATTACCAGTTTCACTTTTGATAAATTTTTTTTATGT
TAAACACAATCATGTTTCAGAATAATTATTAATATAATTATTATAAATTG
TCAAAATGTATTTAAGATGTACATTACAAATGTATATCAATATTTCTATG
ATTTTAATTTTTTCTAAAGAAAACGCGTCAACTTATTCACTTAAAGAATG
AAGATATTAGAATTCATAATAAACACATCAAAAGTGAATAAGTTAAATAA
TTTTTAAATTAAAATATATCTAAATGCATGAATAAATTTTTAAAAATTAA
TATGAATGATCTTTCCAATATTTCGCATTTCATATTATTTTACATCATTT
TATTATATACATTTTTTTTGATAAATGCATAAACATACGATGCACACTAA
TTGTATTCTATGTGATACTGAAATATTTACTCAAAATCCCATAGAATATA
AATTTATTTTCAAATGTAACATTCTCAACATTAATTATAGAAAAATAAAC
TGATTCTAGGGAACCAATATTAACGCTATCGCATCATATTTAACTTGTAA
ACATTTTAAATGTGTCTCTCATCTTTTCCTTTCAGACTATAAATCAATAT
ATTTTGTTTAATATTTAAAATAAATGTTTCAACCACGGGTTTCACTTGGC
CCACGAGATTCAACATGATTTTACAAAACTGTTTTGTGATATTGTTATGA
CTACAAAGTGCAAACAAAAGTATTGAGGTCGACTTTATGTAAAAAAGAAC
AAATATCTCAGTGATTCAATTGTTTTATTGATTGCTATCAATATAATTAT
TAATTTAATATAAAATTGATTATTTGTTCTATTGCTAATTTATGAATAAT
AATTGAAAAACATAATAATTTTAACTTTCACCTCGAAAAATTACATATAT
TTTATAATGCATTTAAAAAGTGTCCCACAAGATCATTCGAGTTTGCCAGA
TCTGATCTACAGCAGAAGTTATCTACTATTATGCTGCCGAGCTTTGTAGA
TATTTTTGTAGCATATTTATTGATAAAATCTGTATACAAATGTATAATTA
ATAAAATTTAAATATGTAGAATATTTAGAATTTAGATATATTTATAAATT
TTAATAGAATTAAAATACCAAATTACTTAAATGTGTCATCACATTAAAAT
AAGGTTGAGAACCAAGAAATGATTAAGTCACATGAAAAAGAATACAAAAT
AAAATTTTTATTTTTGTTACTTGAAAATTAACTTTTCTATCTATTAATAC
ATTAGTTTTTCATCCTTTTTGTTATAACTTTTAATCTGTTAAATATTAGA
AATTTGAATTTTTGTCTAATTGTCATGGTTTCGGTGACTAAATTTGGGAA
ATCACTGTTCGAAATAATTTGATTAGGAAATATTTTAGTCCAGTGTTTCT
CAACCAAAAATGTGCCGCGGACCAGTAAGCAATTTAAATTTTTACCGCGG
ACAACTAATACTAATTGTTGGTTATATTTTGCAGGAATACAAAATATTTA
ATGTACTATTAAATACATATATTTCAGTTGTAAAAATTCACACAAAGTTT
ACAAAAAATAAACAATATATTTACACAAAAAAATGTGCATAAAAGAATAA
CAATAAATATTGCAAAAAACATATAATAATATTATAATAAAGAAGTACAA
CACAAAAGTAATCTTAAAATTATACAAAACTACTGCATATCTAATAAATC
ACAGAAAATAGACAATATATAAATAATTTTCATTTAAAAACAGAGAATAA
AAAAAATAGAGAAAAATCCATAGTTGTATAAACATAATATACTTTTCATA
AAGTTTAACTAGAAAAATATAAAAGTCCAAAGAATCCAGAGAGAGAAATG
CACATTCTGTAATTTTACGTTTATAGTAATGTTGTAATATTTTATATGAT
TTATTTTATGAGGGGTAAACAATTTAACAATATTCTGGCATTATTTTCCT
CCTATTCAACTCACGTTGCGGACCGGTAATTTATGGTTTGCGGACCGGTG
TTGGTCCACGGACCACTACTTTGAGAACCACTGTTTTAGTGCATTCACTT
TATGATTAGTAGAATTTATTAGCACATTTCTTTTCCTACAGATGAATTGT
ATAGTCGGGAACCAAATTTAGTTCGTAACAAAGATCCGGAACCTGAATGG
ATACAATATGAATTGAAGCATTTTACTGTATACAGGGATACGAACAATGA
CAAAAGAATGGACCGCAAAGAAATCGGTGAATGGATTATGCCATCAAATT
ATGATGGTATTGAATCGGAAGTTCACCATTTGATGGCGCATGCTGATATA
AACAAAGATGATGAGTTGTCAATTGATGAAATTGTAGAACAATCGGAATT
ATTTGCGGGTAGCCAAGCAACTAATTATGGATCGACTCTTAAGAACAAGG
AAGAACTTTAACAAAATCACCTAAATTTGGCCATCTATTCTCGAGCATTC
TAATATGAATTAATAATTTTAGTTTTAAACCTTGCATGCTTTTGTTGTAA
TTTTTTTTCTATAAGTGGAATTGTAATAAATAAAATGTTTAATTGCTTTA
AAA
back to top

protein sequence of SMED30013416-orf-1

>SMED30013416-orf-1 ID=SMED30013416-orf-1|Name=SMED30013416-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=756bp
METRGKSNVYLLGSAESDILGAKLPSHLQTFGYFMHLHKVENLTVRDSSR
QTIEKVFGFWHKAGIPVRAAKHCIDKLEAFFAEWKGLQKHKNRITDGHKM
KEDEFTSRLDNLFDIAHLDALTLITIPEDRAFFLSQRQEGRPGSIGAVDK
VEELKTRHRQDQKKAELKRKKRSQEEIEAYSSQAALKTALSSDDDAVDEY
DDDEYFDKSKTCSRSDEVCVGPKRAKINVLSPGLTSALDRTKISSQNATF
VLSEVASSLGHDVNTLNINRSSIHRARASHRAARSSCLRSEFSTTVPLTV
HWDGKLMEDLSTLEHVDRLPVLISGVGVEQLLGVPKLSAGTGEAQASAVV
QCLEEWGLAEQVAAVCFDTTASNTGHRSGTCSLIEHKLNKDLLYLACRHH
IMELIVGAAFETTSVGTSSGPEIQIFKRFRDYWQFIDRDGFQVASSDPSV
ELLVAPYRSDILSFARTYLQAEHPRDDYREFLELAVIFLGDVPDRGIRFQ
VPGAMHWARWMAKVIYSIKMFLFRSQFKMTASEERGICDVATFSVVIHLK
AWMTAPLAVEAPLNDFTLMGQLRSYPHAAISAATSKKLGLHMWYLSEELI
GLALFDSRLSHDSKRLMIAAMDEEAPDHPSKRPSIKSDAFLGKRGLEQFC
TVNSKKLFQLLDLPITLVNKDPSDWEQDESYTRALGIVKSLAVVNDRAER
GVALIQDFNKKLTKNEDQLQFLLQIVNEHRRQFPDCTKRNLATCANGQQS
DTVKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005788endoplasmic reticulum lumen
GO:0005576extracellular region
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016529sarcoplasmic reticulum
GO:0033018sarcoplasmic reticulum lumen
GO:0042470melanosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000142posterior region of the whole animal
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR46113FAMILY NOT NAMEDcoord: 60..434