Pre-mRNA-splicing factor 38B

Overview
NamePre-mRNA-splicing factor 38B
Smed IDSMED30013398
Length (bp)1071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA-splicing factor 38B (SMED30013398) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA-splicing factor 38B (SMED30013398) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA-splicing factor 38B (SMED30013398) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA-splicing factor 38B (SMED30013398) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013398

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013398SMESG000037911.1 SmedASXL_010280SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013398SMESG000037911.1 SmedASXL_010280SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30013398SMESG000037911.1 dd_Smed_v4_1839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013398SMESG000037911.1 dd_Smed_v4_1839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013398SMESG000037911.1 dd_Smed_v4_1839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013398SMESG000037911.1 dd_Smed_v4_1839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013398SMESG000037911.1 Contig40021uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013398SMESG000037911.1 Contig40021newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Human
Match: PRPF38B (pre-mRNA processing factor 38B [Source:HGNC Symbol;Acc:HGNC:25512])

HSP 1 Score: 275.789 bits (704), Expect = 8.485e-88
Identity = 141/204 (69.12%), Postives = 172/204 (84.31%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEA 740
            K+GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W WF  +LDDEE+LD KAGGGC MTIGEM+   LTKL+WFSTLFPRIPVP+QK I++++K  R +K+K + 
Sbjct:   42 KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRIPVPVQKNIDQQIK-TRPRKIKKDG 244          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Human
Match: PRPF38B (pre-mRNA processing factor 38B [Source:HGNC Symbol;Acc:HGNC:25512])

HSP 1 Score: 191.43 bits (485), Expect = 1.791e-59
Identity = 104/145 (71.72%), Postives = 124/145 (85.52%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEE 563
            K+GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W WF  +LDDEE
Sbjct:   42 KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFESFLDDEE 186          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Human
Match: PRPF38B (pre-mRNA processing factor 38B [Source:HGNC Symbol;Acc:HGNC:25512])

HSP 1 Score: 186.037 bits (471), Expect = 2.258e-54
Identity = 80/120 (66.67%), Postives = 98/120 (81.67%), Query Frame = 3
Query:  381 STPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEA 740
            ST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W WF  +LDDEE+LD KAGGGC MTIGEM+   LTKL+WFSTLFPRIPVP+QK I++++K  R +K+K + 
Sbjct:   15 STAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRIPVPVQKNIDQQIK-TRPRKIKKDG 133          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Celegans
Match: Y108G3AL.2 (pep chromosome:WBcel235:V:166989:176823:1 gene:WBGene00022434.1 transcript:Y108G3AL.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y108G3AL.2)

HSP 1 Score: 216.853 bits (551), Expect = 6.949e-68
Identity = 112/205 (54.63%), Postives = 155/205 (75.61%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEAE 743
            K+ N + VWGNK +MNLN+++L NI +S YYKN L E+  +  +I++I+Y+VKHLEPWEKG+R++ G TGMCGGVRGVGAGG+VS+ +C+LY+LF LK++R QL  M++   S YIR LGFMYIR+  PP + W W   YLDD+ E+D ++GGG  MT G++V  ++ KLDW+ TLFPRIPVPIQK I+E+  + + ++L  E E
Sbjct:   50 KRSNTLPVWGNKVTMNLNTLVLENIRESYYYKNNLVEIDNFQTLIEQIFYQVKHLEPWEKGTRRLQGMTGMCGGVRGVGAGGVVSSAYCLLYRLFNLKISRKQLISMLNSRQSVYIRGLGFMYIRYTQPPADLWYWLEPYLDDDREIDPRSGGGDLMTFGQLVRTMINKLDWYGTLFPRIPVPIQKDIDEKFSERKKQQLLEEEE 254          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Fly
Match: CG1622 (gene:FBgn0030468 transcript:FBtr0073757)

HSP 1 Score: 246.899 bits (629), Expect = 1.609e-78
Identity = 130/210 (61.90%), Postives = 166/210 (79.05%), Query Frame = 3
Query:   93 EFEEEDPEGGPYKKG---NIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDY 713
            ++      GG  K G   N +  WGN+ SMNLN++IL NI  S Y+K  L +L TY+EV+DEIYY+VKH+EPWE+GSRK  GQTGMCGGVRGVGAGGIVST +C+LYKL+TL+LTR Q+ G+++H+DS YIRALGFMY+R+  PP + + W+  YL DEEE+D KAGGG  +TIG+MV + +TKLDWFSTLFPRIPVPIQK+IE+R++ Y
Sbjct:    4 DYSASSSAGGGKKAGKQHNTLPFWGNESSMNLNALILANIQSSSYFKVHLFKLKTYHEVVDEIYYQVKHMEPWERGSRKTSGQTGMCGGVRGVGAGGIVSTAYCLLYKLYTLRLTRKQINGLLNHTDSAYIRALGFMYLRYTQPPGDLYDWYEDYLQDEEEIDVKAGGGQVLTIGQMVYQFMTKLDWFSTLFPRIPVPIQKQIEKRIEQY 213          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Fly
Match: CG1622 (gene:FBgn0030468 transcript:FBtr0310465)

HSP 1 Score: 184.496 bits (467), Expect = 3.669e-57
Identity = 102/170 (60.00%), Postives = 131/170 (77.06%), Query Frame = 3
Query:   90 KEFEEEDPEGGPYKKG---NIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGG 590
            +++      GG  K G   N +  WGN+ SMNLN++IL NI  S Y+K  L +L TY+EV+DEIYY+VKH+EPWE+GSRK  GQTGMCGGVRGVGAGGIVST +C+LYKL+TL+LTR Q+ G+++H+DS YIRALGFMY+R+  PP + + W+  YL DEEE+D KAGGG
Sbjct:    3 EDYSASSSAGGGKKAGKQHNTLPFWGNESSMNLNALILANIQSSSYFKVHLFKLKTYHEVVDEIYYQVKHMEPWERGSRKTSGQTGMCGGVRGVGAGGIVSTAYCLLYKLYTLRLTRKQINGLLNHTDSAYIRALGFMYLRYTQPPGDLYDWYEDYLQDEEEIDVKAGGG 172          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Fly
Match: CG1622 (gene:FBgn0030468 transcript:FBtr0339945)

HSP 1 Score: 139.813 bits (351), Expect = 1.994e-40
Identity = 83/135 (61.48%), Postives = 105/135 (77.78%), Query Frame = 3
Query:   93 EFEEEDPEGGPYKKG---NIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALG 488
            ++      GG  K G   N +  WGN+ SMNLN++IL NI  S Y+K  L +L TY+EV+DEIYY+VKH+EPWE+GSRK  GQTGMCGGVRGVGAGGIVST +C+LYKL+TL+LTR Q+ G+++H+DS YIRALG
Sbjct:    4 DYSASSSAGGGKKAGKQHNTLPFWGNESSMNLNALILANIQSSSYFKVHLFKLKTYHEVVDEIYYQVKHMEPWERGSRKTSGQTGMCGGVRGVGAGGIVSTAYCLLYKLYTLRLTRKQINGLLNHTDSAYIRALG 138          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Zebrafish
Match: prpf38b (pre-mRNA processing factor 38B [Source:NCBI gene;Acc:406810])

HSP 1 Score: 271.166 bits (692), Expect = 1.294e-86
Identity = 140/199 (70.35%), Postives = 165/199 (82.91%), Query Frame = 3
Query:  111 PEGGPYKKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMK 707
            P GG  K GN + +WGN+++MNLN MILTN+L SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I HSDSPYIRALGFMYIR+  PP +   W+  +LDDEEELD KAGGGC MT+GEM+   LTKL+WFSTLFPRIPVP+QK I++ MK
Sbjct:   16 PTGG--KHGNNLPLWGNEKTMNLNPMILTNVLSSPYFKVQLYELKTYHEVVDEIYFKVNHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHSDSPYIRALGFMYIRYTQPPPDLVDWYDEFLDDEEELDVKAGGGCVMTVGEMLRSFLTKLEWFSTLFPRIPVPVQKAIDQHMK 212          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Zebrafish
Match: prpf38b (pre-mRNA processing factor 38B [Source:NCBI gene;Acc:406810])

HSP 1 Score: 184.496 bits (467), Expect = 4.159e-57
Identity = 105/151 (69.54%), Postives = 124/151 (82.12%), Query Frame = 3
Query:  111 PEGGPYKKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEE 563
            P GG  K GN + +WGN+++MNLN MILTN+L SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I HSDSPYIRALGFMYIR+  PP +   W+  +LDDEE
Sbjct:   16 PTGG--KHGNNLPLWGNEKTMNLNPMILTNVLSSPYFKVQLYELKTYHEVVDEIYFKVNHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHSDSPYIRALGFMYIRYTQPPPDLVDWYDEFLDDEE 164          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Xenopus
Match: ENSXETT00000026836.1 (pre-mRNA processing factor 38B [Source:NCBI gene;Acc:100170167])

HSP 1 Score: 273.478 bits (698), Expect = 2.305e-87
Identity = 138/193 (71.50%), Postives = 165/193 (85.49%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMK 707
            K GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W W+  +LDDEEELD KAGGGC MTIGEM+   LTKL+WFSTLFPRIPVP+QK I++++K
Sbjct:   30 KSGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPADLWDWYEDFLDDEEELDVKAGGGCIMTIGEMLRSYLTKLEWFSTLFPRIPVPVQKHIDQQIK 222          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Xenopus
Match: ENSXETT00000038745.1 (pre-mRNA processing factor 38B [Source:NCBI gene;Acc:100170167])

HSP 1 Score: 189.504 bits (480), Expect = 6.226e-59
Identity = 103/145 (71.03%), Postives = 123/145 (84.83%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEE 563
            K GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W W+  +LDDEE
Sbjct:   29 KSGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPADLWDWYEDFLDDEE 173          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Mouse
Match: Prpf38b (PRP38 pre-mRNA processing factor 38 (yeast) domain containing B [Source:MGI Symbol;Acc:MGI:1914171])

HSP 1 Score: 276.174 bits (705), Expect = 3.934e-88
Identity = 141/205 (68.78%), Postives = 173/205 (84.39%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEAE 743
            K+GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W WF  +LDDEE+LD KAGGGC MTIGEM+   LTKL+WFSTLFPRIPVP+QK I++++K  R +K+K + +
Sbjct:   43 KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRIPVPVQKNIDQQIK-TRPRKIKKDGK 246          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Mouse
Match: Prpf38b (PRP38 pre-mRNA processing factor 38 (yeast) domain containing B [Source:MGI Symbol;Acc:MGI:1914171])

HSP 1 Score: 101.679 bits (252), Expect = 2.250e-27
Identity = 44/64 (68.75%), Postives = 57/64 (89.06%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRK 320
            K+GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK
Sbjct:   43 KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRK 106          

HSP 2 Score: 40.4318 bits (93), Expect = 2.250e-27
Identity = 25/66 (37.88%), Postives = 37/66 (56.06%), Query Frame = 2
Query:  341 VWRSAWRWCRWNCFNPILHIV*IIHFKAYKKSITGDDRSFRFTIYPCIRIYVYQICVTA*RILGLV 538
            V RS+  W R +CF  IL  + II+ +   K+  G   ++R +IY    IYVY++  T  R +GLV
Sbjct:  117 VSRSSRCWNRRHCFYSILPSIQIIYPEVNSKASDGSHNTYRLSIYQSPWIYVYKVYPTPYRPVGLV 182          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Mouse
Match: Prpf38b (PRP38 pre-mRNA processing factor 38 (yeast) domain containing B [Source:MGI Symbol;Acc:MGI:1914171])

HSP 1 Score: 77.411 bits (189), Expect = 2.514e-17
Identity = 33/51 (64.71%), Postives = 45/51 (88.24%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYR 281
            K+GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++
Sbjct:   43 KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFK 93          
BLAST of Pre-mRNA-splicing factor 38B vs. UniProt/SwissProt
Match: sp|Q6AXY7|PR38B_RAT (Pre-mRNA-splicing factor 38B OS=Rattus norvegicus OX=10116 GN=Prpf38b PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 2.608e-87
Identity = 141/205 (68.78%), Postives = 173/205 (84.39%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEAE 743
            K+GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W WF  +LDDEE+LD KAGGGC MTIGEM+   LTKL+WFSTLFPRIPVP+QK I++++K  R +K+K + +
Sbjct:   42 KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRIPVPVQKNIDQQIK-TRPRKIKKDGK 245          
BLAST of Pre-mRNA-splicing factor 38B vs. UniProt/SwissProt
Match: sp|Q80SY5|PR38B_MOUSE (Pre-mRNA-splicing factor 38B OS=Mus musculus OX=10090 GN=Prpf38b PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 2.752e-87
Identity = 141/205 (68.78%), Postives = 173/205 (84.39%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEAE 743
            K+GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W WF  +LDDEE+LD KAGGGC MTIGEM+   LTKL+WFSTLFPRIPVP+QK I++++K  R +K+K + +
Sbjct:   43 KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRIPVPVQKNIDQQIK-TRPRKIKKDGK 246          
BLAST of Pre-mRNA-splicing factor 38B vs. UniProt/SwissProt
Match: sp|Q5VTL8|PR38B_HUMAN (Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 4.075e-87
Identity = 141/204 (69.12%), Postives = 172/204 (84.31%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEA 740
            K+GN++ +WGN+++MNLN MILTNIL SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP + W WF  +LDDEE+LD KAGGGC MTIGEM+   LTKL+WFSTLFPRIPVP+QK I++++K  R +K+K + 
Sbjct:   42 KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRIPVPVQKNIDQQIK-TRPRKIKKDG 244          
BLAST of Pre-mRNA-splicing factor 38B vs. UniProt/SwissProt
Match: sp|Q6P7Y3|PR38B_DANRE (Pre-mRNA-splicing factor 38B OS=Danio rerio OX=7955 GN=prpf38b PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 2.348e-84
Identity = 139/199 (69.85%), Postives = 164/199 (82.41%), Query Frame = 3
Query:  111 PEGGPYKKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMK 707
            P GG  K GN + +WGN+++MNLN MILTN+L SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I HSDSP IRALGFMYIR+  PP +   W+  +LDDEEELD KAGGGC MT+GEM+   LTKL+WFSTLFPRIPVP+QK I++ MK
Sbjct:   16 PTGG--KHGNNLPLWGNEKTMNLNPMILTNVLSSPYFKVQLYELKTYHEVVDEIYFKVNHVEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHSDSPDIRALGFMYIRYTQPPPDLVDWYDEFLDDEEELDVKAGGGCVMTVGEMLRSFLTKLEWFSTLFPRIPVPVQKAIDQHMK 212          
BLAST of Pre-mRNA-splicing factor 38B vs. UniProt/SwissProt
Match: sp|Q8RWB1|SRL1_ARATH (Pre-mRNA splicing factor SR-like 1 OS=Arabidopsis thaliana OX=3702 GN=SRL1 PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 8.763e-39
Identity = 74/172 (43.02%), Postives = 104/172 (60.47%), Query Frame = 3
Query:  177 LNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKI 692
            L  ++  NIL S Y+K +L  L TY+EVIDEIY +V H+EPW  G+ +                    ST +C+LYK FT+KLT  Q+ G++ H+DSPYIRA+GF+Y+R+    +  W W+  Y+ D+EE    + G  T T+G  V  LL  L +F TLFPRIPVP+ ++I
Sbjct:   15 LEKVLSMNILSSDYFK-ELYGLKTYHEVIDEIYNQVNHVEPWMGGNCR------------------GPSTAYCLLYKFFTMKLTVKQMHGLLKHTDSPYIRAVGFLYLRYVADAKTLWTWYEPYIKDDEEFSPGSNGRMT-TMGVYVRDLLLGLYYFDTLFPRIPVPVMRQI 166          
BLAST of Pre-mRNA-splicing factor 38B vs. TrEMBL
Match: A0A5J4P3J4 (Pre-mRNA-splicing factor 38B OS=Paragonimus westermani OX=34504 GN=DEA37_0003479 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 4.032e-94
Identity = 153/208 (73.56%), Postives = 183/208 (87.98%), Query Frame = 3
Query:  105 EDPEGGPYKKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKL 728
            +D E     +GNI+K+WGN+++MNLN+MI TNI+QSPY+K  L EL TY+EVIDEIYY+V+HLEPWE+GSRKIGGQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR QL+G++DH DSPYIRALGFMYIR+ L PE+FW W+S YLDD+EELD KAGGGCTMTIG M+E  LTKLDWFSTLFPRIPVP+QKK+EE+++  R++KL
Sbjct:   16 DDDEEDQTPRGNILKLWGNQQTMNLNTMIYTNIVQSPYFKTNLIELKTYHEVIDEIYYKVEHLEPWERGSRKIGGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQLKGLLDHPDSPYIRALGFMYIRYCLSPEDFWWWYSPYLDDQEELDVKAGGGCTMTIGAMLESWLTKLDWFSTLFPRIPVPVQKKLEEKLRIRRSQKL 223          
BLAST of Pre-mRNA-splicing factor 38B vs. TrEMBL
Match: A0A183N3X9 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS23004 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 9.300e-91
Identity = 153/225 (68.00%), Postives = 187/225 (83.11%), Query Frame = 3
Query:  132 KGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKL-----KNEAESKMVKEMLNSEGNENE 791
            +GNI+K+WGN ++MNLN+MI TNI QSPY+K  L EL TY+EVIDEIYY+V+HLEPWE+GSR+IGGQTGMCGGVRGVGAGGIVST +C+LYKLFTLKLTR QL+G++DH DSPYIRALGFMYIR+ +PPE+FW W+S YL D EELD KAGGGC MTIG M+E  LTKLDWFSTLFPRIPVP+QKK+EE+M+  + + L       E ESK + +  N +G+ ++
Sbjct:   22 RGNILKLWGNPQTMNLNTMIYTNIAQSPYFKANLVELKTYHEVIDEIYYKVEHLEPWERGSRRIGGQTGMCGGVRGVGAGGIVSTAYCLLYKLFTLKLTRKQLKGLLDHPDSPYIRALGFMYIRYCIPPEDFWWWYSPYLSDPEELDVKAGGGCVMTIGNMLEHWLTKLDWFSTLFPRIPVPVQKKLEEKMRLRKCQALLEVGSVQEKESKRLSDR-NRDGSHHK 245          
BLAST of Pre-mRNA-splicing factor 38B vs. TrEMBL
Match: A0A504Y713 (PRP38 pre-mRNA processing factor 38 domain containing B OS=Fasciola gigantica OX=46835 GN=FGIG_04959 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.285e-90
Identity = 145/205 (70.73%), Postives = 180/205 (87.80%), Query Frame = 3
Query:  132 KGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEAES 746
            +GNI+K+WGN+++MNLN+M+ TN+ QSPY+K  L EL TY+EVIDEIYY+V+HLEPWE+GSRKIGGQTGMCGGVRGVGAGGIVST +C+LYKLFTLKLTR QL+G++DH DSPYIRALGFMYIR+ LPP++FW W+S YLDD EELD KAGGGCTMTIG M+E  +TKLDWF+TLFPRIPVP+QKK++E+++  R + +   A +
Sbjct:   28 RGNILKLWGNQQTMNLNAMVYTNVTQSPYFKANLIELKTYHEVIDEIYYKVEHLEPWERGSRKIGGQTGMCGGVRGVGAGGIVSTAYCLLYKLFTLKLTRKQLKGLLDHPDSPYIRALGFMYIRYCLPPDDFWWWYSPYLDDPEELDVKAGGGCTMTIGSMLEHWITKLDWFTTLFPRIPVPVQKKLDEKLRLRRCQVMLQNAPA 232          
BLAST of Pre-mRNA-splicing factor 38B vs. TrEMBL
Match: A0A430QNC3 (Pre-mRNA-splicing factor 38B OS=Schistosoma bovis OX=6184 GN=DC041_0008519 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 4.331e-90
Identity = 153/225 (68.00%), Postives = 187/225 (83.11%), Query Frame = 3
Query:  132 KGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKL-----KNEAESKMVKEMLNSEGNENE 791
            +GNI+K+WGN ++MNLN+MI TNI QSPY+K  L EL TY+EVIDEIYY+V+HLEPWE+GSR+IGGQTGMCGGVRGVGAGGIVST +C+LYKLFTLKLTR QL+G++DH DSPYIRALGFMYIR+ +PPE+FW W+S YL D EELD KAGGGC MTIG M+E  LTKLDWFSTLFPRIPVP+QKK+EE+M+  + + L       E ESK + +  N +G+ ++
Sbjct:   22 RGNILKLWGNPQTMNLNTMIYTNIAQSPYFKANLVELKTYHEVIDEIYYKVEHLEPWERGSRRIGGQTGMCGGVRGVGAGGIVSTAYCLLYKLFTLKLTRKQLKGLLDHPDSPYIRALGFMYIRYCIPPEDFWWWYSPYLSDSEELDVKAGGGCIMTIGNMLEHWLTKLDWFSTLFPRIPVPVQKKLEEKMRLRKCQALLEVGSVQEKESKRLSDR-NRDGSHHK 245          
BLAST of Pre-mRNA-splicing factor 38B vs. TrEMBL
Match: A0A183KSQ5 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS18092 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 4.331e-90
Identity = 153/225 (68.00%), Postives = 187/225 (83.11%), Query Frame = 3
Query:  132 KGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKL-----KNEAESKMVKEMLNSEGNENE 791
            +GNI+K+WGN ++MNLN+MI TNI QSPY+K  L EL TY+EVIDEIYY+V+HLEPWE+GSR+IGGQTGMCGGVRGVGAGGIVST +C+LYKLFTLKLTR QL+G++DH DSPYIRALGFMYIR+ +PPE+FW W+S YL D EELD KAGGGC MTIG M+E  LTKLDWFSTLFPRIPVP+QKK+EE+M+  + + L       E ESK + +  N +G+ ++
Sbjct:   22 RGNILKLWGNPQTMNLNTMIYTNIAQSPYFKANLVELKTYHEVIDEIYYKVEHLEPWERGSRRIGGQTGMCGGVRGVGAGGIVSTAYCLLYKLFTLKLTRKQLKGLLDHPDSPYIRALGFMYIRYCIPPEDFWWWYSPYLSDSEELDVKAGGGCIMTIGNMLEHWLTKLDWFSTLFPRIPVPVQKKLEEKMRLRKCQALLEVGSVQEKESKRLSDR-NRDGSHHK 245          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Cavefish
Match: ENSAMXT00000032694.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000053.1:614618:625070:-1 gene:ENSAMXG00000039494.1 transcript:ENSAMXT00000032694.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 267.7 bits (683), Expect = 1.316e-84
Identity = 139/200 (69.50%), Postives = 166/200 (83.00%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKL 728
            K GN++ +WGN+++MNLN MILTN+L SPY+K QL EL TY+EV+DEIY++V H EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP +   W+  +LDDEEELD KAGGGC MT+GEM+   LTKL+WFSTLFPRIPVP+QK I++ MK  R +KL
Sbjct:   19 KHGNVLPLWGNEKTMNLNPMILTNVLSSPYFKVQLYELKTYHEVVDEIYFKVTHAEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPADLIEWYEPFLDDEEELDVKAGGGCVMTVGEMLRSFLTKLEWFSTLFPRIPVPVQKMIDQHMKS-RPRKL 217          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Cavefish
Match: ENSAMXT00000034023.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000053.1:614711:625070:-1 gene:ENSAMXG00000039494.1 transcript:ENSAMXT00000034023.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 267.7 bits (683), Expect = 2.020e-84
Identity = 139/200 (69.50%), Postives = 166/200 (83.00%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKL 728
            K GN++ +WGN+++MNLN MILTN+L SPY+K QL EL TY+EV+DEIY++V H EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR Q+ G+I H+DSPYIRALGFMYIR+  PP +   W+  +LDDEEELD KAGGGC MT+GEM+   LTKL+WFSTLFPRIPVP+QK I++ MK  R +KL
Sbjct:   19 KHGNVLPLWGNEKTMNLNPMILTNVLSSPYFKVQLYELKTYHEVVDEIYFKVTHAEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYIRYTQPPADLIEWYEPFLDDEEELDVKAGGGCVMTVGEMLRSFLTKLEWFSTLFPRIPVPVQKMIDQHMKS-RPRKL 217          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007907.1 (pep scaffold:Pmarinus_7.0:GL488187:608:5995:1 gene:ENSPMAG00000007150.1 transcript:ENSPMAT00000007907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.147 bits (396), Expect = 1.760e-47
Identity = 93/128 (72.66%), Postives = 107/128 (83.59%), Query Frame = 3
Query:  123 PYKKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRF 506
            P   GN + +WGN+++MN+N +ILTNI  SPY+K +L EL TY+EV DEIYY+V HLEPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR QL G+I HSDSPYIR LGFMYIR+
Sbjct:   30 PGAGGNALPLWGNEKTMNMNPLILTNIQASPYFKVELYELKTYHEV-DEIYYKVSHLEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQLNGLITHSDSPYIRGLGFMYIRY 156          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Nematostella
Match: EDO47248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN21])

HSP 1 Score: 257.299 bits (656), Expect = 1.017e-82
Identity = 145/246 (58.94%), Postives = 183/246 (74.39%), Query Frame = 3
Query:   84 ESKEFEEEDPEGGPYKKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQ-----KKIEERMKDYRAKKLKNEAESKMVKEMLNSEGNENEGIPNS 806
            E+++FE + P     KK N + +WG++ +MN+N+MILTNILQSPY+KN+L +L TY+EV+DEIYY+V HLEPWEKGSRK  GQ GMCGGVRGVGAGGIVST +C+LYKLFTL+LTR QL G++ H+DSPYIRALGFMYIR+  PP + W W+  YL+DEEE+D KAG GCTMT+G++V   L KL+W+ TLFPRIPVPIQ     K  E+ + D   KK     E+   + +   EG E EG  NS
Sbjct:    2 EAEDFESKQPT----KKQNTLPLWGSERTMNMNNMILTNILQSPYFKNELYQLKTYHEVVDEIYYKVDHLEPWEKGSRKTSGQVGMCGGVRGVGAGGIVSTAYCLLYKLFTLRLTRKQLNGLLTHTDSPYIRALGFMYIRYCQPPADLWEWYEPYLEDEEEVDPKAGTGCTMTMGQLVRSFLLKLEWYGTLFPRIPVPIQKDLEKKLKEKNLCDDHKKKADGTWEATQERYLSLGEG-EAEGKANS 242          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Medaka
Match: ENSORLT00000019556.2 (pre-mRNA processing factor 38B [Source:NCBI gene;Acc:101166664])

HSP 1 Score: 267.7 bits (683), Expect = 5.894e-86
Identity = 136/193 (70.47%), Postives = 163/193 (84.46%), Query Frame = 3
Query:  129 KKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMK 707
            K GN++ +WGN+++MNLN MILTN+L SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR QL G+I H+DSPYIRALGFMYIR+  PP +   W+  +LDDEE+LD KAGGGC MTIGEM+   LTKL+WFSTLFPRIPVP+QK I++ +K
Sbjct:   20 KHGNVLPLWGNEKTMNLNPMILTNVLSSPYFKVQLYELKTYHEVVDEIYFKVTHIEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQLMGLITHTDSPYIRALGFMYIRYTQPPTDLLDWYDGFLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRIPVPVQKMIDQNLK 212          
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Medaka
Match: ENSORLT00000032966.1 (pre-mRNA processing factor 38B [Source:NCBI gene;Acc:101166664])

HSP 1 Score: 186.808 bits (473), Expect = 3.595e-58
Identity = 107/166 (64.46%), Postives = 129/166 (77.71%), Query Frame = 3
Query:   66 MALMQNESKEFEEEDPEGGPYKKGNIIKVWGNKESMNLNSMILTNILQSPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIXXXXXXXXXXXXXXXXXXXSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEE 563
            MA + N+        P  G  K GN++ +WGN+++MNLN MILTN+L SPY+K QL EL TY+EV+DEIY++V H+EPWEKGSRK  GQTGMCGGVRGVG GGIVST FC+LYKLFTLKLTR QL G+I H+DSPYIRALGFMYIR+  PP +   W+  +LDDEE
Sbjct:    1 MANVGNQLPTQAVSKPPSG--KHGNVLPLWGNEKTMNLNPMILTNVLSSPYFKVQLYELKTYHEVVDEIYFKVTHIEPWEKGSRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQLMGLITHTDSPYIRALGFMYIRYTQPPTDLLDWYDGFLDDEE 164          
BLAST of Pre-mRNA-splicing factor 38B vs. Planmine SMEST
Match: SMESG000037911.1 (SMESG000037911.1)

HSP 1 Score: 278.87 bits (712), Expect = 2.204e-93
Identity = 132/141 (93.62%), Postives = 136/141 (96.45%), Query Frame = 3
Query:  393 CILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEAESKMVKEMLNSEGNENEGIPNSSES 815
            C+   +  ++LTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEAESKMVKEMLNSEGNENEGIPNSSES
Sbjct:   26 CVEECVALVQLTRSQLRGMIDHSDSPYIRALGFMYIRFALPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLFPRIPVPIQKKIEERMKDYRAKKLKNEAESKMVKEMLNSEGNENEGIPNSSES 166          

HSP 2 Score: 71.633 bits (174), Expect = 3.376e-14
Identity = 35/36 (97.22%), Postives = 36/36 (100.00%), Query Frame = 1
Query:  265 MRYIIESSILSHGKRVVEKLAVKQVCVEECVALVQV 372
            MRYIIESSILSHGKRVVEKLAVKQVCVEECVALVQ+
Sbjct:    1 MRYIIESSILSHGKRVVEKLAVKQVCVEECVALVQL 36          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PRPF38B8.485e-8869.12pre-mRNA processing factor 38B [Source:HGNC Symbol... [more]
PRPF38B1.791e-5971.72pre-mRNA processing factor 38B [Source:HGNC Symbol... [more]
PRPF38B2.258e-5466.67pre-mRNA processing factor 38B [Source:HGNC Symbol... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y108G3AL.26.949e-6854.63pep chromosome:WBcel235:V:166989:176823:1 gene:WBG... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG16221.609e-7861.90gene:FBgn0030468 transcript:FBtr0073757[more]
CG16223.669e-5760.00gene:FBgn0030468 transcript:FBtr0310465[more]
CG16221.994e-4061.48gene:FBgn0030468 transcript:FBtr0339945[more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prpf38b1.294e-8670.35pre-mRNA processing factor 38B [Source:NCBI gene;A... [more]
prpf38b4.159e-5769.54pre-mRNA processing factor 38B [Source:NCBI gene;A... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000026836.12.305e-8771.50pre-mRNA processing factor 38B [Source:NCBI gene;A... [more]
ENSXETT00000038745.16.226e-5971.03pre-mRNA processing factor 38B [Source:NCBI gene;A... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Prpf38b3.934e-8868.78PRP38 pre-mRNA processing factor 38 (yeast) domain... [more]
Prpf38b2.250e-2768.75PRP38 pre-mRNA processing factor 38 (yeast) domain... [more]
Prpf38b2.514e-1764.71PRP38 pre-mRNA processing factor 38 (yeast) domain... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AXY7|PR38B_RAT2.608e-8768.78Pre-mRNA-splicing factor 38B OS=Rattus norvegicus ... [more]
sp|Q80SY5|PR38B_MOUSE2.752e-8768.78Pre-mRNA-splicing factor 38B OS=Mus musculus OX=10... [more]
sp|Q5VTL8|PR38B_HUMAN4.075e-8769.12Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=96... [more]
sp|Q6P7Y3|PR38B_DANRE2.348e-8469.85Pre-mRNA-splicing factor 38B OS=Danio rerio OX=795... [more]
sp|Q8RWB1|SRL1_ARATH8.763e-3943.02Pre-mRNA splicing factor SR-like 1 OS=Arabidopsis ... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P3J44.032e-9473.56Pre-mRNA-splicing factor 38B OS=Paragonimus wester... [more]
A0A183N3X99.300e-9168.00Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A504Y7131.285e-9070.73PRP38 pre-mRNA processing factor 38 domain contain... [more]
A0A430QNC34.331e-9068.00Pre-mRNA-splicing factor 38B OS=Schistosoma bovis ... [more]
A0A183KSQ54.331e-9068.00Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000032694.11.316e-8469.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000034023.12.020e-8469.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007907.11.760e-4772.66pep scaffold:Pmarinus_7.0:GL488187:608:5995:1 gene... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO472481.017e-8258.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000019556.25.894e-8670.47pre-mRNA processing factor 38B [Source:NCBI gene;A... [more]
ENSORLT00000032966.13.595e-5864.46pre-mRNA processing factor 38B [Source:NCBI gene;A... [more]
back to top
BLAST of Pre-mRNA-splicing factor 38B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037911.12.204e-9393.62SMESG000037911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013398 ID=SMED30013398|Name=Pre-mRNA-splicing factor 38B|organism=Schmidtea mediterranea sexual|type=transcript|length=1071bp
TTGAATATTTCTTATTTATTTAACAAAATGTCGTAATTTTTTTAATATAA
AATATCATAATGGAAATGGCTTTAATGCAAAACGAATCAAAAGAATTCGA
GGAAGAAGATCCAGAAGGAGGACCCTATAAAAAAGGAAATATAATTAAAG
TTTGGGGTAATAAAGAATCGATGAATTTGAATAGCATGATTTTGACAAAT
ATTTTGCAATCACCGTATTATAAAAATCAGCTGTCTGAACTAACTACTTA
TTATGAAGTTATAGATGAGATATATTATAGAGTCAAGCATCTTGAGCCAT
GGGAAAAGGGTAGTAGAAAAATTGGCGGTCAAACAGGTATGTGTGGAGGA
GTGCGTGGCGTTGGTGCAGGTGGAATTGTTTCAACCCCATTTTGCATATT
GTATAAATTATTCACTTTAAAGCTTACAAGAAGTCAATTACGGGGGATGA
TAGATCATTCAGATTCACCATATATCCGTGCATTAGGATTTATGTATATC
AGATTTGCGTTACCGCCTGAAGAATTTTGGGCCTGGTTCTCTATTTATCT
CGACGATGAAGAAGAATTGGACGCCAAGGCCGGTGGTGGATGTACAATGA
CGATCGGGGAAATGGTTGAGCGTCTACTGACAAAGCTAGACTGGTTTTCA
ACGCTTTTCCCCAGAATTCCGGTACCTATTCAGAAAAAAATCGAGGAGAG
AATGAAGGATTATCGGGCTAAAAAATTGAAAAATGAGGCTGAATCTAAAA
TGGTGAAAGAGATGCTGAACAGTGAAGGAAATGAAAACGAAGGGATTCCC
AATAGTAGCGAGTCTAAGGAAGTCGAGAGGGAGGATAAGCACAGGCGACA
TAGAGATGAGCCAGATAGGCGTCACAGGAAAAGATCCAAGTCGAGGAGCC
GCAGTTCGCATCATCGAAGTTCTCGACACAGTACCAAGAGTCACAAAAGT
CATAAAAAACACAAAAAGCACAAGCGAAATCATGATCATCACCGACAATC
GCAAAGTAAAGATTGAAATTACTGCTATTGAAAAGTTTATTGTTAATAAA
ATGTTTCGTATTTAAAAAAAA
back to top

protein sequence of SMED30013398-orf-1

>SMED30013398-orf-1 ID=SMED30013398-orf-1|Name=SMED30013398-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=319bp
MEMALMQNESKEFEEEDPEGGPYKKGNIIKVWGNKESMNLNSMILTNILQ
SPYYKNQLSELTTYYEVIDEIYYRVKHLEPWEKGSRKIGGQTGMCGGVRG
VGAGGIVSTPFCILYKLFTLKLTRSQLRGMIDHSDSPYIRALGFMYIRFA
LPPEEFWAWFSIYLDDEEELDAKAGGGCTMTIGEMVERLLTKLDWFSTLF
PRIPVPIQKKIEERMKDYRAKKLKNEAESKMVKEMLNSEGNENEGIPNSS
ESKEVEREDKHRRHRDEPDRRHRKRSKSRSRSSHHRSSRHSTKSHKSHKK
HKKHKRNHDHHRQSQSKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR005037PRP38
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0071011precatalytic spliceosome
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0008380RNA splicing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 208..228
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 235..318
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 266..312
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 249..265
NoneNo IPR availablePANTHERPTHR23142:SF2PRE-MRNA-SPLICING FACTOR 38Bcoord: 23..316
IPR005037Pre-mRNA-splicing factor 38PFAMPF03371PRP38coord: 30..212
e-value: 1.2E-56
score: 191.3
IPR005037Pre-mRNA-splicing factor 38PANTHERPTHR23142UNCHARACTERIZEDcoord: 23..316