perilipin-2 isoform X1

Overview
Nameperilipin-2 isoform X1
Smed IDSMED30013396
Length (bp)1413
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of perilipin-2 isoform X1 (SMED30013396) t-SNE clustered cells

Violin plots show distribution of expression levels for perilipin-2 isoform X1 (SMED30013396) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of perilipin-2 isoform X1 (SMED30013396) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for perilipin-2 isoform X1 (SMED30013396) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013396

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013396SMESG000067325.1 SMESG000028715.1 Contig1083GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013396SMESG000075481.1 Contig1083GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30013396SMESG000075481.1 dd_Smed_v4_154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013396SMESG000075481.1 dd_Smed_v4_154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013396SMESG000075481.1 dd_Smed_v4_154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013396SMESG000075481.1 dd_Smed_v4_154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013396SMESG000075481.1 Contig48792uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013396SMESG000075481.1 Contig48792newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30013396SMESG000075481.1 dd_Smed_v6_154_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30013396SMESG000075481.1 dd_Smed_v6_154_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30013396SMESG000075481.1 dd_Smed_v6_154_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of perilipin-2 isoform X1 vs. Ensembl Human
Match: PLIN5 (perilipin 5 [Source:HGNC Symbol;Acc:HGNC:33196])

HSP 1 Score: 51.9878 bits (123), Expect = 1.616e-6
Identity = 30/109 (27.52%), Postives = 56/109 (51.38%), Query Frame = 1
Query:   82 LERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVK----DMVEPIA---ASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVD 387
            ++R+   P+++ T T   + YS  KD++  L S     E+ +  +     D  +P+      +L  +++ AC  LDKLE K P +++ SE V+ S+ +   +S+   VD
Sbjct:   23 VQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLAENCVCGLTTRALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKDVVASSVTGVVD 131          
BLAST of perilipin-2 isoform X1 vs. Ensembl Mouse
Match: Plin5 (perilipin 5 [Source:MGI Symbol;Acc:MGI:1914218])

HSP 1 Score: 56.225 bits (134), Expect = 5.389e-8
Identity = 65/284 (22.89%), Postives = 118/284 (41.55%), Query Frame = 1
Query:   88 RIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVK----DMVEPIA---ASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMS-----------KNNKAEYGTA-EQKEYDILFNRA------LKEINTIHSF---------TSKSVEQLSNVLNSVYDQSVTKNKEWLKNYYDEFTEEM-------KQNSSDETKTELTVMQLAQGLSNKLRVSVRAMS 816
            R+   P++K T T     Y+  KD++  L S     E  +  V     D  +P+      +L  V++ AC  LDKLE K P +++ S+ V+ S+ +    S+   VD  +A +      +G   R  SQ +D +   +   V RF+            +    E GT  EQ++    F R       L+ +   HS          T + + QL   L  +  Q + +       ++   T+E+        +N    ++ EL  + L++ L+ +L+ +V A++
Sbjct:   40 RVVALPLVKATCTAVSSAYNSAKDRHPLLGSACRLAEHCVCSVTTCALDHAQPLLEHLQPQLATVNDLACRGLDKLEEKLPFLQQPSDMVVTSAKDTVAKSVTGMVD--LAQRGR--RWSGELRRSMSQAMDMVLGKSEKLVDRFLPMTEAELAVLAAEAEGPEVGTVEEQRQQQGYFVRLGSLSARLRHLAYEHSLGKLRQSKHRTQEMLAQLQETLELI--QHMQRGASPSPTFHPPKTQELWGSWSPCLENGRSHSEVELETLALSRSLTLELQNAVDALA 317          
BLAST of perilipin-2 isoform X1 vs. Ensembl Mouse
Match: Plin5 (perilipin 5 [Source:MGI Symbol;Acc:MGI:1914218])

HSP 1 Score: 56.225 bits (134), Expect = 5.389e-8
Identity = 65/284 (22.89%), Postives = 118/284 (41.55%), Query Frame = 1
Query:   88 RIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVK----DMVEPIA---ASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMS-----------KNNKAEYGTA-EQKEYDILFNRA------LKEINTIHSF---------TSKSVEQLSNVLNSVYDQSVTKNKEWLKNYYDEFTEEM-------KQNSSDETKTELTVMQLAQGLSNKLRVSVRAMS 816
            R+   P++K T T     Y+  KD++  L S     E  +  V     D  +P+      +L  V++ AC  LDKLE K P +++ S+ V+ S+ +    S+   VD  +A +      +G   R  SQ +D +   +   V RF+            +    E GT  EQ++    F R       L+ +   HS          T + + QL   L  +  Q + +       ++   T+E+        +N    ++ EL  + L++ L+ +L+ +V A++
Sbjct:   40 RVVALPLVKATCTAVSSAYNSAKDRHPLLGSACRLAEHCVCSVTTCALDHAQPLLEHLQPQLATVNDLACRGLDKLEEKLPFLQQPSDMVVTSAKDTVAKSVTGMVD--LAQRGR--RWSGELRRSMSQAMDMVLGKSEKLVDRFLPMTEAELAVLAAEAEGPEVGTVEEQRQQQGYFVRLGSLSARLRHLAYEHSLGKLRQSKHRTQEMLAQLQETLELI--QHMQRGASPSPTFHPPKTQELWGSWSPCLENGRSHSEVELETLALSRSLTLELQNAVDALA 317          
BLAST of perilipin-2 isoform X1 vs. UniProt/SwissProt
Match: sp|B0FJL7|PLIN5_SHEEP (Perilipin-5 OS=Ovis aries OX=9940 GN=Plin5 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.316e-7
Identity = 33/109 (30.28%), Postives = 56/109 (51.38%), Query Frame = 1
Query:   70 QIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNL-----RIVKDMVEPIAA---SKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSI 372
            Q  +++R+   P+I+ T T   E YS  KD++  L S     E  +     R + D  +P+ +    +L  V++ AC  LDKLE K P +++ SE V+ S+     +S+
Sbjct:   19 QQSAVQRVAALPLIRATCTAVSEAYSAAKDRHPLLGSACRLAEHCVCDLTTRAL-DHAQPLLSHLQPQLATVNDLACRGLDKLEEKLPFLQQPSETVVTSAKGVVASSV 126          
BLAST of perilipin-2 isoform X1 vs. UniProt/SwissProt
Match: sp|Q8BVZ1|PLIN5_MOUSE (Perilipin-5 OS=Mus musculus OX=10090 GN=Plin5 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 3.770e-7
Identity = 65/284 (22.89%), Postives = 118/284 (41.55%), Query Frame = 1
Query:   88 RIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVK----DMVEPIA---ASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMS-----------KNNKAEYGTA-EQKEYDILFNRA------LKEINTIHSF---------TSKSVEQLSNVLNSVYDQSVTKNKEWLKNYYDEFTEEM-------KQNSSDETKTELTVMQLAQGLSNKLRVSVRAMS 816
            R+   P++K T T     Y+  KD++  L S     E  +  V     D  +P+      +L  V++ AC  LDKLE K P +++ S+ V+ S+ +    S+   VD  +A +      +G   R  SQ +D +   +   V RF+            +    E GT  EQ++    F R       L+ +   HS          T + + QL   L  +  Q + +       ++   T+E+        +N    ++ EL  + L++ L+ +L+ +V A++
Sbjct:   40 RVVALPLVKATCTAVSSAYNSAKDRHPLLGSACRLAEHCVCSVTTCALDHAQPLLEHLQPQLATVNDLACRGLDKLEEKLPFLQQPSDMVVTSAKDTVAKSVTGMVD--LAQRGR--RWSGELRRSMSQAMDMVLGKSEKLVDRFLPMTEAELAVLAAEAEGPEVGTVEEQRQQQGYFVRLGSLSARLRHLAYEHSLGKLRQSKHRTQEMLAQLQETLELI--QHMQRGASPSPTFHPPKTQELWGSWSPCLENGRSHSEVELETLALSRSLTLELQNAVDALA 317          
BLAST of perilipin-2 isoform X1 vs. TrEMBL
Match: A0A0L8H2A2 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22023930mg PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.615e-11
Identity = 48/168 (28.57%), Postives = 83/168 (49.40%), Query Frame = 1
Query:   40 LEMENQTSD-SQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIA---ASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMSKNNKAEYG 531
            +E E  TS+ +  + ++R+   PVI+ T+T+   YY+  K+ N+ +       ES  + V +  +P+     +++   DNFACNQLDKLE K P IK++ + ++  S E   T ++P+VD++                    T+    +TT   +  F S  N  +YG
Sbjct:    1 MEHEQSTSEETSAQFMKRVSSIPVIESTWTQLSVYYNKAKEYNTLVKYAFDKAESGAKTVLNTAQPVLDKYQTQINAADNFACNQLDKLEEKCPAIKKTPQQIVTDSKEMCSTLVQPAVDKV-------------------NTVKQFGDTTVDNIKYFSSLENSKDYG 149          
BLAST of perilipin-2 isoform X1 vs. TrEMBL
Match: A0A0L7QPM7 (Lipid storage droplets surface-binding protein 2 OS=Habropoda laboriosa OX=597456 GN=WH47_08046 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.686e-10
Identity = 57/231 (24.68%), Postives = 102/231 (44.16%), Query Frame = 1
Query:   70 QIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIAA-------SKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRIT----------------SQTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKEWLKNY 693
             ++ + R++  PVI  T  K G  YS++KD +  +N  LT  E+ L+       P+ A        ++  VD   C  L+ +E K P++K+  + +  ++     +S++P++D++ AAK+SA   A T   I+                 Q +D  S   N  + R+       E   A     +   N+ L  + TI   ++K+  +   V +SV  Q  T  KE + +Y
Sbjct:   15 HLEVINRVKNIPVIHSTIEKTGSTYSYLKDSHHLINWALTQAETGLQYATATAIPLTAPLAKKFEGQITAVDQKLCEGLNIVEQKVPLMKQPPQQIYDAAVAVMSSSLQPTIDKLHAAKESATQQASTLREISIAKANELLATQYGSMAVQGVDNTSVLINGLLDRYFPPVEGEESTPAPVSADE---NKVLHAVQTIGQLSTKTANR---VYHSVAAQLKTVKKEDVASY 239          
BLAST of perilipin-2 isoform X1 vs. TrEMBL
Match: A0A154PBZ0 (Lipid storage droplets surface-binding protein 2 OS=Dufourea novaeangliae OX=178035 GN=WN55_11148 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.733e-10
Identity = 55/231 (23.81%), Postives = 104/231 (45.02%), Query Frame = 1
Query:   70 QIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIAA-------SKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAG---------------TPF-RITSQTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKEWLKNY 693
             ++ ++R++  PV+     K G  YS++KD +  +N  LT  E+ L+       P+ A        ++  VD   C  L+ +E K P++K+  + +  ++     +S++P++D++ AAK+SA   A                TP+  +  Q +D  S   N+ + R+       E   A     +   N+ L  + TI   ++K+  +   V +SV  Q  T  KE + +Y
Sbjct:   17 HLEVIDRVKNIPVVHSAIEKTGSTYSYLKDSHHLINWALTQAEAGLQYATATAIPLTAPLAKKFEGQITAVDQKLCEGLNIVEQKVPMMKQPPQQIYDAAKAVMSSSLQPTMDKLNAAKESATQQASSLKEISITKANELLNTPYGNMAVQGVDNTSVLINALLDRYFPPVEGEENTPAPVSADE---NKVLHAVQTIGQLSAKTANR---VYHSVAAQLKTVKKEDVASY 241          
BLAST of perilipin-2 isoform X1 vs. TrEMBL
Match: A0A411G765 (Lipid storage droplets surface-binding protein 2 (Fragment) OS=Cotesia chilonis OX=89804 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.002e-10
Identity = 58/239 (24.27%), Postives = 106/239 (44.35%), Query Frame = 1
Query:   49 ENQTSDS-QIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIAAS-------KLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITS----------------QTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKEWLKNY 693
            ++ TSD   ++ L+R++  P +     K G  YS++K  +  +N  L++ E+ L        PIA         ++  VD   C  LD +E K PI K+ ++ V  ++     +S++P++++++AAK+SA   A    +I+                 Q +D  S   N+ +  +     + E   A     +   N+ L  + TI   +SK+  +   V +SV  Q  T  KE +  Y
Sbjct:   16 QSATSDGPHLEVLDRVKNIPAVHTAIEKTGSTYSYLKGSHHLINWALSYAEAGLCYATATAAPIAKPLAKKFEEQINTVDQKLCQGLDIVEQKVPIFKQPTQEVYDAARRVLNSSLQPTINKLLAAKESATQQANVIKKISVDKANELLRTHYGAMAIQGVDNTSTLVNNLLDHYFPPTAEEESKPAPISADE---NKVLHAVQTIGQLSSKTANR---VYHSVAAQLKTIKKEDVATY 248          
BLAST of perilipin-2 isoform X1 vs. TrEMBL
Match: A0A1S3HTM7 (perilipin-2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106158080 PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.343e-9
Identity = 42/128 (32.81%), Postives = 69/128 (53.91%), Query Frame = 1
Query:   46 MENQTSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKL-NSTLTWTESNLRIVKDMVEPIAASKLGC---VDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAI 417
            +E + S+ Q   + R+   PV+   + +  +YY   K+K+  L   TL   ES+++      +P+ +   G    V+  AC QLDKLE KYPII + +E VI+ S   Y  +I+P+VD++ A K   +
Sbjct:    6 LEKKMSEEQF--ITRVSSLPVVSSAWGQVSDYYLRTKEKSPSLVQYTLNMAESSVKTAYTTAQPVISKLDGPIQKVNAIACQQLDKLEEKYPIISKDTETVIEKSKGAYNNAIQPTVDKVNAVKQYGV 131          
BLAST of perilipin-2 isoform X1 vs. Ensembl Medaka
Match: plin2 (perilipin 2 [Source:NCBI gene;Acc:101168816])

HSP 1 Score: 50.0618 bits (118), Expect = 3.084e-6
Identity = 34/122 (27.87%), Postives = 58/122 (47.54%), Query Frame = 1
Query:   82 LERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVK-----------DMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSV-DRIIAAKDS 411
            +ER+   P++  T+      YS  KD +  + +     E  +R +            D +EP    +L   ++ AC  LD++E   PI+++ SE V+ SS +   TS + +V  R+  AKDS
Sbjct:   13 VERVSSLPLVTSTYRLVFSVYSSTKDNHPYIRTVCEAAEQGVRTITSVALTTASPIMDKLEP----QLTIANDLACKGLDRIEKTLPILRQPSEQVV-SSAKGVVTSAKDAVTGRVSGAKDS 129          
BLAST of perilipin-2 isoform X1 vs. Ensembl Medaka
Match: plin2 (perilipin 2 [Source:NCBI gene;Acc:101168816])

HSP 1 Score: 50.0618 bits (118), Expect = 3.084e-6
Identity = 34/122 (27.87%), Postives = 58/122 (47.54%), Query Frame = 1
Query:   82 LERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVK-----------DMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSV-DRIIAAKDS 411
            +ER+   P++  T+      YS  KD +  + +     E  +R +            D +EP    +L   ++ AC  LD++E   PI+++ SE V+ SS +   TS + +V  R+  AKDS
Sbjct:   13 VERVSSLPLVTSTYRLVFSVYSSTKDNHPYIRTVCEAAEQGVRTITSVALTTASPIMDKLEP----QLTIANDLACKGLDRIEKTLPILRQPSEQVV-SSAKGVVTSAKDAVTGRVSGAKDS 129          
BLAST of perilipin-2 isoform X1 vs. Planmine SMEST
Match: SMESG000075481.1 (SMESG000075481.1)

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 362/363 (99.72%), Postives = 363/363 (100.00%), Query Frame = 1
Query:   46 MENQTSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKEWLKNYYDEFTEEMKQNSSDETKTELTVMQLAQGLSNKLRVSVRAMSTVCYNHMSLINKEMLDHVFNKTEHIYSVLNKSNYKDVREQISIENVKWVGQNVIGLLSSIKESLAAKYRTEVGQNPSIEMTEIGDKNTNNQEADLSDYLSGTDENQ 1134
            MENQTSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNL+IVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKEWLKNYYDEFTEEMKQNSSDETKTELTVMQLAQGLSNKLRVSVRAMSTVCYNHMSLINKEMLDHVFNKTEHIYSVLNKSNYKDVREQISIENVKWVGQNVIGLLSSIKESLAAKYRTEVGQNPSIEMTEIGDKNTNNQEADLSDYLSGTDENQ
Sbjct:    1 MENQTSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLKIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKEWLKNYYDEFTEEMKQNSSDETKTELTVMQLAQGLSNKLRVSVRAMSTVCYNHMSLINKEMLDHVFNKTEHIYSVLNKSNYKDVREQISIENVKWVGQNVIGLLSSIKESLAAKYRTEVGQNPSIEMTEIGDKNTNNQEADLSDYLSGTDENQ 363          
BLAST of perilipin-2 isoform X1 vs. Planmine SMEST
Match: SMESG000075481.1 (SMESG000075481.1)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 344/363 (94.77%), Postives = 345/363 (95.04%), Query Frame = 1
Query:   46 MENQTSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKEWLKNYYDEFTEEMKQNSSDETKTELTVMQLAQGLSNKLRVSVRAMSTVCYNHMSLINKEMLDHVFNKTEHIYSVLNKSNYKDVREQISIENVKWVGQNVIGLLSSIKESLAAKYRTEVGQNPSIEMTEIGDKNTNNQEADLSDYLSGTDENQ 1134
            MENQTSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNL+IVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKE                  DETKTELTVMQLAQGLSNKLRVSVRAMSTVCYNHMSLINKEMLDHVFNKTEHIYSVLNKSNYKDVREQISIENVKWVGQNVIGLLSSIKESLAAKYRTEVGQNPSIEMTEIGDKNTNNQEADLSDYLSGTDENQ
Sbjct:    1 MENQTSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLKIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVHRFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNSVYDQSVTKNKE-----------------CDETKTELTVMQLAQGLSNKLRVSVRAMSTVCYNHMSLINKEMLDHVFNKTEHIYSVLNKSNYKDVREQISIENVKWVGQNVIGLLSSIKESLAAKYRTEVGQNPSIEMTEIGDKNTNNQEADLSDYLSGTDENQ 346          
BLAST of perilipin-2 isoform X1 vs. Planmine SMEST
Match: SMESG000017016.1 (SMESG000017016.1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.455e-20
Identity = 45/102 (44.12%), Postives = 60/102 (58.82%), Query Frame = 1
Query:   67 SQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSI 372
            S  KSL+R++ YP++ D+      YY WIK  N  +++TLT  E  L+ VKD  EPIA   LG +DN   NQL+KLE K PII ESS ++     + Y   I
Sbjct:   10 SHFKSLDRVQNYPIVNDSIGFVLSYYQWIKSSNGIIDNTLTKAEMTLKAVKDTAEPIAVRNLGFIDNVVVNQLEKLEKKCPIILESSSSIKNIPSKIYHDGI 111          
BLAST of perilipin-2 isoform X1 vs. Planmine SMEST
Match: SMESG000017013.1 (SMESG000017013.1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.948e-17
Identity = 40/111 (36.04%), Postives = 67/111 (60.36%), Query Frame = 1
Query:   61 SDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRI 393
            SD   KS++++++YP++ D+      YY W+K  NS + + LT  E  ++ VK+  EPIAA+KL  +D+   NQL++LE   PII +SS+ +  +S + Y  +   +V  I
Sbjct:    9 SDPTYKSIDKMQQYPIVNDSLVYVIGYYKWLKSTNSIIENALTKAEKTIKTVKESTEPIAANKLKYIDHVLYNQLERLEKTCPIILQSSKTIADASSKVYRNNFESAVKTI 119          
BLAST of perilipin-2 isoform X1 vs. Planmine SMEST
Match: SMESG000016757.1 (SMESG000016757.1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.711e-11
Identity = 32/113 (28.32%), Postives = 64/113 (56.64%), Query Frame = 1
Query:   58 TSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWTESNLRIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKSSGEYYETSIRPSVDRII 396
            ++D   +S +RI  YP++ ++     + Y WIK +N  ++ T T  E+ L  +++  +PIAASKL  +D     QL+K E  +P++ + ++ V+K++   +   I  S+  ++
Sbjct:    2 SNDIIFQSFDRICHYPIVHESVGCFLKVYQWIKSRNKTIHGTFTKVETVLISIQNSTKPIAASKLKPLDQVVNKQLEKFEKFFPVVLDDTDVVLKNTIRSFVNPITNSISCVV 114          
The following BLAST results are available for this feature:
BLAST of perilipin-2 isoform X1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PLIN51.616e-627.52perilipin 5 [Source:HGNC Symbol;Acc:HGNC:33196][more]
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Plin55.389e-822.89perilipin 5 [Source:MGI Symbol;Acc:MGI:1914218][more]
Plin55.389e-822.89perilipin 5 [Source:MGI Symbol;Acc:MGI:1914218][more]
back to top
BLAST of perilipin-2 isoform X1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|B0FJL7|PLIN5_SHEEP2.316e-730.28Perilipin-5 OS=Ovis aries OX=9940 GN=Plin5 PE=2 SV... [more]
sp|Q8BVZ1|PLIN5_MOUSE3.770e-722.89Perilipin-5 OS=Mus musculus OX=10090 GN=Plin5 PE=1... [more]
back to top
BLAST of perilipin-2 isoform X1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8H2A22.615e-1128.57Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L7QPM72.686e-1024.68Lipid storage droplets surface-binding protein 2 O... [more]
A0A154PBZ06.733e-1023.81Lipid storage droplets surface-binding protein 2 O... [more]
A0A411G7657.002e-1024.27Lipid storage droplets surface-binding protein 2 (... [more]
A0A1S3HTM71.343e-932.81perilipin-2 isoform X2 OS=Lingula unguis OX=7574 G... [more]
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of perilipin-2 isoform X1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
plin23.084e-627.87perilipin 2 [Source:NCBI gene;Acc:101168816][more]
plin23.084e-627.87perilipin 2 [Source:NCBI gene;Acc:101168816][more]
back to top
BLAST of perilipin-2 isoform X1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075481.10.000e+099.72SMESG000075481.1[more]
SMESG000075481.10.000e+094.77SMESG000075481.1[more]
SMESG000017016.16.455e-2044.12SMESG000017016.1[more]
SMESG000017013.18.948e-1736.04SMESG000017013.1[more]
SMESG000016757.13.711e-1128.32SMESG000016757.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013396 ID=SMED30013396|Name=perilipin-2 isoform X1|organism=Schmidtea mediterranea sexual|type=transcript|length=1413bp
CACATTTCGTTTGTTTGATTAAACAAATTTAAATCACTTTTAGAAATGGA
AAATCAAACTTCCGATAGTCAAATTAAGTCTTTGGAAAGGATTAGAGAAT
ATCCAGTTATTAAGGATACATTCACTAAAGCCGGAGAATATTATTCTTGG
ATTAAAGATAAAAATTCCAAGCTTAATTCTACATTAACATGGACCGAAAG
TAATTTGAGAATTGTCAAAGACATGGTTGAGCCAATTGCTGCATCAAAAC
TGGGATGTGTTGATAATTTTGCTTGTAATCAATTGGACAAATTGGAAAAT
AAATATCCAATTATTAAAGAATCATCGGAAAATGTTATCAAATCCTCTGG
AGAATATTATGAGACTTCAATTAGACCAAGTGTGGACAGAATAATTGCTG
CAAAAGATAGTGCTATATATGCTGCTGGAACTCCGTTTAGAATTACAAGT
CAAACAATAGATTTTTTGTCAAATACTACTAATAGTTTTGTTCATCGTTT
TATGTCAAAGAATAATAAAGCTGAATATGGAACTGCCGAACAAAAAGAAT
ATGATATTTTATTCAATCGGGCTCTAAAAGAAATAAACACAATTCATTCG
TTTACTAGCAAAAGTGTTGAACAGTTATCCAATGTTTTGAATTCAGTATA
CGATCAATCAGTGACAAAAAACAAAGAATGGTTAAAAAATTATTATGATG
AATTCACAGAAGAAATGAAACAAAATTCTAGTGACGAAACAAAAACTGAA
TTAACAGTAATGCAACTAGCTCAAGGATTGTCTAACAAATTGCGAGTGTC
TGTTAGAGCCATGTCAACAGTTTGCTACAATCATATGTCATTGATAAATA
AAGAAATGCTTGACCATGTATTCAATAAAACTGAACATATTTATTCAGTA
TTAAACAAATCGAATTACAAAGACGTACGTGAGCAAATATCAATCGAAAA
TGTCAAATGGGTTGGACAAAATGTCATCGGTTTGTTGTCATCTATTAAGG
AGTCTTTGGCAGCTAAATATCGGACCGAGGTTGGACAGAATCCATCGATT
GAAATGACGGAAATCGGTGATAAAAATACAAATAATCAAGAAGCTGATTT
ATCTGACTATTTGTCGGGCACAGATGAAAATCAATGAGCAATGTATTTTT
GATTAATATTTGACATTTTTGTTTGAACTTTAATATGAAAGTTTTATAAA
ATATATTTTCATTCTTTGTGATTTGTAATTGATTTGATTTTTTTAACCGA
TCGTTTGAACTTGAAACTATGCAAATGTGAACAGTCATATGCCAACGGTC
AAATATCGACTTGGACGGCAAGTTATCAATCATTTAAGTGCAGTGATATA
ATAAATCTATATTTTGTGCTCATAGAATATAATTTAATAAATTTTATTAA
ATGTGAAATACAG
back to top

protein sequence of SMED30013396-orf-1

>SMED30013396-orf-1 ID=SMED30013396-orf-1|Name=SMED30013396-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MIDNLPSKSIFDRWHMTVHICIVSSSNDRLKKSNQLQITKNENIFYKTFI
LKFKQKCQILIKNTLLIDFHLCPTNSQINQLLDYLYFYHRFPSFQSMDSV
QPRSDI*
back to top

protein sequence of SMED30013396-orf-2

>SMED30013396-orf-2 ID=SMED30013396-orf-2|Name=SMED30013396-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MENQTSDSQIKSLERIREYPVIKDTFTKAGEYYSWIKDKNSKLNSTLTWT
ESNLRIVKDMVEPIAASKLGCVDNFACNQLDKLENKYPIIKESSENVIKS
SGEYYETSIRPSVDRIIAAKDSAIYAAGTPFRITSQTIDFLSNTTNSFVH
RFMSKNNKAEYGTAEQKEYDILFNRALKEINTIHSFTSKSVEQLSNVLNS
VYDQSVTKNKEWLKNYYDEFTEEMKQNSSDETKTELTVMQLAQGLSNKLR
VSVRAMSTVCYNHMSLINKEMLDHVFNKTEHIYSVLNKSNYKDVREQISI
ENVKWVGQNVIGLLSSIKESLAAKYRTEVGQNPSIEMTEIGDKNTNNQEA
DLSDYLSGTDENQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR004279Perilipin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005811lipid particle
GO:0005875microtubule associated complex
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006810transport
GO:0006869lipid transport
GO:0007275multicellular organism development
GO:0007476imaginal disc-derived wing morphogenesis
GO:0019915lipid storage
GO:0030730sequestering of triglyceride
GO:0031887lipid particle transport along microtubule
GO:0050995negative regulation of lipid catabolic process
GO:0051049regulation of transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004279PerilipinPFAMPF03036Perilipincoord: 9..121
e-value: 1.5E-8
score: 34.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 341..363
NoneNo IPR availablePANTHERPTHR14024ADIPOPHILIN/PERILIPINcoord: 2..254
NoneNo IPR availablePANTHERPTHR14024:SF49LIPID STORAGE DROPLETS SURFACE-BINDING PROTEIN 1coord: 2..254