Pre-mRNA-splicing ATP-dependent RNA helicase PRP28

Overview
NamePre-mRNA-splicing ATP-dependent RNA helicase PRP28
Smed IDSMED30013392
Length (bp)4372
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 (SMED30013392) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 (SMED30013392) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 (SMED30013392) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 (SMED30013392) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013392

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013392h1SMcG0011101 SmedASXL_011090SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013392h1SMcG0011101 SmedASXL_011090SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30013392h1SMcG0011101 dd_Smed_v4_5080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013392h1SMcG0011101 dd_Smed_v4_5080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013392h1SMcG0011101 dd_Smed_v4_5080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013392h1SMcG0011101 dd_Smed_v4_5080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013392h1SMcG0011101 dd_Smed_v4_5080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013392h1SMcG0011101 dd_Smed_v4_5080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013392h1SMcG0011101 dd_Smed_v4_5080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013392h1SMcG0011101 dd_Smed_v4_5080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013392h1SMcG0011101 dd_Smed_v6_5080_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Human
Match: DDX23 (DEAD-box helicase 23 [Source:HGNC Symbol;Acc:HGNC:17347])

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 364/570 (63.86%), Postives = 461/570 (80.88%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RL+ +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL ++P + +KPDTD+AED EK+L NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E++KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FY+LK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  253 RYLGGIKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 819          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Human
Match: DDX46 (DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:18681])

HSP 1 Score: 280.026 bits (715), Expect = 3.119e-77
Identity = 161/420 (38.33%), Postives = 244/420 (58.10%), Query Frame = 1
Query: 1024 HLDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKP---TERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
             L +M+  +  +FR +   IT KG   P  I+ W + G+S K+L+ +  K  Y++PTPIQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I     L++ E    GP A+I+ PTR+LA+QI +E  KF + LG++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT   ++E LAR  L +P  V +G  G+    ++  +QVI +  E +    L  +        +IIFV++++ AD L K L + +   +S HGG  Q  R+  +   K+    +LVAT++A RG+D+K + LV+NY  P   ++Y+HR GRTGRAG +G A +F+T+D +
Sbjct:  341 ELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSL-KKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGE----GPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNV-----RPD--------------------RQTVMFSATFPRAMEALARRILSKPIEVQVG--GRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQA 728          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Human
Match: DDX46 (DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:18681])

HSP 1 Score: 280.026 bits (715), Expect = 3.167e-77
Identity = 161/420 (38.33%), Postives = 244/420 (58.10%), Query Frame = 1
Query: 1024 HLDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKP---TERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
             L +M+  +  +FR +   IT KG   P  I+ W + G+S K+L+ +  K  Y++PTPIQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I     L++ E    GP A+I+ PTR+LA+QI +E  KF + LG++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT   ++E LAR  L +P  V +G  G+    ++  +QVI +  E +    L  +        +IIFV++++ AD L K L + +   +S HGG  Q  R+  +   K+    +LVAT++A RG+D+K + LV+NY  P   ++Y+HR GRTGRAG +G A +F+T+D +
Sbjct:  341 ELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSL-KKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGE----GPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNV-----RPD--------------------RQTVMFSATFPRAMEALARRILSKPIEVQVG--GRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQA 728          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Human
Match: DDX43 (DEAD-box helicase 43 [Source:HGNC Symbol;Acc:HGNC:18677])

HSP 1 Score: 266.544 bits (680), Expect = 1.559e-75
Identity = 163/450 (36.22%), Postives = 257/450 (57.11%), Query Frame = 1
Query:  979 REAKVKWDERPWTE---------------KHLDEMTNRDWRIFREDFSIT---TKGGN---IPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDKLREIM-SRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDD 2259
            RE  +KW +  W +                 + ++    WR  +E+F+IT    K G    IPN    +++A      +   I KA +++PTPIQ QA PI LQ  D+IGVA+TG+GKT  +L+P    +   P L K ++N   P  ++L PTR+LA+Q+  E  K+    G+++V + GG +R+EQ+ +L+ G +I+IATPGRL D+  + ++ L   TY+++DE D+M+DM FE  + KIL  +     +PD                    RQTVM +AT   SV RLA+++L+ P  VY+G++        KQ I + TE +K   ++  + S +    +I+FV++K  AD L+  L   N+   S HG + Q  RE A+   K+ +  IL+AT+LA RG+D+ DV+ V N+D P+ I+EY+HR+GRTGRAG+ G++I+ +T++D
Sbjct:  177 REEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWR--KENFNITWDDLKDGEKRPIPNPTCTFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSL-KGQRNR--PGMLVLTPTRELALQVEGECCKYSYK-GLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDV-----RPD--------------------RQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRND 595          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Human
Match: DDX41 (DEAD-box helicase 41 [Source:HGNC Symbol;Acc:HGNC:18674])

HSP 1 Score: 264.618 bits (675), Expect = 4.663e-75
Identity = 154/454 (33.92%), Postives = 248/454 (54.63%), Query Frame = 1
Query:  949 EAKRLKNISNREAKVKWDE---RPWTE-KHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQ---ILEETMKFGQ----PLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTK--DDSPLF 2271
            E + L ++      + +D+     WT  +++  M+       R+ + I  +G  IP  I+ ++E      +L  +  K  +  PTPIQ Q IP  L  RD+IG+A TGSGKT  F +P++ +  +  +     + E GPY +I+ P+R+LA Q   ILE   +  Q    PL ++    IGG S +EQ+  +R G  +++ATPGRL+D+L+ + + L+ C Y+ +DE DRMIDM FE D+R I SY                          +  RQT++F+ATM   ++  A++ L +P T+ +G  G  +    Q +  + E  K   L E + +   PP++IF  +K   D + + L    ++A++ HGGK QE R  A+ A +  +KD+LVAT++A +G+D   +  V+NYDMP+ I+ Y+HR+GRTGR+G  G+A +F+ K  D+S L 
Sbjct:  122 EGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIH-HPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKRE-GPYGLIICPSRELARQTHGILEYYCRLLQEDSSPL-LRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYF-------------------------KGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAKMVYLLECLQKT-PPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLM 546          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Celegans
Match: ddx-23 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q95QN2])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 354/570 (62.11%), Postives = 450/570 (78.95%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLYI 2406
            RYLG+++  K+R RRL+E+KFVF WD GEDTS DYN LY+ +HE QFFGRG + G D+NAQKK    FY +MM +RR+  +K+QE  RL+    +E KV  D+R W  K L EM++RDWRIFREDF+I+ KGG +P  +R WEEAG  D++   +  +  Y EPTPIQRQAIPIGLQNRD+IGVAETGSGKTAAFL+PLL WI  LP++++ E  +LGPYAII+ PTR+LA QI EET KFG+ LGIK V++IGG SRE+Q  +LR+G E+VIATPGRL+DVLENRY++LNQCTYVI+DE DRM+DM FE DV+K+L Y+P+   K DTD+ ++ E L++ F T +KYRQTVMFTATM  ++ERLAR +LRRPA V+IGS GKPTER +QV+YM+ E++KR KL E++   F PPIIIFVNQKKGAD+L+KGL K+  K    HGGKGQ+ REYA+ ALK    DILVAT++AGRGID+KDVSLVLNYDM K+I++Y HR+GRTGRAGK G AI+F+T DD+ +++DLK++L ESP+S  P EL +HPDAQ K G FTSKKR++ ETL++
Sbjct:  162 RYLGKQKEKKKRGRRLHEKKFVFDWDAGEDTSQDYNKLYQSRHEIQFFGRGSVAGTDVNAQKKEKNSFYQEMMENRRTVDEKEQEMHRLEKELKKEKKVAHDDRHWRMKELSEMSDRDWRIFREDFNISIKGGRVPRPLRNWEEAGFPDEVYQAV-KEIGYLEPTPIQRQAIPIGLQNRDVIGVAETGSGKTAAFLLPLLVWITSLPKMERQEHRDLGPYAIIMAPTRELAQQIEEETNKFGKLLGIKTVSVIGGASREDQGMKLRMGVEVVIATPGRLLDVLENRYLLLNQCTYVILDEADRMLDMGFEPDVQKVLEYMPDTNMKKDTDEFDNEEALMKGFSTREKYRQTVMFTATMSSAIERLARQYLRRPAVVHIGSAGKPTERVEQVVYMVPEDRKRKKLVEVLESQFQPPIIIFVNQKKGADMLSKGLTKLGFKPTVLHGGKGQDQREYALQALKEGTSDILVATDVAGRGIDVKDVSLVLNYDMAKSIEDYTHRIGRTGRAGKHGKAITFLTPDDTAVYFDLKQVLVESPVSSCPPELANHPDAQSKPGVFTSKKRQD-ETLFL 729          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Celegans
Match: F53H1.1 (pep chromosome:WBcel235:IV:1297400:1309644:-1 gene:WBGene00018776.1 transcript:F53H1.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.1)

HSP 1 Score: 279.256 bits (713), Expect = 1.987e-79
Identity = 155/410 (37.80%), Postives = 241/410 (58.78%), Query Frame = 1
Query: 1036 MTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVP-PIIIFVNQKKGADVLAKGLEKMNLKAIS-FHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFV 2247
            MT  + + +RE+  SIT KG + P  I+ W + G++ K+++V+  K +Y +PT IQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I   P L++ +    GP A+IL PTR+LA+Q  +E  KF +PLG+K     GG    EQ+  L+ GAEIV+ TPGR++DVL     +   L + TY+++DE DRM D  FE  + K+++ +     +PD                    +QTV+F+AT    +E LAR  L +P  + +G          Q   +  E+QK  KL E++   +     I+FV++++ AD +   L +    +++  HGG  Q  R+ ++A  K+    +LVAT++A RG+D+K++ LV+NYD P   ++Y+HRVGRTGRAG++G A +FV
Sbjct:  277 MTKAEVKAYREELDSITVKGIDCPKPIKTWAQCGVNLKMMNVL-KKFEYSKPTSIQAQAIPSIMSGRDVIGIAKTGSGKTLAFLLPMFRHILDQPELEEGD----GPIAVILAPTRELAMQTYKEANKFAKPLGLKVACTYGGVGISEQIADLKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNI-----RPD--------------------KQTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICAEHQKFLKLLELLGMYYEEGSSIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKTGVIKVLVATSVAARGLDVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFV 656          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Celegans
Match: F53H1.1 (pep chromosome:WBcel235:IV:1297222:1309652:-1 gene:WBGene00018776.1 transcript:F53H1.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.1)

HSP 1 Score: 279.641 bits (714), Expect = 8.221e-78
Identity = 155/410 (37.80%), Postives = 241/410 (58.78%), Query Frame = 1
Query: 1036 MTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVP-PIIIFVNQKKGADVLAKGLEKMNLKAIS-FHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFV 2247
            MT  + + +RE+  SIT KG + P  I+ W + G++ K+++V+  K +Y +PT IQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I   P L++ +    GP A+IL PTR+LA+Q  +E  KF +PLG+K     GG    EQ+  L+ GAEIV+ TPGR++DVL     +   L + TY+++DE DRM D  FE  + K+++ +     +PD                    +QTV+F+AT    +E LAR  L +P  + +G          Q   +  E+QK  KL E++   +     I+FV++++ AD +   L +    +++  HGG  Q  R+ ++A  K+    +LVAT++A RG+D+K++ LV+NYD P   ++Y+HRVGRTGRAG++G A +FV
Sbjct:  277 MTKAEVKAYREELDSITVKGIDCPKPIKTWAQCGVNLKMMNVL-KKFEYSKPTSIQAQAIPSIMSGRDVIGIAKTGSGKTLAFLLPMFRHILDQPELEEGD----GPIAVILAPTRELAMQTYKEANKFAKPLGLKVACTYGGVGISEQIADLKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNI-----RPD--------------------KQTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICAEHQKFLKLLELLGMYYEEGSSIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKTGVIKVLVATSVAARGLDVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFV 656          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 267.7 bits (683), Expect = 1.821e-76
Identity = 159/433 (36.72%), Postives = 243/433 (56.12%), Query Frame = 1
Query:  994 KWDERP--WTEKHLDEMTNRDWRIFR-EDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWI-EKLPRLQKMEQNELG-----PYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGG-NSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSY-LPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPAT-VYIGSIGKPTERTKQVIYMLTENQKRDKLREIM----SRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISF 2244
            +W   P  ++E +L   T+      + E+  +   G ++P +I  + EAG    +++ + N++ Y +PTP+Q+ +IP  L NRD++  A+TGSGKTAAFL+P++  I    P + K      G     P A++L PTR+LAIQI +E  KF     I+   + GG  +  +QV +LR G  I+IATPGRL+D++E  +I L  C Y+++DE DRM+DM FE  +RKI+   +P  T                        R T MF+AT    ++ LA+ FL+     + +G +G  +E  +Q +  + E +KR  L EI+    S N V   ++FV  K+GA+ LA  L +  ++++S HG   Q  RE  +   +S +  ILVAT +A RG+DI +V  V+NYD+P   DEY+HR+GRTGR G  G+A SF
Sbjct:   77 QWGGAPAEYSESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIEHFNEAGFGPAVMENV-NRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTA-----------------------RTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLV---LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSF 482          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 267.7 bits (683), Expect = 1.821e-76
Identity = 159/433 (36.72%), Postives = 243/433 (56.12%), Query Frame = 1
Query:  994 KWDERP--WTEKHLDEMTNRDWRIFR-EDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWI-EKLPRLQKMEQNELG-----PYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGG-NSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSY-LPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPAT-VYIGSIGKPTERTKQVIYMLTENQKRDKLREIM----SRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISF 2244
            +W   P  ++E +L   T+      + E+  +   G ++P +I  + EAG    +++ + N++ Y +PTP+Q+ +IP  L NRD++  A+TGSGKTAAFL+P++  I    P + K      G     P A++L PTR+LAIQI +E  KF     I+   + GG  +  +QV +LR G  I+IATPGRL+D++E  +I L  C Y+++DE DRM+DM FE  +RKI+   +P  T                        R T MF+AT    ++ LA+ FL+     + +G +G  +E  +Q +  + E +KR  L EI+    S N V   ++FV  K+GA+ LA  L +  ++++S HG   Q  RE  +   +S +  ILVAT +A RG+DI +V  V+NYD+P   DEY+HR+GRTGR G  G+A SF
Sbjct:   77 QWGGAPAEYSESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIEHFNEAGFGPAVMENV-NRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIRKIVGQGMPPKTA-----------------------RTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLV---LVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSF 482          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Fly
Match: CG10333 (gene:FBgn0032690 transcript:FBtr0081072)

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 382/565 (67.61%), Postives = 462/565 (81.77%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNE 2391
            RYLG  +  +R +R  N+RKFVF WD GEDTS DYN LYK++H  QFFGRG++ GIDI  QK+   +FY  ++  RR++ +K+QE  RLK +  +E K KWD+R W+EK  DEMT RDWRIFRED+++T KGG IPN IR W E+G   +++D II+K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKT AFLIPLLSWI+ LP+++++E  + GPYAII+ PTR+LA QI EET KFGQPLGI+ V ++GG SREEQ F+LRLG EIVIATPGRL+DVLENRY+VLNQCTY+++DE DRMIDM FE DV+KIL Y+P    KPDT++AED  KL++NF+T +KYRQTVMFTATM P+VERLART+LRRPATVYIGS+GKPTERT+Q++YM+ EN KR KL EI+SR   PP+IIFVNQKKGADVLAKGLEK+   + + HGGKGQE REYA+AALKS  KDILVAT++AGRGIDIKDVSLV+NYDM KTI++Y HR+GRTGRAGK G AISFVTKDDS LFYDLK+ +  SP+S  P EL++HP+AQ K GT  +KKRR E
Sbjct:  256 RYLGIIKKKRRVRRL-NDRKFVFDWDAGEDTSIDYNNLYKERHHVQFFGRGNVAGIDIKEQKRTQSKFYGDLLEKRRTEAEKEQEKVRLKKMKRKEDKQKWDDRHWSEKENDEMTERDWRIFREDYNVTIKGGRIPNPIRSWNESGFPKEIID-IIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKIERLEDVDQGPYAIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVGGLSREEQGFRLRLGCEIVIATPGRLIDVLENRYLVLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDETKLMENFYTKKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSVGKPTERTEQIVYMMGENDKRKKLMEILSRKIDPPVIIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQEQREYALAALKSGAKDILVATDVAGRGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDSALFYDLKQCVSASPVSTCPPELMNHPEAQHKPGTVVTKKRREE 818          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445187)

HSP 1 Score: 278.87 bits (712), Expect = 5.946e-80
Identity = 154/390 (39.49%), Postives = 224/390 (57.44%), Query Frame = 1
Query: 1078 ITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELG-PYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISF 2244
            +   G ++P  I+ +  A L D ++D + NK+ YK PTPIQ+ +IP+    RD++  A+TGSGKTAAFL+P+LS +     L+   + ELG P  +I+ PTR+LAIQI  E  KF     +K   + GG S   Q   +  G  +VIATPGRL+D ++  +I      +V++DE DRM+DM F  D+R+I++++   T +P+                     QT+MF+AT    ++R+A  FL+    V IG +G      KQ IY + +  KR KL EI+S       I+FV  K+GAD LA  L +      S HG + Q  RE A+   K+    +L+AT++A RG+DIK++  V+NYDMP  ID+Y+HR+GRTGR G  G A SF
Sbjct:  233 VKVTGSDVPQPIQHFTSADLRDIIIDNV-NKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKL-----LEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHV---TMRPE--------------------HQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQ-ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSF 592          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445185)

HSP 1 Score: 278.87 bits (712), Expect = 5.946e-80
Identity = 154/390 (39.49%), Postives = 224/390 (57.44%), Query Frame = 1
Query: 1078 ITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELG-PYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISF 2244
            +   G ++P  I+ +  A L D ++D + NK+ YK PTPIQ+ +IP+    RD++  A+TGSGKTAAFL+P+LS +     L+   + ELG P  +I+ PTR+LAIQI  E  KF     +K   + GG S   Q   +  G  +VIATPGRL+D ++  +I      +V++DE DRM+DM F  D+R+I++++   T +P+                     QT+MF+AT    ++R+A  FL+    V IG +G      KQ IY + +  KR KL EI+S       I+FV  K+GAD LA  L +      S HG + Q  RE A+   K+    +L+AT++A RG+DIK++  V+NYDMP  ID+Y+HR+GRTGR G  G A SF
Sbjct:  233 VKVTGSDVPQPIQHFTSADLRDIIIDNV-NKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKL-----LEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHV---TMRPE--------------------HQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQ-ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSF 592          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445186)

HSP 1 Score: 278.87 bits (712), Expect = 5.946e-80
Identity = 154/390 (39.49%), Postives = 224/390 (57.44%), Query Frame = 1
Query: 1078 ITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELG-PYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISF 2244
            +   G ++P  I+ +  A L D ++D + NK+ YK PTPIQ+ +IP+    RD++  A+TGSGKTAAFL+P+LS +     L+   + ELG P  +I+ PTR+LAIQI  E  KF     +K   + GG S   Q   +  G  +VIATPGRL+D ++  +I      +V++DE DRM+DM F  D+R+I++++   T +P+                     QT+MF+AT    ++R+A  FL+    V IG +G      KQ IY + +  KR KL EI+S       I+FV  K+GAD LA  L +      S HG + Q  RE A+   K+    +L+AT++A RG+DIK++  V+NYDMP  ID+Y+HR+GRTGR G  G A SF
Sbjct:  233 VKVTGSDVPQPIQHFTSADLRDIIIDNV-NKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKL-----LEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHV---TMRPE--------------------HQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQ-ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSF 592          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Fly
Match: CG6227 (gene:FBgn0030631 transcript:FBtr0074011)

HSP 1 Score: 289.271 bits (739), Expect = 1.076e-79
Identity = 159/418 (38.04%), Postives = 245/418 (58.61%), Query Frame = 1
Query: 1024 HLDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMS-RNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
             L  MT  D   +R D   I  KG   P  I+ W + G+S K ++V+  +  +++PTPIQ QAIP  +  RD+IG+A+TGSGKT AF++P+   I   P ++  +    G  AII+ PTR+L +QI ++  KF + LG++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT    +E LAR  L++P  V +G      +  +Q + +L ++ K  KL E++        II+FV++++ AD+L + L K +   +S HGG  Q  R+  +   KS +  +L+AT++A RG+D+KD+ LV+NYD+P   ++Y+HR GRTGRAGK+G A +F+T + S
Sbjct:  479 ELTRMTAADVEKYRSDLEGIQVKGKGCPKPIKTWAQCGVSKKEMEVL-RRLGFEKPTPIQCQAIPAIMSGRDLIGIAKTGSGKTLAFILPMFRHILDQPSMEDGD----GAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNV-----RPD--------------------RQTVMFSATFPRQMEALARRILKKPIEVIVGGRSVVCKEVEQHVVILNDDAKFFKLLELLGIYQEAGSIIVFVDKQENADILLRDLMKASYPCMSLHGGIDQFDRDSTIIDFKSGKVRLLIATSVAARGLDVKDLILVVNYDVPNHYEDYVHRCGRTGRAGKKGSAYTFITPEQS 866          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Zebrafish
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 749.969 bits (1935), Expect = 0.000e+0
Identity = 367/570 (64.39%), Postives = 459/570 (80.53%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNP+YK+KH+   +GRG I GID+  QK+   +FY  +M  RR++ +K+QE +RLK +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+E  L   +L+VI  K  YK+PTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E ++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL Y+P   +KPDTDDAED EK++QNF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q + +++E +KR KL E+++  F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+VLNYDM K I++YIHR+GRTGRAGK G+A++F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  240 RYLGGMKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPIYKEKHQVHLYGRGFIAGIDLKQQKRDQSRFYGDLMEKRRTNEEKEQEEQRLKKVRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRNWKEYSLPPHILEVI-EKCGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEDSDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEYIPVTNQKPDTDDAEDPEKMMQNFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVILMSEGEKRKKLLEVLASGFEPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVLNYDMAKNIEDYIHRIGRTGRAGKSGVAMTFLTKEDSSVFYDLKQAILESPVSTCPPELANHPDAQHKPGTILTKKRR-EETIF 806          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Zebrafish
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 360/571 (63.05%), Postives = 452/571 (79.16%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWD-EGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD      + D + L  KKH+   +GRG I GID+  QK+   +FY  +M  RR++ +K+QE +RLK +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+E  L   +L+VI  K  YK+PTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E ++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL Y+P   +KPDTDDAED EK++QNF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q + +++E +KR KL E+++  F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+VLNYDM K I++YIHR+GRTGRAGK G+A++F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  181 RYLGGMKKRRRTRHL-NDRKFVFEWDYRFIYIAIDLHCL--KKHQVHLYGRGFIAGIDLKQQKRDQSRFYGDLMEKRRTNEEKEQEEQRLKKVRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRNWKEYSLPPHILEVI-EKCGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEDSDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEYIPVTNQKPDTDDAEDPEKMMQNFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVILMSEGEKRKKLLEVLASGFEPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVLNYDMAKNIEDYIHRIGRTGRAGKSGVAMTFLTKEDSSVFYDLKQAILESPVSTCPPELANHPDAQHKPGTILTKKRR-EETIF 746          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Zebrafish
Match: CR936486.1 (pep chromosome:GRCz11:CHR_ALT_CTG23_2_1:14207403:14214672:-1 gene:ENSDARG00000110234.1 transcript:ENSDART00000186263.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR936486.1)

HSP 1 Score: 409.838 bits (1052), Expect = 1.110e-131
Identity = 202/304 (66.45%), Postives = 252/304 (82.89%), Query Frame = 1
Query: 1495 LGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            +G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL Y+P   +KPDTDDAED EK++QNF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q + +++E +KR KL E+++  F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+VLNYDM K I++YIHR+GRTGRAGK G+A++F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:    1 MGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEYIPVTNQKPDTDDAEDPEKMMQNFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVILMSEGEKRKKLLEVLASGFEPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVLNYDMAKNIEDYIHRIGRTGRAGKSGVAMTFLTKEDSSVFYDLKQAILESPVSTCPPELANHPDAQHKPGTILTKKRR-EETIF 303          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Zebrafish
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 278.485 bits (711), Expect = 5.674e-77
Identity = 155/396 (39.14%), Postives = 231/396 (58.33%), Query Frame = 1
Query: 1078 ITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSR-NFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTK 2253
            I+ KG   P  I+ W + G+S K+L+ +  K  Y++PTPIQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I     + + E    GP A+I+ PTR+LA+QI +E  KF + L ++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT   ++E LAR  L +P  V +G         +Q + ++ E +K  KL EI+        +IIFV++++ AD L K L K +   +S HGG  Q  R+  +   K+    +LVAT++A RG+D+K + LV+NY  P   ++Y+HR GRTGRAG +G A +F+T+
Sbjct:  328 ISVKGKGCPKPIKTWVQCGISMKVLNAL-KKHNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRPVGEAE----GPLAVIMTPTRELALQITKECKKFSKSLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANNGRVTNLRRVTYVVIDEADRMFDMGFEPQVMRIVDNV-----RPD--------------------RQTVMFSATFPRTMEALARRILSKPVEVQVGGRSVVCSDVEQHVIVIEEEKKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCMSLHGGIDQYDRDSIINDFKNGACRLLVATSVAARGLDVKQLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITE 693          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Zebrafish
Match: DDX17 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 268.855 bits (686), Expect = 2.948e-76
Identity = 153/445 (34.38%), Postives = 241/445 (54.16%), Query Frame = 1
Query:  955 KRLKNISNREAKVKWD--ERPWTEKH-------LDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDKLREIMSRNFVP---PIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVT 2250
            K+  N  +R  K KWD  + P  EK+       +  M+  D   +R    IT +G   P  +  + +A     ++DV++ +  +KEPT IQ Q  P+ L  RD++G+A+TGSGKT A+L+P +  I   P L++ +    GP  ++L PTR+LA Q+ +    +G+   IK+  + GG  +  Q+  L  G EI IATPGRL+D LE     L +CTY+++DE DRM+DM FE  +RKI+  +     +PD                    RQT+M++AT    V +LA  FL+    + IG++         Q++ +  EN+K +KL ++M           IIFV  KK  D L + + +    A+  HG K Q  R++ +   +S +  IL+AT++A RG+D++DV  V+NYD P + ++Y+HR+GRT R+  +G A +F T
Sbjct:   33 KKFGNPGDRLRKKKWDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQAQFPQYVMDVLLQQ-NFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGD----GPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQI-----RPD--------------------RQTLMWSATWPKEVRQLAEDFLQDYVQINIGALELSANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFT 447          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Xenopus
Match: ankrd9 (ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GENE-955835])

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 364/570 (63.86%), Postives = 457/570 (80.18%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RL+ +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W ++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL ++P   +KPDTD+AED EK+  NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E +KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  241 RYLGGLKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEVRLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWVDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVTNQKPDTDEAEDPEKMTANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSEAEKRKKLLAILEKGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSSVFYDLKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 807          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Xenopus
Match: ankrd9 (ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GENE-955835])

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 364/570 (63.86%), Postives = 457/570 (80.18%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RL+ +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W ++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL ++P   +KPDTD+AED EK+  NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E +KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  217 RYLGGLKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEVRLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWVDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVTNQKPDTDEAEDPEKMTANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSEAEKRKKLLAILEKGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSSVFYDLKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 783          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Xenopus
Match: ankrd9 (ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GENE-955835])

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 364/570 (63.86%), Postives = 457/570 (80.18%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RL+ +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W ++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL ++P   +KPDTD+AED EK+  NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E +KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  161 RYLGGLKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEVRLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWVDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVTNQKPDTDEAEDPEKMTANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSEAEKRKKLLAILEKGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSSVFYDLKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 727          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Xenopus
Match: ankrd9 (ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GENE-955835])

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 364/570 (63.86%), Postives = 457/570 (80.18%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RL+ +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W ++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL ++P   +KPDTD+AED EK+  NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E +KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  101 RYLGGLKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEVRLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWVDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVTNQKPDTDEAEDPEKMTANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSEAEKRKKLLAILEKGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSSVFYDLKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 667          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Xenopus
Match: ankrd9 (ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GENE-955835])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 356/570 (62.46%), Postives = 449/570 (78.77%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD      A     YK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RL+ +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W ++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL ++P   +KPDTD+AED EK+  NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E +KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:   79 RYLGGLKKRRRTRHL-NDRKFVFEWD------AKCFSRYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEVRLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWVDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVTNQKPDTDEAEDPEKMTANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSEAEKRKKLLAILEKGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSSVFYDLKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 639          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Mouse
Match: Ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:MGI Symbol;Acc:MGI:1921601])

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 364/570 (63.86%), Postives = 461/570 (80.88%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RL+ +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL ++P + +KPDTD+AED EK+L NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E++KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FY+LK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  252 RYLGGIKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 818          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Mouse
Match: Ddx43 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:MGI Symbol;Acc:MGI:3642857])

HSP 1 Score: 273.478 bits (698), Expect = 5.018e-78
Identity = 166/451 (36.81%), Postives = 262/451 (58.09%), Query Frame = 1
Query:  979 REAKVKWDERPW---------------TEKHLDEMTNRDWRIFREDFSITT---KGGN---IPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERT-KQVIYMLTENQKRDKLREIMSRNFVPP--IIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDD 2259
            RE  +KW+++ W               T   + ++   +WR  +E+F+IT    K G    IPN I  +E+A  S   +   I +A +++PTPIQ QA PI LQ  D+IGVA+TG+GKT ++L+P    ++  P L + ++N  GP  ++L PTR+LA+Q+  E  K+     +K+V + GG  R+ Q+  +  G +I+IATPGRL D+  N ++ L   TY+++DE D+M+DM FE  + KIL  +     +PD                    RQT+M +AT   +V RLA+++L+ P  VY+G++      T KQ I + TE +KR  ++  +  N  P   +I+FV++K  AD L+  L   ++   S HG + Q  RE A+   K+ +  IL+AT+LA RG+D+ D++ V NYD P+ I+EY+HRVGRTGRAG+ G++I+ +T++D
Sbjct:  175 REDALKWEKKKWADLPPIKKNFYIESATTSSMSQVQIDNWR--KENFNITCDDLKDGEKRPIPNPICKFEDAFQSYPEVMENIKRAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLSYLMPGFIHLDSQP-LAREQRN--GPGMLVLTPTRELALQVEAECSKYSYG-DLKSVCVYGGGDRDGQIQDVSKGVDIIIATPGRLNDLQMNNFVNLKSVTYLVLDEADKMLDMGFEPQIMKILLDV-----RPD--------------------RQTIMTSATWPYAVRRLAQSYLKEPMIVYVGTLDLVAVSTVKQNIIITTEEEKRTHIQTFLE-NMSPKDKVIVFVSRKAVADHLSSDLILRHISVESLHGNREQSDREKALENFKTGKVRILIATDLASRGLDVHDITHVYNYDFPRNIEEYVHRVGRTGRAGRTGMSITLITRND 593          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Mouse
Match: Ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:MGI Symbol;Acc:MGI:1920895])

HSP 1 Score: 280.026 bits (715), Expect = 2.181e-77
Identity = 161/420 (38.33%), Postives = 244/420 (58.10%), Query Frame = 1
Query: 1024 HLDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKP---TERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
             L +M+  +  +FR +   IT KG   P  I+ W + G+S K+L+ +  K  Y++PTPIQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I     L++ E    GP A+I+ PTR+LA+QI +E  KF + LG++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT   ++E LAR  L +P  V +G  G+    ++  +QVI +  E +    L  +        +IIFV++++ AD L K L + +   +S HGG  Q  R+  +   K+    +LVAT++A RG+D+K + LV+NY  P   ++Y+HR GRTGRAG +G A +F+T+D +
Sbjct:  341 ELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSL-KKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGE----GPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNV-----RPD--------------------RQTVMFSATFPRAMEALARRILSKPIEVQVG--GRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQA 728          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Mouse
Match: Ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:MGI Symbol;Acc:MGI:1920895])

HSP 1 Score: 280.026 bits (715), Expect = 2.181e-77
Identity = 161/420 (38.33%), Postives = 244/420 (58.10%), Query Frame = 1
Query: 1024 HLDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKP---TERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
             L +M+  +  +FR +   IT KG   P  I+ W + G+S K+L+ +  K  Y++PTPIQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I     L++ E    GP A+I+ PTR+LA+QI +E  KF + LG++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT   ++E LAR  L +P  V +G  G+    ++  +QVI +  E +    L  +        +IIFV++++ AD L K L + +   +S HGG  Q  R+  +   K+    +LVAT++A RG+D+K + LV+NY  P   ++Y+HR GRTGRAG +G A +F+T+D +
Sbjct:  341 ELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSL-KKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGE----GPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNV-----RPD--------------------RQTVMFSATFPRAMEALARRILSKPIEVQVG--GRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQA 728          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Mouse
Match: Ddx41 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 [Source:MGI Symbol;Acc:MGI:1920185])

HSP 1 Score: 263.077 bits (671), Expect = 8.126e-75
Identity = 154/454 (33.92%), Postives = 247/454 (54.41%), Query Frame = 1
Query:  949 EAKRLKNISNREAKVKWDE---RPWTE-KHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQ---ILEETMKFGQ----PLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTK--DDSPLF 2271
            E + L ++      + +D+     WT  +++  M+       R+ + I  +G  IP  I+ ++E      +L  +  K     PTPIQ Q IP  L  RD+IG+A TGSGKT  F +P++ +  +  +     + E GPY +I+ P+R+LA Q   ILE   +  Q    PL ++    IGG S +EQ+  +R G  +++ATPGRL+D+L+ + + L+ C Y+ +DE DRMIDM FE D+R I SY                          +  RQT++F+ATM   ++  A++ L +P T+ +G  G  +    Q +  + E  K   L E + +   PP++IF  +K   D + + L    ++A++ HGGK QE R  A+ A +  +KD+LVAT++A +G+D   +  V+NYDMP+ I+ Y+HR+GRTGR+G  G+A +F+ K  D+S L 
Sbjct:  122 EGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILRGL-KKKGILHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKRE-GPYGLIICPSRELARQTHGILEYYCRLLQEDSSPL-LRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYF-------------------------KGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAKMVYLLECLQKT-PPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLM 546          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. UniProt/SwissProt
Match: sp|Q9BUQ8|DDX23_HUMAN (Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens OX=9606 GN=DDX23 PE=1 SV=3)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 364/570 (63.86%), Postives = 461/570 (80.88%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RL+ +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV+KIL ++P + +KPDTD+AED EK+L NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E++KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FY+LK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  253 RYLGGIKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 819          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. UniProt/SwissProt
Match: sp|Q5RC67|DDX23_PONAB (Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii OX=9601 GN=DDX23 PE=2 SV=1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 362/570 (63.51%), Postives = 459/570 (80.53%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK++H+ Q  GRG I GID+  QK+   +FY  +M  RR+  +K+QE  R + +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+++ L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E+++ GPYAIIL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+V ++CTYV++DE DRMIDM FE DV+KIL ++P + +KPDTD+AED EK+L NF +   KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKP ER +Q +++++E++KR KL  I+ + F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI+DVS+V+NYDM K I++YIHR+GRTGRAGK G+AI+F+TK+DS +FY+LK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  253 RYLGGIKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARFRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVPSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRR-EETIF 819          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. UniProt/SwissProt
Match: sp|Q5BCU6|PRP28_EMENI (Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=prp28 PE=3 SV=2)

HSP 1 Score: 540.421 bits (1391), Expect = 4.268e-173
Identity = 262/522 (50.19%), Postives = 370/522 (70.88%), Query Frame = 1
Query:  745 NERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWD--------ERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKME-QNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLT-ENQKRDKLREIMSR-NFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYD 2277
             +RKF F W+  EDTS DYNPLY+ +HEA FFGRG + G   +    ++ + Y K + DR      D+EA  ++     E + +          ++ W+EK L+ M  RDWRIF+EDF+I TKGG++PN +R W+E+GL  +LL+ ++++  YKEPTPIQR AIPI +Q+RD+IGVA TGSGKTAAFL+PLL +I +LPR+ + E +   GPYAI+L PTR+LA QI  E  KF +PLG   V+I+GG+S EEQ + LR GAEI+IATPGRLVD +E R +VL+QC YVIMDE DRMID+ FE  V KIL  LP   EKPDT++AED+  + ++  +  +YRQT+M+TATM  +VER+AR +LRRPA V IGS G+  +  +Q + M+  E++++ +L EI+S  +F PPII+FVN K+  D +A+ +++    +++ HG K QE RE A+A++++   D+LVAT+LAGRGID+ DVSLV+N++M  +I+ Y HR+GRTGRAGK G+AI+F+  +D+ + YD
Sbjct:  222 TDRKFNFEWNAEEDTSGDYNPLYQHRHEANFFGRGRLAGFGDDVAD-SVAKKYAKALEDR------DREAGSIRAREILEMERRRREESTRNQLDKHWSEKKLEHMRERDWRIFKEDFNIATKGGSVPNPMRSWDESGLPKRLLE-LVDRVGYKEPTPIQRAAIPIAMQSRDLIGVAVTGSGKTAAFLLPLLCYIAELPRIDEFEWRKNDGPYAIVLAPTRELAQQIEIEAKKFTEPLGFNVVSIVGGHSFEEQAYSLRNGAEIIIATPGRLVDCIERRMLVLSQCCYVIMDEADRMIDLGFEEPVNKILDALPVTNEKPDTEEAEDSSAMSRHLGSKDRYRQTMMYTATMPTAVERIARKYLRRPAIVTIGSAGEAVDTVEQRVEMIAGEDKRKKRLGEILSSGDFRPPIIVFVNIKRNCDAIAREIKQWGFSSVTLHGSKTQEQREAALASVRNGSTDVLVATDLAGRGIDVPDVSLVINFNMATSIESYTHRIGRTGRAGKSGVAITFLGNEDADVMYD 735          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. UniProt/SwissProt
Match: sp|Q2UH00|PRP28_ASPOR (Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=prp28 PE=3 SV=1)

HSP 1 Score: 539.265 bits (1388), Expect = 2.518e-172
Identity = 260/515 (50.49%), Postives = 371/515 (72.04%), Query Frame = 1
Query:  748 ERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDR--RSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKME-QNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQ-VIYMLTENQKRDKLREIMSRN-FVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYD 2277
            +RKF F W+  EDTS DYNPLY+ +HEA FFGRG + G   +     + + Y + + DR   + G + +E   ++     E+     ++ W+EK L+ M  RDWRIF+EDF+I+TKGG++PN +R W+E+GL  +L++ ++NK  YKEPTPIQR AIPI +Q+RD+IGVA TGSGKTA+FL+PLL +I +LPR+ + E +   GPYAI+L PTR+LA QI  E  KF +PLG   V+I+GG+S EEQ + LR GAEI+IATPGRLVD +E R +VL+QC YVIMDE DRMID+ FE  V KIL  LP + EKPD+++AE++  + Q+  T  +YRQT+M+TATM  +VER+AR +LRRPA V IGS G+  +  +Q V ++  E++++ +L +I+S   F PPII+FVN K+  D +A+ +++    +++ HG K QE RE A+A++++ + D+LVAT+LAGRGID+ DVSLV+N++M  TI+ Y HR+GRTGRAGK G+AI+F+  +D+ + YD
Sbjct:  244 DRKFNFEWNAEEDTSGDYNPLYQHRHEANFFGRGRLAGFGDDVADN-VAKKYARALEDRDHEAGGIRAREILEMERRRREESTRNQLDKHWSEKKLEHMRERDWRIFKEDFNISTKGGSVPNPMRSWDESGLPKRLME-LVNKVGYKEPTPIQRAAIPIAMQSRDLIGVAVTGSGKTASFLLPLLVYIAELPRIDEFEWRKNDGPYAIVLAPTRELAQQIEIEAKKFTEPLGFNVVSIVGGHSFEEQAYSLRNGAEIIIATPGRLVDCIERRMLVLSQCCYVIMDEADRMIDLGFEEPVNKILDALPVSNEKPDSEEAENSMAMSQHIGTKDRYRQTMMYTATMPTAVERIARKYLRRPAIVTIGSAGEAVDTVEQRVEFIAGEDKRKKRLGDILSSGEFRPPIIVFVNIKRNCDAIAREIKQWGFSSVTLHGSKTQEQREAALASVRNGQTDVLVATDLAGRGIDVPDVSLVINFNMATTIESYTHRIGRTGRAGKSGVAITFLGNEDTDVMYD 756          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. UniProt/SwissProt
Match: sp|A1CX72|PRP28_NEOFI (Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=prp28 PE=3 SV=1)

HSP 1 Score: 538.88 bits (1387), Expect = 2.789e-172
Identity = 263/521 (50.48%), Postives = 369/521 (70.83%), Query Frame = 1
Query:  748 ERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWD--------ERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKME-QNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLT-ENQKRDKLREIMSRN-FVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYD 2277
            +RKF F W+  EDTS DYNPLY+++HEA F+GRG + G   +     L Q Y + + DR      D+EA  ++     E + +          ++ W+EK L+ M  RDWRIF+EDF+I+TKGG++PN +R WEE+GL  +LL+ ++++  YKEPTPIQR AIPI LQ+RD+IGVA TGSGKTA+FL+PLL +I +LPR+ + E +   GPYAI+L PTR+LA QI  E  KF QPLG   V+I+GG+S EEQ + LR GAEI+IATPGRLVD +E R +VL+QC YVIMDE DRMID+ FE  V KIL  LP   EKPDT++AE++  +      + +YRQT+M+TATM  +VER+AR +LRRPA V IGS G+  +  +Q + M+  E++++ +L +I+S   F PPII+FVN K+  D +A+ +++M   +++ HG K QE RE A+A++++   D+LVAT+LAGRGID+ DVSLV+N++M  +I+ Y HR+GRTGRAGK G+AI+F+  +D+ + YD
Sbjct:  241 DRKFNFEWNAEEDTSGDYNPLYQQRHEANFYGRGRLAGFGDDVAD-TLAQKYARALEDR------DREAGSIRAREILEMERRRREESTRNQLDKHWSEKKLEHMRERDWRIFKEDFNISTKGGSVPNPMRSWEESGLPKRLLE-LVDQVGYKEPTPIQRAAIPIALQSRDLIGVAVTGSGKTASFLLPLLVYISELPRIDEFEWRKNDGPYAIVLAPTRELAQQIEIEARKFTQPLGFNVVSIVGGHSFEEQAYSLRNGAEIIIATPGRLVDCIERRLLVLSQCCYVIMDEADRMIDLGFEEPVNKILDALPVTNEKPDTEEAENSAAM-----RSHRYRQTMMYTATMPSAVERIARKYLRRPAIVTIGSAGEAVDTVEQRVEMIAGEDKRKKRLADILSSGEFRPPIIVFVNIKRNCDAIAREIKQMGFSSVTLHGSKTQEQREAALASVRNGSTDVLVATDLAGRGIDVPDVSLVVNFNMANSIESYTHRIGRTGRAGKSGVAITFLGNEDADVMYD 748          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. TrEMBL
Match: G4V9R0 (Putative dead box ATP-dependent RNA helicase OS=Schistosoma mansoni OX=6183 GN=Smp_093690.1 PE=3 SV=1)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 444/690 (64.35%), Postives = 544/690 (78.84%), Query Frame = 1
Query:  364 AVPKHAQIPLSVEEVLXXXXXXXXXXXXXXYFSKAEREALAIQRRXXXXXXXXXXXXXXXNLQTKYIEEG----RIKXXXXXXXXXXXXXXXXXXXKTAXXXXXXX-----XXXXXXXXXRYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLYI 2406
             VPK  ++P+S+EE++  K AEE    KPK+ SK ER   AIQRR+ +V+  ++K +     QT+Y+E      R +  +  +   R + + R+  K A Q E         +EE+AIKERYLGQKRLTKRR RRLNERKFVF WD  +DTS DYNPLYK+KH+ QFFGRGHIGGIDI  QKK +G+FY+K++  RRSD QK QE KRL  ++ REAK KWD+R WTEK LD+MT RDWRIFREDF+I+TKGGNIPN +R W E  ++D+L DVI  K  Y EPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL+WI++LP+L+++E  E GPYAII+ PTR+LA QI EET+KFG+PLGIK V++IGG SRE+Q  +LR+GAEIVI TPGRL DVLENRY+VLNQCTY+++DE D+MIDM FE +V  IL+YLP   EKPD +DAED  KLL NF T  KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKPTER +Q++YM++E +KR KL EI++    PP+IIFVNQKKGADVLAKGLEK+   A+  HGGKGQE REYA+A+LKS +K+ILVAT++AGRGIDIKDVS+V+NYDM KTIDEY+HR+GRTGRAGK G+AIS +TK+D+P+FYDLK+LL +SP+S  P EL +HPDAQ K G   +KKRR EET+YI
Sbjct:   43 CVPK--RVPISLEELILKKKAEEAELIKPKFISKEERIQQAIQRRQAEVQAQREKQMDAFKKQTEYLEGAKDLERKRRTEDFQERMRQNRNFRNTSKRAAQGEVPSDKINNSQEEQAIKERYLGQKRLTKRRPRRLNERKFVFDWDVADDTSQDYNPLYKEKHQIQFFGRGHIGGIDIKQQKKEIGRFYSKLLESRRSDTQKVQEKKRLSGVAKREAKQKWDDRHWTEKALDQMTERDWRIFREDFNISTKGGNIPNPLRSWAEMNVADELKDVI-KKVGYPEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLNWIQRLPKLERLEDTEQGPYAIIMAPTRELAQQIEEETVKFGRPLGIKTVSLIGGLSREDQALKLRMGAEIVIGTPGRLNDVLENRYMVLNQCTYIVLDEADKMIDMGFEPEVNNILTYLPVTNEKPDNEDAEDDSKLLSNFATKHKYRQTVMFTATMPPAVERLARSYLRRPAMVYIGSAGKPTERVEQIVYMVSEQEKRRKLLEILAAGLDPPVIIFVNQKKGADVLAKGLEKLGYSAVVLHGGKGQEQREYALASLKSGQKEILVATDVAGRGIDIKDVSMVINYDMSKTIDEYVHRIGRTGRAGKSGIAISLLTKEDAPVFYDLKQLLIQSPVSTCPHELANHPDAQTKPGILAAKKRRAEETVYI 729          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. TrEMBL
Match: G4V9R1 (Putative dead box ATP-dependent RNA helicase OS=Schistosoma mansoni OX=6183 GN=Smp_093690.2 PE=3 SV=1)

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 442/690 (64.06%), Postives = 545/690 (78.99%), Query Frame = 1
Query:  364 AVPKHAQIPLSVEEVLXXXXXXXXXXXXXXYFSKAEREALAIQRRXXXXXXXXXXXXXXXNLQTKYIEEG----RIKXXXXXXXXXXXXXXXXXXXKTAX-----XXXXXXXXXXXXXXXRYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLYI 2406
             VPK  ++P+S+EE++  K AEE    KPK+ SK ER   AIQRR+ +V+  ++K +     QT+Y+E      R +  +  +   R + + R+  K A       ++ +  +EE+AIKERYLGQKRLTKRR RRLNERKFVF WD  +DTS DYNPLYK+KH+ QFFGRGHIGGIDI  QKK +G+FY+K++  RRSD QK QE KRL  ++ REAK KWD+R WTEK LD+MT RDWRIFREDF+I+TKGGNIPN +R W E  ++D+L DVI  K  Y EPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL+WI++LP+L+++E  E GPYAII+ PTR+LA QI EET+KFG+PLGIK V++IGG SRE+Q  +LR+GAEIVI TPGRL DVLENRY+VLNQCTY+++DE D+MIDM FE +V  IL+YLP   EKPD +DAED  KLL NF T  KYRQTVMFTATM P+VERLAR++LRRPA VYIGS GKPTER +Q++YM++E +KR KL EI++    PP+IIFVNQKKGADVLAKGLEK+   A+  HGGKGQE REYA+A+LKS +K+ILVAT++AGRGIDIKDVS+V+NYDM KTIDEY+HR+GRTGRAGK G+AIS +TK+D+P+FYDLK+LL +SP+S  P EL +HPDAQ K G   +KKRR EET+YI
Sbjct:  106 CVPK--RVPISLEELILKKKAEEAELIKPKFISKEERIQQAIQRRQAEVQAQREKQMDAFKKQTEYLEGAKDLERKRRTEDFQERMRQNRNFRNTSKRAAQGEVPSDKINNSQEEQAIKERYLGQKRLTKRRPRRLNERKFVFDWDVADDTSQDYNPLYKEKHQIQFFGRGHIGGIDIKQQKKEIGRFYSKLLESRRSDTQKVQEKKRLSGVAKREAKQKWDDRHWTEKALDQMTERDWRIFREDFNISTKGGNIPNPLRSWAEMNVADELKDVI-KKVGYPEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLNWIQRLPKLERLEDTEQGPYAIIMAPTRELAQQIEEETVKFGRPLGIKTVSLIGGLSREDQALKLRMGAEIVIGTPGRLNDVLENRYMVLNQCTYIVLDEADKMIDMGFEPEVNNILTYLPVTNEKPDNEDAEDDSKLLSNFATKHKYRQTVMFTATMPPAVERLARSYLRRPAMVYIGSAGKPTERVEQIVYMVSEQEKRRKLLEILAAGLDPPVIIFVNQKKGADVLAKGLEKLGYSAVVLHGGKGQEQREYALASLKSGQKEILVATDVAGRGIDIKDVSMVINYDMSKTIDEYVHRIGRTGRAGKSGIAISLLTKEDAPVFYDLKQLLIQSPVSTCPHELANHPDAQTKPGILAAKKRRAEETVYI 792          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. TrEMBL
Match: A0A0R3WBU9 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8136 PE=4 SV=1)

HSP 1 Score: 812.372 bits (2097), Expect = 0.000e+0
Identity = 439/699 (62.80%), Postives = 548/699 (78.40%), Query Frame = 1
Query:  376 HAQIPLSVEEVLXXXXXXXXXXXXXXYFSKAEREALAIQRRXXXXXXXXXXXXXXXNLQTKYIEEGRIKXXXXXXXXXXXXXXXXXXXK---------------------TAXXXXXXXXXXXXXXXXRYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLYIA 2409
             A++P+S+EE++  K A +    KPK+ S+ ERE +A+QRREE ++E +K+A  E + Q +Y+ + RI S + D  SR      R   +                      ++ +  DK REEEAIKERYLGQKRLTKRRQRRLNERKFVF WD  EDTS DYNPLYK+KH+ QFFGRGHIGGIDI  QK+ +G+FY+KM+  RRSD QK+QE KRL  ++ REAK KWD+R W+EK L EMT RDWRIFRED++I+TKGGN+PN IR W+E+ +   LL+ II+K  Y EPT IQRQAIPIGLQNRDIIG+AETGSGKT AFL+PLL+WI+ LP+L +ME  E GPYA+I+ P+R+LA QI EET+KFG PLGIK V +IGG S+E+Q  +LR+GAEIVI TPGRLVDVLE+RYIVLNQCTYV++DE D+MIDM FE  V  ILSYLP   +KPDT++AE  EKLL NF T QKYRQTVMFTATM P+VERLAR++LRRPATVY+G+ GKPT+R +Q++Y++ EN KR KL EI++    PP+IIFVNQKKGAD+LAKGLEK+   A+  HGGKGQEHREYA+A+LKS +K+ILVAT++AGRGIDIKDVS+V+NYDM KTID+Y+HR+GRTGRAGK G+A++F+TKDD+ ++YDLK+LL  SP+S  P EL +HPDAQ K GTF +KKRRN+ET+YIA
Sbjct:  134 QAKVPVSLEELMQRKEAADAELSKPKFISREEREKMALQRREEAIREQRKRAADELSKQIEYLSKTRIDSSNLDSLSRYDRDSYRLRRRVNEWDRRYPDKGRDRRAEDGSASKVSAADKVREEEAIKERYLGQKRLTKRRQRRLNERKFVFDWDANEDTSQDYNPLYKEKHQIQFFGRGHIGGIDIKQQKREIGKFYSKMLESRRSDTQKEQENKRLSGLAKREAKEKWDDRHWSEKSLSEMTYRDWRIFREDYNISTKGGNLPNPIRSWKESAIHKDLLE-IIHKVGYSEPTAIQRQAIPIGLQNRDIIGIAETGSGKTLAFLVPLLTWIQTLPKLVRMEDTEQGPYALIMAPSRELAQQIEEETVKFGAPLGIKTVAVIGGISKEDQALKLRMGAEIVIGTPGRLVDVLESRYIVLNQCTYVVLDEADKMIDMGFEPHVNNILSYLPVTNQKPDTEEAEQDEKLLANFSTKQKYRQTVMFTATMPPAVERLARSYLRRPATVYVGTAGKPTDRVEQIVYIVQENDKRKKLLEILNEGIEPPVIIFVNQKKGADMLAKGLEKLGHSAVVLHGGKGQEHREYALASLKSGQKEILVATDVAGRGIDIKDVSMVINYDMAKTIDDYVHRIGRTGRAGKSGIAVTFLTKDDTAVYYDLKQLLLTSPVSTCPPELANHPDAQTKPGTFAAKKRRNDETVYIA 831          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. TrEMBL
Match: A0A4E0RA85 (DEAD box ATP dependent RNA helicase OS=Fasciola hepatica OX=6192 GN=D915_004945 PE=4 SV=1)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 446/726 (61.43%), Postives = 559/726 (77.00%), Query Frame = 1
Query:  259 KESFPDIEDFEVEKKIPFNDQSKQNNENAVFKTPNAVPKHAQIPLSVEEVLXXXXXXXXXXXXXXYFSKAEREALAIQRRXXXXXXXXXXXXXXXNLQTKYIEEGR----------IKXXXXXXXXXXXXXXXXXXXKTAXXXXXXXXXXXXXXXXRYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLYI 2406
            ++ FP  +  + E K+   + S   ++N V K+    PK  ++P+S+E+++A K AEE    KPK+ SK ER+A A++RR+ +V+  +++ L +   QT+Y+E+ R          I+      R R       +  +     E+D+ +E EAIKERYLGQKRLTKRRQRRLNERKFVF WD  EDTS DYNPLYK+KH+ QFFGRGHIGGIDI  QKK +G+FY +++ DRRSD QK QE +RL  ++ REAK KWD+R W+EK L +MT RDWRIFRED+ I TKGGNIP  IR W+E G S +LL  II K  Y EPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL+WI++LP+L++ME  E GPYAII+ PTR+LA QI EET+KFG+PLGIK V++IGG SRE+Q  +LR+GAEIVIATPGRL DVLENRY+VLNQCTYV++DE D+MIDM FE +V  ILSYLP   EKPDT+DAED  KLL NF T  KYRQTVMFTATM PSVERLAR++LRRPA VYIGS GKPTER +Q++YM++E +KR KL +I++    PP+IIFVNQKKGAD+LAKGL+K+   A+  HGGK QE REYA+A+LKS +K+ILVAT++AGRGIDIKDVSLV+NYDM KTID+Y+HR+GRTGRAGK G AI+ +TK+D+P++YDLK+LL +SP+S  P +L +HPDAQ K G   +KKRR +ET+YI
Sbjct:  156 RKPFPPHQAAKSEPKL---ETSTTGDKNTVTKS-TLPPK--KVPISLEDLIAKKKAEEAELVKPKFISKEERQAEALRRRQIEVQAQRERQLADLKKQTEYLEQAREAERSRRSEYIERDYRRARGRGIQNKPSNDSQAHRNTEKDETKEMEAIKERYLGQKRLTKRRQRRLNERKFVFDWDAAEDTSQDYNPLYKEKHQIQFFGRGHIGGIDIKQQKKEIGRFYARLLGDRRSDTQKVQEERRLVGVARREAKQKWDDRHWSEKALSQMTERDWRIFREDYGIATKGGNIPCPIRSWDEMGGSPELLQ-IIRKVGYTEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLNWIQRLPKLERMEDTEQGPYAIIMAPTRELAQQIEEETVKFGRPLGIKTVSLIGGLSREDQALKLRMGAEIVIATPGRLNDVLENRYLVLNQCTYVVLDEADKMIDMGFEPEVNNILSYLPVTNEKPDTEDAEDDSKLLSNFATKHKYRQTVMFTATMPPSVERLARSYLRRPAVVYIGSAGKPTERVEQIVYMVSEQEKRKKLLQILNGGIDPPVIIFVNQKKGADMLAKGLDKLGHSAVVLHGGKNQEQREYALASLKSGQKEILVATDVAGRGIDIKDVSLVINYDMSKTIDDYVHRIGRTGRAGKSGTAITLLTKEDTPVYYDLKQLLLQSPVSTCPHDLANHPDAQTKPGIAAAKKRRADETVYI 874          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. TrEMBL
Match: A0A2H1CBR0 (DEAD/DEAH box helicase OS=Fasciola hepatica OX=6192 GN=D915_07936 PE=4 SV=1)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 446/726 (61.43%), Postives = 559/726 (77.00%), Query Frame = 1
Query:  259 KESFPDIEDFEVEKKIPFNDQSKQNNENAVFKTPNAVPKHAQIPLSVEEVLXXXXXXXXXXXXXXYFSKAEREALAIQRRXXXXXXXXXXXXXXXNLQTKYIEEGR----------IKXXXXXXXXXXXXXXXXXXXKTAXXXXXXXXXXXXXXXXRYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLYI 2406
            ++ FP  +  + E K+   + S   ++N V K+    PK  ++P+S+E+++A K AEE    KPK+ SK ER+A A++RR+ +V+  +++ L +   QT+Y+E+ R          I+      R R       +  +     E+D+ +E EAIKERYLGQKRLTKRRQRRLNERKFVF WD  EDTS DYNPLYK+KH+ QFFGRGHIGGIDI  QKK +G+FY +++ DRRSD QK QE +RL  ++ REAK KWD+R W+EK L +MT RDWRIFRED+ I TKGGNIP  IR W+E G S +LL  II K  Y EPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL+WI++LP+L++ME  E GPYAII+ PTR+LA QI EET+KFG+PLGIK V++IGG SRE+Q  +LR+GAEIVIATPGRL DVLENRY+VLNQCTYV++DE D+MIDM FE +V  ILSYLP   EKPDT+DAED  KLL NF T  KYRQTVMFTATM PSVERLAR++LRRPA VYIGS GKPTER +Q++YM++E +KR KL +I++    PP+IIFVNQKKGAD+LAKGL+K+   A+  HGGK QE REYA+A+LKS +K+ILVAT++AGRGIDIKDVSLV+NYDM KTID+Y+HR+GRTGRAGK G AI+ +TK+D+P++YDLK+LL +SP+S  P +L +HPDAQ K G   +KKRR +ET+YI
Sbjct:  112 RKPFPPHQAAKSEPKL---ETSTTGDKNTVTKS-TLPPK--KVPISLEDLIAKKKAEEAELVKPKFISKEERQAEALRRRQIEVQAQRERQLADLKKQTEYLEQAREAERSRRSEYIERDYRRARGRGIQNKPSNDSQAHRNTEKDETKEMEAIKERYLGQKRLTKRRQRRLNERKFVFDWDAAEDTSQDYNPLYKEKHQIQFFGRGHIGGIDIKQQKKEIGRFYARLLGDRRSDTQKVQEERRLVGVARREAKQKWDDRHWSEKALSQMTERDWRIFREDYGIATKGGNIPCPIRSWDEMGGSPELLQ-IIRKVGYTEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLNWIQRLPKLERMEDTEQGPYAIIMAPTRELAQQIEEETVKFGRPLGIKTVSLIGGLSREDQALKLRMGAEIVIATPGRLNDVLENRYLVLNQCTYVVLDEADKMIDMGFEPEVNNILSYLPVTNEKPDTEDAEDDSKLLSNFATKHKYRQTVMFTATMPPSVERLARSYLRRPAVVYIGSAGKPTERVEQIVYMVSEQEKRKKLLQILNGGIDPPVIIFVNQKKGADMLAKGLDKLGHSAVVLHGGKNQEQREYALASLKSGQKEILVATDVAGRGIDIKDVSLVINYDMSKTIDDYVHRIGRTGRAGKSGTAITLLTKEDTPVYYDLKQLLLQSPVSTCPHDLANHPDAQTKPGIAAAKKRRADETVYI 830          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Cavefish
Match: ddx23 (DEAD-box helicase 23 [Source:NCBI gene;Acc:103037499])

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 369/570 (64.74%), Postives = 455/570 (79.82%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNPLYK+KH+ Q +GRG I GID+  QK+    FY  +M  RR+  +K+QE  RLK +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+E  L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E ++ GPYA+IL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL +CTYV++DE DRMIDM FE DV+KIL Y+P   +KPDTD+AED EK+ QNF +   KYRQTVMFTATM P+VERLAR++LRR A VYIGS GKP ER +Q + +++E +KR KL E++SR F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI DVS+VLNYDM K I++YIHR+GRTGRAGK G+A++F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  246 RYLGGMKKRRRTRHL-NDRKFVFEWDASEDTSIDYNPLYKEKHQVQLYGRGFIAGIDLKQQKRDQSHFYGDLMEKRRTMEEKEQEELRLKKMRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRNWKEFDLPPHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEDSDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLGRCTYVVLDEADRMIDMGFEPDVQKILEYIPVTNQKPDTDEAEDPEKMTQNFESGKHKYRQTVMFTATMPPAVERLARSYLRRAAVVYIGSAGKPHERVEQKVILMSEGEKRKKLLEVLSRGFEPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYIHRIGRTGRAGKSGVAMTFLTKEDSSVFYDLKQAILESPVSTCPPELTNHPDAQHKPGTILTKKRR-EETIF 812          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Cavefish
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:103041720])

HSP 1 Score: 288.5 bits (737), Expect = 3.312e-80
Identity = 163/419 (38.90%), Postives = 246/419 (58.71%), Query Frame = 1
Query: 1024 HLDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWI-EKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSR-NFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
             L  MT  +   +R +   IT KG   P  I+ W + G S K+L+ +  K  Y++PTPIQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I ++ P    +E+ E GP A+I+ PTR+LA+QI +E  KF +PLG++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT   ++E LAR  L +P  V +G         +Q + ++ E++K  KL EI+        +IIFV++++ AD L K L K +   +S HGG  Q  R+  +   K+    ++VAT++A RG+D+K + LV+NY+ P   ++Y+HR GRTGRAG +G A +F+T + +
Sbjct:  343 ELARMTPEEVNEYRLELEGITVKGKGCPKPIKTWVQCGTSMKVLNAL-KKHNYEKPTPIQSQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRP----LEEGE-GPIAVIMTPTRELALQITKECKKFSKPLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANSGRVTNLRRVTYVVVDEADRMFDMGFEPQVMRIMDNV-----RPD--------------------RQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDKKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCMSLHGGIDQYDRDSIINDFKNGACRLMVATSVAARGLDVKQLILVVNYNCPNHYEDYVHRAGRTGRAGNKGFAYTFITDEQA 730          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Cavefish
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103046784])

HSP 1 Score: 263.848 bits (673), Expect = 3.594e-75
Identity = 159/460 (34.57%), Postives = 246/460 (53.48%), Query Frame = 1
Query:  922 RRSDGQKDQEAKRLKNISNREAKVKW--DERPWTEKHL----DEMTNRDWR---IFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDK----LREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDD 2259
            R   G+      +  N   R  K  W  DE P  EK+      ++T R  +    +R    +T KG + P  +  + EA   + +++VI NK  + EPTPIQ Q  P+ L  +D++G+A+TGSGKT A+L+P +  I   P L+  +    GP  ++L PTR+LA Q+ +   ++G+   +K+  I GG  +  Q+  L  G EI IATPGRL+D LE     L +CTY+++DE DRM+DM FE  +RKI+  +     +PD                    RQT+M++AT    V +LA  FL+    + IG++         Q++ +  + +K DK    L EIMS       IIFV  K+  D L + + +    A+  HG K Q+ R++ +   K  +  IL+AT++A RG+D++DV  V+NYD P + ++YIHR+GRT R+ K G A +F T ++
Sbjct:   21 RFGSGRSGPPTSKFGNPGERLRKRHWNLDELPKFEKNFYKEHPDITRRSMQEVEQYRRAKEVTVKGRDCPKPVMKFNEATFPNYVMEVI-NKQAWSEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPFLEHGD----GPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQI-----RPD--------------------RQTLMWSATWPKEVRQLAEDFLKEYVQINIGALQLSANHNILQIVDVCNDGEKDDKLIRLLEEIMSEK-ENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKYGKACILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSQKTGTAYTFFTPNN 449          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Cavefish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 259.61 bits (662), Expect = 1.028e-73
Identity = 145/412 (35.19%), Postives = 224/412 (54.37%), Query Frame = 1
Query: 1066 EDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLS--WIEKLPRLQKMEQNELG-----PYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPI-IIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYD 2277
            +D  +   G N P  I  + +  + + ++  I   ++Y  PTP+Q+ AIPI    RD++  A+TGSGKTAAFL+P+LS  + +      + E    G     P +++L PTR+LA+QI +E  KF     ++   + GG    +Q+  L  G  +++ATPGRLVD++E   I L+ C Y+++DE DRM+DM FE  +R+I+                      Q+    +  RQT+MF+AT    ++ LAR FL     + +G +G  +E   Q +  + E+ KR  L ++++      + ++FV  KKGAD L   L +      S HG + Q  RE A+   +S    ILVAT +A RG+DI +V  V+N+D+P  I+EY+HR+GRTGR G  GLA SF    +S +  D
Sbjct:  122 DDIPVEATGHNSPPHIDSFHDVEMGEIIMGNIA-LSRYTRPTPVQKHAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQAENGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVE---------------------QDTMPPKGLRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALNQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKD 511          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Cavefish
Match: DDX41 (DEAD-box helicase 41 [Source:NCBI gene;Acc:103035623])

HSP 1 Score: 259.225 bits (661), Expect = 1.306e-73
Identity = 146/404 (36.14%), Postives = 229/404 (56.68%), Query Frame = 1
Query: 1063 REDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSW-IEKLPRLQKMEQNELGPYAIILVPTRDLAIQ---ILEETMKFGQPLG---IKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTK 2253
            R+ + I  +G  IP  I+ + E      +L  +  K     PTPIQ Q IP  L  RD+IG+A TGSGKT  F +P++ + +E+  RL   ++   GPY +I+ P+R+LA Q   I+E   K  +  G   +++   IGG S +EQ+  ++ G  +++ATPGRL+D+L  + + L+ C Y+ +DE DRMIDM FE D+R I SY                          +  RQT++F+ATM   ++  A++ L +P T+ +G  G  +    Q +  + E  K   L E + +   PP++IF  +K   D + + L    ++A++ HGGK QE R  A+ A K  +KD+LVAT++A +G+D   +  V+NYDMP+ I+ Y+HR+GRTGR+GK G+A +F+ K
Sbjct:  156 RKKYHILVEGDGIPAPIKSFREMKFPQAILKGL-KKKGIVHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPIIMFCLEQEKRLPFCKRE--GPYGLIICPSRELARQTHSIIEYYCKLLEDEGAPQMRSALCIGGMSVKEQMEVVKHGVHMMVATPGRLMDLLNKKMVSLDICRYLALDEADRMIDMGFEEDIRTIFSYF-------------------------KGQRQTLLFSATMPKKIQNFAKSALVKPITINVGRAGAASLDVIQEVEYVKEEAKMVYLLECLQKT-PPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFKEGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGKTGVATTFINK 530          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 394/682 (57.77%), Postives = 524/682 (76.83%), Query Frame = 1
Query:  388 PLSVEEVLXXXXXXXXXXXXXXYFSKAEREALAIQRRXXXXXXXXXXXXXXXNLQTKYIEEGR---------IKXXXXXXXXXXXXXXXXXXXKTAXXXXXXXXXXXXXXXXRYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            PLS+EE++A K AE+EAE+KPK+ +K EREA A++RR ++V+E ++    E+  +  + EEG+          +    +RR R +       D+   + E+D+++E +AIK+RYLGQ +  +R +R  N+RKFVF WD GEDTS D+NP+YK++H  Q +GRG++ GID+  QKK   +FY  ++  RR+  +KDQE  RLK    +EAK +WD+R W++K L+EM  RDWRIFRED++ITTKGG IPN IR W+E+ L   + +VI  K  YK+PTPIQRQAIPIGLQNRDIIG+AETGSGKTAAFLIPLL WI  LP++ ++E  + GPYA+IL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G +IVIATPGRL+DVLENRY+VL++CTYV++DE DRMIDM FE DV++IL ++P + +KPDTDDAED +K+  NF +   KYRQTVMFTATM  +VERLAR++LRRPA VYIGS+GKP ER +Q ++++ E++KR KL E++SR F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI DVS+VLNYDM K I++Y HR+GRTGRAGK G++++F+TK+D+ +FYDLK+ +  SP+S+ P EL +HPDAQ K GT  +KKRR EET++
Sbjct:   70 PLSLEEMIARKKAEQEAEQKPKFLTKVEREAEALRRRSQQVEEQRRAMEEERKKRMVFQEEGKKMMEDPYERDRRERRERRERETETSLNEDDRNKIREEKDREKEMQAIKDRYLGQPKKRRRVRRL-NDRKFVFDWDAGEDTSVDHNPIYKERHSVQLYGRGYVAGIDLKQQKKEQSKFYGDLLERRRTQEEKDQEEVRLKKERKKEAKQRWDDRHWSQKKLEEMCERDWRIFREDYNITTKGGKIPNPIRLWKESILPSHIREVI-EKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLRRPAVVYIGSVGKPIERVEQRVFIMGESEKRKKLLELLSRGFEPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFLTKEDAAVFYDLKQAMLGSPVSQCPPELANHPDAQHKPGTILTKKRR-EETIF 748          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 278.485 bits (711), Expect = 1.178e-77
Identity = 153/415 (36.87%), Postives = 238/415 (57.35%), Query Frame = 1
Query: 1027 LDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMS-RNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKD 2256
            L +MT  +   +R +   +  KG   P  I+ W + G+S K+L+ +  K  Y++PTPIQ QAIP  +  RD+IG+A+TGSGKT  FL+P+   +     L++ E    GP  +I+ PTR+LA+QI +E  KF + L ++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R     + TY+++DE DRM DM FE  V +I+      T +PD                    RQTVMF+AT   ++E LAR  L +P  V +G         +Q + ++ E+ K  KL E++        +I+FV++++ AD L K L K +   +S HGG  Q  R+  +   KS    ++VAT++A RG+D+K + +V+NYD P   ++Y+HRVGRTGRAG +G + +F+T +
Sbjct:  339 LAKMTAEEVSAYRLEMEGVMVKGKGCPKPIKTWVQCGISMKILNTL-KKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQRPLEEGE----GPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIE-----TSRPD--------------------RQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFITSE 723          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.684 bits (657), Expect = 1.448e-74
Identity = 145/406 (35.71%), Postives = 222/406 (54.68%), Query Frame = 1
Query: 1066 EDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWI---------EKLPRLQ---KMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPI-IIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISF 2244
            +D  +   G + P  I  + E  L + ++  +    +Y+ PTP+Q+ AIPI    RD++  A+TGSGKTAAFL+P+LS I         E     Q   K  Q +  P +++L PTR+LA+QI +E  KF     ++   + GG     QV +L+ G  +++ATPGRLVD++E   + L+ C Y+++DE DRM+DM FE  +R+I+                      Q+   T+  RQT+MF+AT    ++ LAR FL     + +G +G  +E   Q +  + E  KR  L ++++      + ++FV  KKGAD L   L        S HG + Q  RE A++  ++  + ILVAT +A RG+DI +V  V+N+D+P  I+EY+HR+GRTGR G  G A SF
Sbjct:   43 DDIPVEATGNDCPPHIESFHELELGEIIMSSV-TLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVE---------------------QDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSF 426          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 252.292 bits (643), Expect = 8.798e-71
Identity = 150/399 (37.59%), Postives = 217/399 (54.39%), Query Frame = 1
Query: 1090 GGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNEL----GPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKR-----DKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDD 2259
            G   P     +   G  ++LL+ +I K+++ +PTPIQ Q IPI L  RDIIG+A+TGSGKTA+F+ P+L  I        M Q EL    GP  +I VPTR+L  QI  E  +FG+   + +V + GG S  EQ   L+ GAEIV+ TPGRL+D ++ +   L + TY++ DE DRM DM FE  VR I +++     +PD                    RQT++++AT +  VE+LAR  L  P  V  G IG+  E   Q + + +    +       L E  S   V   +IFV +K  ++ L+  LE+   +    HG   Q  R   ++  K K   I+VAT++A RG+DI  +  V+NYD+ + ID + HRVGRTGRAG++G A + +T  D
Sbjct:  241 GAAPPKPCSSFGHFGFDEQLLN-LIRKSEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHI--------MAQKELKPGDGPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHV-----RPD--------------------RQTMLYSATFRMRVEKLARDILIDPIRVVQGDIGEANEDVTQRVEIFSNGAAKWNWLCSHLVEFTSSGSV---LIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTHKD 602          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 233.417 bits (594), Expect = 1.332e-67
Identity = 134/366 (36.61%), Postives = 200/366 (54.64%), Query Frame = 1
Query: 1177 YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLEN-RYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLF 2271
            +K+PT IQ +AIP+ LQ +DIIG+AETGSGKT AF +P+L  +   P  Q++       +A++L PTR+LA QI E+    G  +GIK+  ++GG     Q   L     ++IATPGRLVD LEN +   +    Y++MDE DR+++M+FE +V KIL  +P                         K R+T +F+ATM   V++L R  L+ P    + +  +  E+ +Q    +    K   L  I++       IIF +       +A  L  +   AI  HG   Q  R  ++   K K + IL+AT++A RG+DI  V +V+N+D+P    +YIHRVGRT RAG+ G +I+FV++ D  LF
Sbjct:   15 WKQPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQALLDAP--QRL-------FALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFNIRALKYLVMDEADRILNMDFETEVDKILKVIP-------------------------KERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFIPAKFKDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELF 346          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Yeast
Match: PRP28 (RNA binding protein; involved in RNA isomerization at the 5' splice site and for exchange of U6 for U1 snRNA at the 5' splice site; similar to the RNA helicases of the DEAD-box family [Source:SGD;Acc:S000002651])

HSP 1 Score: 332.028 bits (850), Expect = 2.823e-100
Identity = 197/514 (38.33%), Postives = 288/514 (56.03%), Query Frame = 1
Query:  745 NERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDK-LLDVIINKAKYKEPTPIQRQAIPIGL---QNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLG------IKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVI-YMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEK-MNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVT 2250
            N  KF F+W+E EDT + Y+P+                        +A+   +               + K  KN     A+  +  + WTEK L EM  RDWRI +ED++I TKGG + N +R WEE  +  + LL VII + ++  PTPIQR  IP      Q RD +GVA TGSGKT AF+IP+L  + + P      +   GP A+IL PTR+L  QI +ET K  +          K ++I+GG+S EE  F L  G +I++ATPGRL+D LEN  +V+ Q   +++DE D+MID+ FE  V  IL+ +       + D A +              RQT+MFTATM P +E++A  ++++P    IG         +QV+ Y   +  K  KL+ I+++ + PPIIIF+N K+ AD LA+  +K  N+K    HG K QE RE+++   ++ +  I++ATN+A RG+DI +VSLV+N+ + K +D+YIHR+GRTGRA  EG A+SFV+
Sbjct:   89 NGSKFHFSWNESEDTLSGYDPI---------------------VSTRAIDLLW---------------KGKTPKN----AAESSYMGKHWTEKSLHEMNERDWRILKEDYAIVTKGGTVENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKV-----DINADSAVN--------------RQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEPLIQQVVEYADNDEDKFKKLKPIVAK-YDPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVS 542          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 271.552 bits (693), Expect = 1.699e-79
Identity = 150/407 (36.86%), Postives = 236/407 (57.99%), Query Frame = 1
Query: 1060 FREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDKLR---EIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPL 2268
            FR++  +T  G +IP  I  ++EAG  D +L+ +  +  + +PT IQ Q  P+ L  RD++G+A TGSGKT ++ +P +  I   P L   +    GP  ++L PTR+LA+QI  E  KFG    I+   + GG  + +Q+  L  G+EIVIATPGRL+D+LE     L + TY+++DE DRM+DM FE  +RKI+  +     +PD                    RQT+M++AT    V++LA  +L  P  V +GS+    +    Q++ ++++ +KRD+L    E  S++     +IF + K+  D + K L +    A++ HG K Q  R++ +   ++    I+VAT++A RGID+K ++ V+NYDMP  I++Y+HR+GRTGRAG  G AISF T+ +  L
Sbjct:   95 FRKENEMTISGHDIPKPITTFDEAGFPDYVLNEVKAEG-FDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGD----GPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQI-----RPD--------------------RQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNKGL 471          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 262.307 bits (669), Expect = 1.168e-75
Identity = 148/405 (36.54%), Postives = 222/405 (54.81%), Query Frame = 1
Query: 1066 EDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKL-PRLQKMEQNELG-----PYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
            +D  +   G ++P  I  +    L D LL   I  A++ +PTP+Q+ ++PI    RD++  A+TGSGKT  FL P+LS   K  P  Q   Q         P A+I+ PTR+LA QI +E  KF     +KA  + GG+    Q+ ++  G ++++ATPGRL D+LE   I L    Y+++DE DRM+DM FE  +R I+               ED +       T    RQT+MF+AT    ++ LAR FL     + +G +G  +E   Q +  +    K+  L +++S +     +IFV  K+ AD L   L   N +A + HG + Q  RE A+AA +S    +LVAT +A RG+DI +V+ V+NYD+P  +D+Y+HR+GRTGRAG  GLA +F   ++S
Sbjct:  126 DDIPVDASGKDVPEPITEFTSPPL-DGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIV---------------EDCDM------TPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKSALLDLLSASTDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNSENS 508          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 259.225 bits (661), Expect = 1.600e-74
Identity = 145/404 (35.89%), Postives = 223/404 (55.20%), Query Frame = 1
Query: 1066 EDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWI-----EKLP-RLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDD 2259
            ++  +   G ++P  I  +    L D+LL   I  A + +PTP+Q+ +IPI  + RD++  A+TGSGKT  FL PL + +       +P + Q     +  P A++L PTR+LA QI EE  KF     ++   + GG     Q+ ++  G ++++ATPGRL D+LE   + L    Y+++DE DRM+DM FE  +R I+    E  + P  ++                 RQT+MF+AT    ++ LAR FL     + +G +G  +E   Q I  + +  K+  L +++S       +IFV  K+ AD L   L   N KA + HG + Q  RE A++A K+   DILVAT +A RG+DI +V+ V+NYD+P  ID+Y+HR+GRTGRAG  G+A SF   ++
Sbjct:  138 DNIPVDASGKDVPEPILDFSSPPL-DELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIV----EECDMPSVEN-----------------RQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNN 519          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Yeast
Match: RRP3 (Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity [Source:SGD;Acc:S000001107])

HSP 1 Score: 221.09 bits (562), Expect = 1.140e-62
Identity = 137/391 (35.04%), Postives = 205/391 (52.43%), Query Frame = 1
Query: 1108 SIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLS--WIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLEN-RYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLF 2271
            S   + E  L  +L+    N   Y +PTPIQ +AIP  L+  DIIG+A+TGSGKTAAF IP+L+  W ++ P            YA IL PTR+LA QI E     G  +G+++  I+GG +  +Q   L     I+IATPGRL+D LEN +   L +  +++MDE DR++DM F   + +IL  +P                       TQ+ R T +F+ATM   +++L R  L  P    + +  +  +   Q + ++    K   L  +++      +IIF   K  A+ L+     +   A + HG   Q  R  ++   K+ ++ ILVAT++A RG+DI  V +V+NYD+P     YIHRVGRT RAG+ G +IS V++ D  L 
Sbjct:   79 SFESFSELNLVPELIQACKN-LNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRLWHDQEPY-----------YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIP-----------------------TQE-RTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFIGKTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELI 433          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Nematostella
Match: EDO43602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYA5])

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 362/570 (63.51%), Postives = 458/570 (80.35%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLYI 2406
            RYLG  +  ++ +R   +RKFVF WD GEDTS DYNP+YK++H+ Q FGRGHIGGIDI  QKK  G+FY +MM  RR+  +K+QE  RLK   ++E KV +D+R WT+K+L+EMT RDWRIFREDF+I+TKGG IP  IR W+EA + D +L+ I++K  YK+PTPIQRQAIPIGLQNRDIIGVAETGSGKTAAF IPLL WI  LP++++    + GPYA+IL PTR+LA QI EE +KFG+PLGI+ V++IGG SRE+Q FQLRLG EIVIATPGRL+DVLENRY+VLN+C+Y++MDE DRMIDM FE +V+KIL +LP +  KPD++D+ED E LL +     KYRQTVMFTATM P VERLA+ +LRRPA VYIGS+GKP ER +Q +Y++ E QKR KL E+++++  PPIIIFVNQKKGADVLAK LEKM  +A + HGG+ QE RE+A+++LK   KDILVAT++AGRGIDIKDVS V+NYDM KTI++Y HR+GRTGRAGK G+A+SF+T+ DS +FYDLK+LL  SP+S  PSEL +HP+AQ K GT  +KKR+ EET+++
Sbjct:  212 RYLGLNKKKRKIRRL-TDRKFVFDWDTGEDTSNDYNPIYKERHQVQLFGRGHIGGIDIKIQKKEAGKFYAEMMEKRRTIEEKEQEGNRLKKEKDKERKVAFDDRHWTKKNLEEMTERDWRIFREDFNISTKGGRIPFPIRKWKEAQIPDSILE-IVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPLGIRTVSVIGGLSREDQGFQLRLGVEIVIATPGRLIDVLENRYLVLNRCSYIVMDEADRMIDMGFEPEVQKILEHLPVSNVKPDSEDSEDPEHLLTHM-GKDKYRQTVMFTATMPPQVERLAKNYLRRPAVVYIGSVGKPVERVEQRVYLVNEQQKRKKLLELLNKDLEPPIIIFVNQKKGADVLAKSLEKMGFRATTLHGGRNQEQREFALSSLKGGSKDILVATDVAGRGIDIKDVSHVINYDMAKTIEDYTHRIGRTGRAGKTGIAVSFLTQSDSGVFYDLKQLLLSSPVSSCPSELANHPEAQHKPGTVLTKKRK-EETIFV 777          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Nematostella
Match: EDO42894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S034])

HSP 1 Score: 287.345 bits (734), Expect = 4.590e-82
Identity = 159/422 (37.68%), Postives = 241/422 (57.11%), Query Frame = 1
Query: 1027 LDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQK-RDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYD 2277
            L +MT  +   FR    +I  +G N P  ++ W + G+  K+LDV+  K  Y++PTPIQ QAIP+ +  RD+IG+A+TGSGKT AFLIP+   I+  P L++ E    GP AI++ PTR+LAIQI  E  KF +P  ++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R     +CTY+++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT    +E LAR  L +P  + +G         +Q + ++ E+ K    L  +        +++FV ++  AD L K L K +   +S HGG  Q  R+  +A  K+    +++AT++A RG+D+K ++LV+NYD P   ++Y+HRVGRTGRAG +G A +F+T +      D
Sbjct:  107 LAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVL-KKNSYEKPTPIQAQAIPVIMSGRDMIGIAKTGSGKTLAFLIPMFRHIKDQPPLEREE----GPIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQVMRIIDCI-----RPD--------------------RQTVMFSATFPRQMEALARKILDKPIEIQVGGRSVVCSDVEQNVVVIEEDDKFLKLLELLGLYQEQGSVLVFVEKQDSADSLFKDLLKRSYPCLSLHGGMDQFDRDSTIADFKNGVTKLMIATSVAARGLDVKHLNLVVNYDCPNHYEDYVHRVGRTGRAGNKGTAYTFLTPEQGRFAID 498          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Nematostella
Match: EDO49247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX3])

HSP 1 Score: 266.544 bits (680), Expect = 5.668e-78
Identity = 147/421 (34.92%), Postives = 233/421 (55.34%), Query Frame = 1
Query: 1012 WTE-KHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPL------GIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTK 2253
            WT  +++  M        R+ + I  +G +IP  ++ ++E      +L   + K     PTPIQ Q +P  L  RD+IG+A TGSGKT  F +P++ +  +  +    ++NE GPY +I+VP+R+LA Q  E    F + L       ++    IGG+S +EQ   ++ G  +V+ATPGRL+D+L+ R I L+ C Y+++DE DRMIDM FE DVR I SY                          +  RQT++F+ATM   ++  A++ L +P TV +G  G  +    Q +  + +  K   L E + +   PP++IF  +K   D + + L    ++A++ HG K QE R +A+       KD+LVAT++A +G+D  D+  V+N+DMP+ I+ Y+HR+GRTGR GK G+A +F+ K
Sbjct:   12 WTPPRYILHMPKEKIERIRKKWHILVEGDDIPPPVKTFKEMKFPRPIL-AALKKKGITHPTPIQVQGLPAVLTGRDMIGIAFTGSGKTLVFTLPIIMFSLEQEKAMPFQRNE-GPYGMIVVPSRELARQTFEVITHFSRALEAHGFPSLRTNLCIGGSSIKEQSDAMKRGVHMVVATPGRLMDLLDKRIITLDVCRYLVLDEADRMIDMGFEEDVRTIFSYF-------------------------KSQRQTLLFSATMPKKIQNFAKSALVKPVTVNVGRAGAASLDVIQEVEYVKQEAKVVYLLECLQKT-PPPVLIFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQGNKDVLVATDVASKGLDFPDIQHVINFDMPEDIENYVHRIGRTGRCGKTGVATTFINK 404          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Nematostella
Match: EDO43557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY08])

HSP 1 Score: 254.988 bits (650), Expect = 1.385e-73
Identity = 149/405 (36.79%), Postives = 218/405 (53.83%), Query Frame = 1
Query: 1060 FREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVP-----PIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDD 2259
             R+   I   G         +   G  ++++   I K +Y +PT IQ QA+PI L  RDIIG+A+TGSGKTAAFL P L  I   P LQ  +    GP  +I  PTR+L  QI  E  +FG+   I  V + GG ++ EQ   L+ GAEIV+ATPGRL+D ++ +   L++ TY++ DE DRM DM FE  VR I + +     +PD                    RQT++F+AT +  VE L R  L  P  V IG +G+  E   Q++++      +    E +++N V       ++IFV +K  ++ LA  L K + +    HG   Q  R   +   K +E  ILVAT++A RG+DI  +  V+NYD+ + I  + HR+GRTGRAG++G A + +T+ D
Sbjct:   88 LRKKMGIKVSGAMPARPCISFAHFGFDEQMM-ASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGD----GPIVLICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQEGAEIVVATPGRLIDHVKAKATNLHRVTYLVFDEADRMFDMGFEPQVRSIANNV-----RPD--------------------RQTLLFSATFKKKVEHLCRDILVDPVRVVIGELGEANEDVTQIVHIFNSMPSK---WEWLTQNLVSFASAGSVLIFVTKKLNSEELATNLRKNDFEVALLHGDMDQFERSKVLGQFKKREIPILVATDVAARGLDIPSIKTVINYDVARDITTHTHRIGRTGRAGEKGNAYTLLTQSD 459          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 251.136 bits (640), Expect = 4.322e-73
Identity = 137/406 (33.74%), Postives = 220/406 (54.19%), Query Frame = 1
Query: 1060 FREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDK----LREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
            +R    +T  G N+P  +  +EE+   D  +     +  + EPT IQ Q  P+ L  R+++G+A+TGSGKT +F++P +  I   P LQ  +    GP  ++L PTR+LA Q+ E     G+   +++  I GG  +  Q+ +L  G EI IATPGRL+D+LE+R   L +CTY+++DE DRM+DM FE  +R I+  +     +PD                    RQT+M++AT    V+ LA  FL     + +GS+G     +  Q++ +  +++K  K    L EIM        +IF   K+ AD L + L      A+  HG K Q  R++ ++  +     ILVAT++A RG+DI D+  V+N+D P   ++Y+HR+GRT R+ + G + +F T +++
Sbjct:   40 YRRSKDLTVNGRNVPKPVTTFEESAFPD-YIQSYFKREGFTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPLLQPGD----GPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLESRKTNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQI-----RPD--------------------RQTLMWSATWPKEVQGLAHDFLSDYVHITVGSLGLTANHKILQIVDVCEDHEKEHKLLKLLEEIMGEK-ENKTLIFTETKRRADELTRKLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDIKFVINFDFPNCTEDYVHRIGRTARSDRTGTSYTFFTVNNA 414          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Medaka
Match: ddx23 (DEAD-box helicase 23 [Source:NCBI gene;Acc:101157453])

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 363/570 (63.68%), Postives = 454/570 (79.65%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNP+YK+KH+ Q +GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RLK +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+E  L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E ++ GPYA+IL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL +CTYV++DE DRMIDM FE DV+KIL Y+P   +KPDTD+AED EK+  NF +   KYRQTVMFTATM P+VERLAR++LRR A VYIGS GKP ER +Q + +++E +KR K+ E+++  F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI DVS+V+NYDM K I++YIHR+GRTGRAGK G+A++F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  235 RYLGGIKKRRRTRHL-NDRKFVFEWDASEDTSVDYNPIYKEKHQVQLYGRGFIAGIDLKQQKRDQSRFYGDLMEKRRTLEEKEQEETRLKKVRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRNWKEYALPAHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEDSDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFKLRMGCEIVIATPGRLIDVLENRYLVLGRCTYVVLDEADRMIDMGFEPDVQKILEYIPVTNQKPDTDEAEDPEKMTMNFESGKHKYRQTVMFTATMPPAVERLARSYLRRAAVVYIGSAGKPHERVEQKVMLMSEGEKRKKMLEVLASGFEPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVINYDMAKNIEDYIHRIGRTGRAGKSGVAMTFLTKEDSAVFYDLKQAILESPVSNCPPELANHPDAQHKPGTILTKKRR-EETIF 801          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Medaka
Match: ddx23 (DEAD-box helicase 23 [Source:NCBI gene;Acc:101157453])

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 363/570 (63.68%), Postives = 454/570 (79.65%), Query Frame = 1
Query:  697 RYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHT-TQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLY 2403
            RYLG  +  +R +   N+RKFVF WD  EDTS DYNP+YK+KH+ Q +GRG I GID+  QK+   +FY  +M  RR+  +K+QE  RLK +  +EAK +WD+R W++K LDEMT+RDWRIFRED+SITTKGG IPN IR W+E  L   +L+VI +K  YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLL WI  LP++ ++E ++ GPYA+IL PTR+LA QI EET+KFG+PLGI+ V +IGG SRE+Q F+LR+G EIVIATPGRL+DVLENRY+VL +CTYV++DE DRMIDM FE DV+KIL Y+P   +KPDTD+AED EK+  NF +   KYRQTVMFTATM P+VERLAR++LRR A VYIGS GKP ER +Q + +++E +KR K+ E+++  F PPIIIFVNQKKG DVLAK LEKM   A + HGGKGQE RE+A++ LK+  KDILVAT++AGRGIDI DVS+V+NYDM K I++YIHR+GRTGRAGK G+A++F+TK+DS +FYDLK+ + ESP+S  P EL +HPDAQ K GT  +KKRR EET++
Sbjct:  210 RYLGGIKKRRRTRHL-NDRKFVFEWDASEDTSVDYNPIYKEKHQVQLYGRGFIAGIDLKQQKRDQSRFYGDLMEKRRTLEEKEQEETRLKKVRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRNWKEYALPAHILEVI-DKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEDSDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFKLRMGCEIVIATPGRLIDVLENRYLVLGRCTYVVLDEADRMIDMGFEPDVQKILEYIPVTNQKPDTDEAEDPEKMTMNFESGKHKYRQTVMFTATMPPAVERLARSYLRRAAVVYIGSAGKPHERVEQKVMLMSEGEKRKKMLEVLASGFEPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVINYDMAKNIEDYIHRIGRTGRAGKSGVAMTFLTKEDSAVFYDLKQAILESPVSNCPPELANHPDAQHKPGTILTKKRR-EETIF 776          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Medaka
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:101161571])

HSP 1 Score: 286.574 bits (732), Expect = 3.617e-80
Identity = 161/416 (38.70%), Postives = 241/416 (57.93%), Query Frame = 1
Query: 1024 HLDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSR-NFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKD 2256
             L +MT  +   +R +   I  KG   P  I+ W + G+S K+L  +  K  Y +PTPIQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I     L++ E    GP ++I+ PTR+LA+QI +E  KF + LG++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT   ++E LAR  L +P  V +G         +Q + ++ E+QK  KL EI+        +IIFV++++ AD L K L K +   +S HGG  Q  R+  +   K+    ++VAT++A RG+D+K + LV+NY+ P   ++Y+HR GRTGRAG +G A +F+T+D
Sbjct:  246 ELAKMTTEEVNAYRLELEGIMVKGKGCPKPIKTWVQCGVSMKILSAL-KKQGYDKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEESE----GPISVIMTPTRELALQITKECKKFSKALGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANSGRVTNLRRATYVVLDEADRMFDMGFEPQVMRIVDNV-----RPD--------------------RQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQHVLVIEEDQKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKNGVCRLMVATSVAARGLDVKQLILVVNYNCPNHYEDYVHRAGRTGRAGNKGYAYTFITED 631          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Medaka
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:101161571])

HSP 1 Score: 286.96 bits (733), Expect = 1.172e-79
Identity = 161/416 (38.70%), Postives = 241/416 (57.93%), Query Frame = 1
Query: 1024 HLDEMTNRDWRIFREDF-SITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVL---ENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSR-NFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKD 2256
             L +MT  +   +R +   I  KG   P  I+ W + G+S K+L  +  K  Y +PTPIQ QAIP  +  RD+IG+A+TGSGKT AFL+P+   I     L++ E    GP ++I+ PTR+LA+QI +E  KF + LG++ V + GG    EQ+ +L+ GAEI++ TPGR++D+L     R   L + TYV++DE DRM DM FE  V +I+  +     +PD                    RQTVMF+AT   ++E LAR  L +P  V +G         +Q + ++ E+QK  KL EI+        +IIFV++++ AD L K L K +   +S HGG  Q  R+  +   K+    ++VAT++A RG+D+K + LV+NY+ P   ++Y+HR GRTGRAG +G A +F+T+D
Sbjct:  356 ELAKMTTEEVNAYRLELEGIMVKGKGCPKPIKTWVQCGVSMKILSAL-KKQGYDKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEESE----GPISVIMTPTRELALQITKECKKFSKALGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANSGRVTNLRRATYVVLDEADRMFDMGFEPQVMRIVDNV-----RPD--------------------RQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQHVLVIEEDQKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKNGVCRLMVATSVAARGLDVKQLILVVNYNCPNHYEDYVHRAGRTGRAGNKGYAYTFITED 741          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Medaka
Match: ENSORLT00000031911.1 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101171584])

HSP 1 Score: 271.166 bits (692), Expect = 1.372e-77
Identity = 152/446 (34.08%), Postives = 243/446 (54.48%), Query Frame = 1
Query:  952 AKRLKNISNREAKVKWD-------ERPWTEKH--LDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDKLREIMSRNFVP---PIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVT 2250
             K+  N  +R  + KWD       E+ +  +H  ++ M+  D   FR    IT +G   P  +  + +A     ++DV++ +  +KEPT IQ Q  P+ L  RD++G+A+TGSGKT A+L+P +  I   P L + +    GP  ++L PTR+LA Q+ +    +G+   IK+  + GG  +  Q+  L  G EI IATPGRL+D LE+    L +CTY+++DE DRM+DM FE  +RKI+  +     +PD                    RQT+M++AT    V +LA  FL+    + IG++         Q++ + TE++K  KL ++M           IIFV  KK  D L + + +    A+  HG K Q  R++ ++  +S +  +L+AT++A RG+D++DV  V+NYD P + ++YIHR+GRT R+  +G A +F T
Sbjct:   30 GKKFGNPGDRLRRKKWDLDQLPKFEKNFYSEHAEVERMSQFDVEEFRRKKEITVRGSGCPKPLTSFHQAQFPQYVIDVLMQQ-NFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLDRGD----GPICLVLAPTRELAQQVQQVACDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQI-----RPD--------------------RQTLMWSATWPKEVRQLAEDFLKEYVQINIGALELSANHNILQIVDVCTESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLSEFRSGKAPVLIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTNKGTAYTFFT 445          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Planmine SMEST
Match: SMESG000068237.1 (SMESG000068237.1)

HSP 1 Score: 1314.29 bits (3400), Expect = 0.000e+0
Identity = 793/793 (100.00%), Postives = 793/793 (100.00%), Query Frame = 1
Query:   31 MDDLVNNYQSDQETVDPNQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSYNENNEVEFKKLKRGKESFPDIEDFEVEKKIPFNDQSKQNNENAVFKTPNAVPKHAQIPLSVEEVLXXXXXXXXXXXXXXYFSKAEREALAIQRRXXXXXXXXXXXXXXXNLQTKYIEEGRIKXXXXXXXXXXXXXXXXXXXKTAXXXXXXXXXXXXXXXXRYLGXXXXXXXXXXXXNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDXXXXXXXXXXXXXXXXXXXHPDAQQKYGTFTSKKRRNEETLYIA 2409
            MDDLVNNYQSDQETVDPNQVRKSEEIKKSKKKKEKKEKKEKKPRKEKKEKKKHRKRRHENSYNENNEVEFKKLKRGKESFPDIEDFEVEKKIPFNDQSKQNNENAVFKTPNAVPKHAQIPLSVEEVLATKHAEEEAEKKPKYFSKAEREALAIQRREEKVKESKKKALYEKNLQTKYIEEGRIKSRDGDRRSRRSHGDGRSGDKTAEQNEEDKKREEEAIKERYLGQKRLTKRRQRRLNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDLKELLKESPLSEIPSELLSHPDAQQKYGTFTSKKRRNEETLYIA
Sbjct:    1 MDDLVNNYQSDQETVDPNQVRKSEEIKKSKKKKEKKEKKEKKPRKEKKEKKKHRKRRHENSYNENNEVEFKKLKRGKESFPDIEDFEVEKKIPFNDQSKQNNENAVFKTPNAVPKHAQIPLSVEEVLATKHAEEEAEKKPKYFSKAEREALAIQRREEKVKESKKKALYEKNLQTKYIEEGRIKSRDGDRRSRRSHGDGRSGDKTAEQNEEDKKREEEAIKERYLGQKRLTKRRQRRLNERKFVFAWDEGEDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRSDGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDLKELLKESPLSEIPSELLSHPDAQQKYGTFTSKKRRNEETLYIA 793          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Planmine SMEST
Match: SMESG000033908.1 (SMESG000033908.1)

HSP 1 Score: 289.271 bits (739), Expect = 1.539e-84
Identity = 153/396 (38.64%), Postives = 238/396 (60.10%), Query Frame = 1
Query: 1078 ITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
            +T KG NI   I  + E  LS +++ VI N  K+ EPTPIQ Q +P+ L  R+++GVA TGSGKTA++LIP +  ++  P L++ +    GP  +I+VPTR+LA Q+      F + +GI++V + GG ++ +Q+ QLR GAEI++ATPGRL+D+L++    L++ TYV++DE DRM+DM FE  +RKI                         F   ++ RQT+M++AT    V+RLA+ FL +   V IGS         +Q++ +L E  K  +L E++S+     +I+F   KK AD++   L     +  + HG K Q  REY +   + +  +ILVAT++A RG+D+ D+ +V+NYD P   ++YIHR+GRTGR GK G++ +F  + +S
Sbjct:  127 MTVKGDNINKPIFSFNEIDLSREIMSVIRNN-KWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGD----GPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRSGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKI-------------------------FSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNS 492          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Planmine SMEST
Match: SMESG000033916.1 (SMESG000033916.1)

HSP 1 Score: 288.5 bits (737), Expect = 2.045e-84
Identity = 153/396 (38.64%), Postives = 238/396 (60.10%), Query Frame = 1
Query: 1078 ITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGIDIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
            +T KG NI   I  + E  LS +++ VI N  K+ EPTPIQ Q +P+ L  R+++GVA TGSGKTA++LIP +  ++  P L++ +    GP  +I+VPTR+LA Q+      F + +GI++V + GG ++ +Q+ QLR GAEI++ATPGRL+D+L++    L++ TYV++DE DRM+DM FE  +RKI                         F   ++ RQT+M++AT    V+RLA+ FL +   V IGS         +Q++ +L E  K  +L E++S+     +I+F   KK AD++   L     +  + HG K Q  REY +   + +  +ILVAT++A RG+D+ D+ +V+NYD P   ++YIHR+GRTGR GK G++ +F  + +S
Sbjct:  121 MTVKGDNINKPIFSFNEIDLSREIMSVIRNN-KWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGD----GPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRNGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKI-------------------------FSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNS 486          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Planmine SMEST
Match: SMESG000033348.1 (SMESG000033348.1)

HSP 1 Score: 283.878 bits (725), Expect = 3.004e-82
Identity = 154/415 (37.11%), Postives = 241/415 (58.07%), Query Frame = 1
Query: 1078 ITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGI-------------------DIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
            +T KG NI   I  ++E  LS +++ VI N  K+ EPTPIQ Q +P+ L  R+++GVA TGSGKTA++LIP +  ++  P L++ +    GP  +I+VPTR+LA Q+      F Q +GI++V + GG ++ +Q+ QLR GAEI++ATPGRL+D+L++    L++ TYV++DE DRM+DM FE  +RKI                         F   ++ RQT+M++AT    V+RLA+ FL +   V IGS         +Q++ ++ E+ K  +L EI+S+N    +I+F   KK AD++   L     +  + HG K Q  R+Y +   + +  +ILVAT++A RG+                   +I D+ +V+NYD P   ++YIHR+GRTGR  K GL+ +F  +++S
Sbjct:  174 MTVKGDNINKPIFSFDEIDLSREIMSVIRNN-KWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGD----GPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKI-------------------------FSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLVIPNYKWVINLNLLAYRYSNIDDIKIVINYDFPNQFEDYIHRIGRTGRKDKTGLSYTFFNENNS 558          
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Planmine SMEST
Match: SMESG000033348.1 (SMESG000033348.1)

HSP 1 Score: 283.493 bits (724), Expect = 3.409e-82
Identity = 154/415 (37.11%), Postives = 241/415 (58.07%), Query Frame = 1
Query: 1078 ITTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTRDLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGRLVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPDTDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYIGSIG-KPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADVLAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGI-------------------DIKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDS 2262
            +T KG NI   I  ++E  LS +++ VI N  K+ EPTPIQ Q +P+ L  R+++GVA TGSGKTA++LIP +  ++  P L++ +    GP  +I+VPTR+LA Q+      F Q +GI++V + GG ++ +Q+ QLR GAEI++ATPGRL+D+L++    L++ TYV++DE DRM+DM FE  +RKI                         F   ++ RQT+M++AT    V+RLA+ FL +   V IGS         +Q++ ++ E+ K  +L EI+S+N    +I+F   KK AD++   L     +  + HG K Q  R+Y +   + +  +ILVAT++A RG+                   +I D+ +V+NYD P   ++YIHR+GRTGR  K GL+ +F  +++S
Sbjct:  167 MTVKGDNINKPIFSFDEIDLSREIMSVIRNN-KWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGD----GPICLIVVPTRELAQQVQTVANDFSQSVGIRSVCVYGGANKGDQIRQLRYGAEIIVATPGRLIDLLQSSITNLHRTTYVVLDEADRMLDMGFEPQIRKI-------------------------FSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEIIDEHAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLVIPNYKWVINLNLLAYRYSNIDDIKIVINYDFPNQFEDYIHRIGRTGRKDKTGLSYTFFNENNS 551          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX230.000e+063.86DEAD-box helicase 23 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX463.119e-7738.33DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX463.167e-7738.33DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX431.559e-7536.22DEAD-box helicase 43 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX414.663e-7533.92DEAD-box helicase 41 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx-230.000e+062.11DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
F53H1.11.987e-7937.80pep chromosome:WBcel235:IV:1297400:1309644:-1 gene... [more]
F53H1.18.221e-7837.80pep chromosome:WBcel235:IV:1297222:1309652:-1 gene... [more]
vbh-11.821e-7636.72Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-11.821e-7636.72Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG103330.000e+067.61gene:FBgn0032690 transcript:FBtr0081072[more]
vas5.946e-8039.49gene:FBgn0283442 transcript:FBtr0445187[more]
vas5.946e-8039.49gene:FBgn0283442 transcript:FBtr0445185[more]
vas5.946e-8039.49gene:FBgn0283442 transcript:FBtr0445186[more]
CG62271.076e-7938.04gene:FBgn0030631 transcript:FBtr0074011[more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx230.000e+064.39DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx230.000e+063.05DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
CR936486.11.110e-13166.45pep chromosome:GRCz11:CHR_ALT_CTG23_2_1:14207403:1... [more]
ddx465.674e-7739.14DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
DDX172.948e-7634.38si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd90.000e+063.86ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GEN... [more]
ankrd90.000e+063.86ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GEN... [more]
ankrd90.000e+063.86ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GEN... [more]
ankrd90.000e+063.86ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GEN... [more]
ankrd90.000e+062.46ankyrin repeat domain 9 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx230.000e+063.86DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
Ddx435.018e-7836.81DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:... [more]
Ddx462.181e-7738.33DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
Ddx462.181e-7738.33DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
Ddx418.126e-7533.92DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 [Source:... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BUQ8|DDX23_HUMAN0.000e+063.86Probable ATP-dependent RNA helicase DDX23 OS=Homo ... [more]
sp|Q5RC67|DDX23_PONAB0.000e+063.51Probable ATP-dependent RNA helicase DDX23 OS=Pongo... [more]
sp|Q5BCU6|PRP28_EMENI4.268e-17350.19Pre-mRNA-splicing ATP-dependent RNA helicase prp28... [more]
sp|Q2UH00|PRP28_ASPOR2.518e-17250.49Pre-mRNA-splicing ATP-dependent RNA helicase prp28... [more]
sp|A1CX72|PRP28_NEOFI2.789e-17250.48Pre-mRNA-splicing ATP-dependent RNA helicase prp28... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V9R00.000e+064.35Putative dead box ATP-dependent RNA helicase OS=Sc... [more]
G4V9R10.000e+064.06Putative dead box ATP-dependent RNA helicase OS=Sc... [more]
A0A0R3WBU90.000e+062.80Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A4E0RA850.000e+061.43DEAD box ATP dependent RNA helicase OS=Fasciola he... [more]
A0A2H1CBR00.000e+061.43DEAD/DEAH box helicase OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx230.000e+064.74DEAD-box helicase 23 [Source:NCBI gene;Acc:1030374... [more]
ddx463.312e-8038.90DEAD-box helicase 46 [Source:NCBI gene;Acc:1030417... [more]
DDX53.594e-7534.57probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx3xb1.028e-7335.19DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
DDX411.306e-7336.14DEAD-box helicase 41 [Source:NCBI gene;Acc:1030356... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx230.000e+057.77DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx461.178e-7736.87DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ENSPMAT00000003898.11.448e-7435.71pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx428.798e-7137.59DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ENSPMAT00000000216.11.332e-6736.61pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRP282.823e-10038.33RNA binding protein; involved in RNA isomerization... [more]
DBP21.699e-7936.86ATP-dependent RNA helicase of the DEAD-box protein... [more]
DED11.168e-7536.54ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP11.600e-7435.89Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
RRP31.140e-6235.04Protein involved in rRNA processing; required for ... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436020.000e+063.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428944.590e-8237.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492475.668e-7834.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435571.385e-7336.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380614.322e-7333.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx230.000e+063.68DEAD-box helicase 23 [Source:NCBI gene;Acc:1011574... [more]
ddx230.000e+063.68DEAD-box helicase 23 [Source:NCBI gene;Acc:1011574... [more]
ddx463.617e-8038.70DEAD-box helicase 46 [Source:NCBI gene;Acc:1011615... [more]
ddx461.172e-7938.70DEAD-box helicase 46 [Source:NCBI gene;Acc:1011615... [more]
ENSORLT00000031911.11.372e-7734.08probable ATP-dependent RNA helicase DDX17 [Source:... [more]
back to top
BLAST of Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068237.10.000e+0100.00SMESG000068237.1[more]
SMESG000033908.11.539e-8438.64SMESG000033908.1[more]
SMESG000033916.12.045e-8438.64SMESG000033916.1[more]
SMESG000033348.13.004e-8237.11SMESG000033348.1[more]
SMESG000033348.13.409e-8237.11SMESG000033348.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013392 ID=SMED30013392|Name=Pre-mRNA-splicing ATP-dependent RNA helicase PRP28|organism=Schmidtea mediterranea sexual|type=transcript|length=4372bp
TCTTAATACAAAAGTTGTTATTTCAAATAGATGGATGATTTAGTCAATAA
TTATCAATCTGACCAAGAAACTGTTGACCCTAATCAAGTAAGAAAAAGCG
AAGAAATTAAAAAGTCTAAGAAAAAGAAAGAGAAAAAAGAGAAAAAGGAG
AAAAAACCAAGAAAAGAGAAGAAAGAAAAGAAGAAACATAGAAAACGAAG
GCATGAAAATTCCTATAATGAAAACAATGAAGTAGAGTTTAAAAAATTAA
AACGAGGAAAAGAATCTTTCCCGGATATCGAAGATTTTGAGGTAGAAAAG
AAAATTCCGTTTAATGATCAATCTAAGCAAAATAATGAAAATGCAGTTTT
TAAAACGCCTAATGCTGTTCCTAAACATGCACAAATCCCTTTGTCCGTAG
AAGAAGTTTTGGCTACTAAACATGCTGAAGAAGAAGCTGAAAAAAAACCT
AAATATTTTTCAAAAGCTGAGCGAGAAGCACTTGCTATTCAAAGAAGAGA
AGAAAAAGTTAAAGAAAGTAAAAAAAAAGCATTATACGAAAAAAATCTTC
AGACTAAATATATTGAAGAAGGTAGAATTAAAAGTCGTGATGGTGATAGA
AGGTCGAGACGAAGCCATGGCGACGGAAGGAGTGGTGATAAAACCGCCGA
ACAAAATGAAGAAGACAAAAAACGCGAAGAAGAAGCAATAAAAGAACGTT
ATTTAGGGCAAAAAAGGTTGACTAAACGCAGACAGCGTCGATTAAATGAA
CGCAAATTTGTTTTTGCTTGGGATGAAGGGGAAGATACGAGCGCTGATTA
TAATCCATTATACAAGAAGAAACATGAAGCCCAGTTTTTCGGAAGAGGTC
ATATCGGTGGTATTGATATCAATGCACAGAAAAAGGCATTAGGTCAGTTT
TATACAAAAATGATGTCTGATAGACGATCTGATGGACAGAAAGATCAAGA
AGCTAAAAGATTAAAAAACATTTCTAATCGCGAAGCAAAAGTGAAATGGG
ATGAACGACCCTGGACCGAAAAGCATTTGGATGAGATGACAAATAGAGAT
TGGCGTATTTTCCGTGAAGATTTCAGCATTACAACGAAAGGTGGAAACAT
TCCAAACTCGATTAGGTGCTGGGAGGAAGCCGGATTATCGGATAAGCTTC
TCGATGTGATAATTAATAAGGCCAAATACAAAGAACCAACTCCTATTCAA
AGACAAGCCATTCCAATTGGATTACAGAACAGAGATATTATTGGAGTGGC
TGAAACTGGATCCGGAAAAACAGCAGCCTTCCTGATACCGCTGTTGTCTT
GGATTGAAAAATTACCACGATTGCAAAAGATGGAACAAAACGAACTTGGT
CCTTACGCTATAATTCTTGTGCCAACTCGAGATTTAGCCATTCAGATTCT
TGAAGAAACCATGAAATTTGGTCAGCCTCTTGGAATCAAAGCCGTAACAA
TTATCGGTGGTAACAGTCGAGAGGAACAGGTTTTCCAGTTGCGTTTAGGT
GCTGAGATAGTGATTGCAACTCCTGGTCGACTGGTAGATGTATTGGAGAA
CCGATATATCGTACTCAATCAATGTACTTACGTTATCATGGACGAGGTCG
ACAGAATGATCGATATGAATTTCGAGGCGGACGTCAGAAAGATTTTATCT
TATTTGCCCGAGGCTACGGAAAAACCAGATACTGATGATGCCGAAGACAC
TGAAAAACTGTTGCAAAATTTCCATACCACTCAAAAATACAGACAAACTG
TCATGTTTACCGCTACAATGCAACCGTCTGTGGAACGGCTTGCCAGAACA
TTTTTACGTCGCCCGGCAACGGTCTATATTGGTTCTATCGGCAAGCCAAC
TGAACGCACCAAACAAGTGATCTACATGCTGACCGAAAACCAAAAACGTG
ACAAACTACGGGAAATTATGAGCAGGAATTTCGTCCCGCCGATTATCATC
TTTGTCAATCAAAAGAAAGGAGCCGATGTTTTGGCAAAGGGTCTCGAGAA
AATGAATTTGAAAGCCATCAGTTTCCACGGAGGAAAGGGGCAGGAACACA
GAGAATATGCAATGGCTGCCCTCAAATCCAAGGAGAAGGATATTTTAGTA
GCTACTAATTTAGCTGGTCGCGGTATTGATATCAAGGATGTTTCACTTGT
TCTTAATTACGACATGCCTAAAACTATTGACGAATATATTCATCGGGTTG
GTAGGACTGGTCGTGCTGGCAAGGAAGGCTTGGCAATCAGTTTCGTTACT
AAGGACGATTCGCCTTTGTTTTATGATTTAAAAGAGCTTTTGAAAGAATC
TCCACTCAGTGAAATCCCCAGTGAACTTTTAAGTCATCCCGATGCTCAAC
AGAAATATGGGACATTTACATCGAAAAAGCGAAGAAATGAGGAAACTCTG
TACATAGCTTAATATGTCGTTCAATAAAATATTCATGTCTCGTTATGCGG
GCTCGATTAATAATTTTCAAATAATAAAGGAAATTTAACTTACTTATAAT
TTGTCAGTAATGTATGTTTTAGATAATTAACCTTTTGATGTCCAGCTGAA
ATTATCTCGAATTTCAGAAGATATAGAAAAGGAGAATTCATTAAGAACTT
GTTTAATATATTAACAGTAAAATACTCCCTTGTGCCATTATATCCTTTTT
GTGGAAACCTCCATTTCATTTAGGGATAATTTCAAAAAGTTTACACTAAA
AATTTTGATATTTAGGTAATCTATTTTAATTGGGTGCATATTTAAAACTT
ATTTCGTCTAAAAATCGCATCAGAAGGAAAATTACAATATATTTAACAAC
ACAACTAACTAATAATCGTTCATTAAAAATGTGATTTTCGTGCTGCCAAT
GTCTAAATTAAGTTTCAATAAATTTGTCTTTGTAAATGCGGATTGAAATC
TCGACGTATCATTGGTCATTGTTATGTTCTTAAATAATATACAAGAATAA
AAATTTACCTCATGCAAAAAATCAAATTTGGAGTGTTTTTAGTATGACTG
TTGTACGTGTTTTGTATGCAAAAATATTATATACTGATTGAATGATGTTA
TAATTCGAACTGACAAATTTTTAAGATACCGTATTTCACTCCTTATAAGT
CGCTAGAGACAATGGTGTTGGTTTAACGACTTCAGATACACCGTCATCAG
ATGATTCATTATTCCATTCACTGTCATTTTTAACGATTAAGGAAAATATG
AAAACATTAAATAAAACAAAATTAAAAACCTCGCAGAAAAGTCCACAGCA
GTGGATAGAGACATACTCGAAACTTAAAACCTAGCAAAAGAAGGTTTAGA
AAATACTTATGTGAAGTGGTGAACGAAAATTAAATAATTGAAAGGATCAA
AAAGAAAAATGACAAAAAAATAATAACAAAATAAAAGGTTAAAAAATATA
AATATATCAAAAAGTAAAGAAAATGATATAAAAAATAATATCGTAAAATA
ACTGAAAATTGCCTATTGGTTACACACACACAAAACAACTATAAATACAG
TAGCCAAATTCATAATGTTTATCCTTAAACTAATCAAATTTTGACTTGAA
TTTGTTGTGAGGAAAAAATTTTTTTGAGTAAGGATGTTTATTTTTATTTG
TAATTGTTGTCTTATATAAAATATATATATTCTTATCTATGAGTTAGTTT
TAATGGATTAACTATTCTGGATGGTCGTGGTGATCAAAGTCAAAGCATTA
CAACAAATCATGAATGAGGAGGGACGCTTTATCTGGCAAGTACATCAAAC
TGCTGCCAGAGACAATTCTATTGTAATCGAAATATCATTGGCTACCCAAA
GATTTCAGAAAGCAATCGCAATGCTTGCTGAAAAGAAAAAAATCCAAAAG
CGTTCCAAAAGAGGTAACTCCAACGGAAATAGCTCCAACAGATCAAACCC
GTATATCCAGACAGCGTTACAATCCAGGAAGCATATCCCAAGCAACACTA
AGATTCCGAAAGTTCTGAGCAGTAGGTACACTAGCCGTGCCTCCTAGAAA
AAAAGCATATCTCAGTAAACAAAGTTGGAGTTTTGAATTTTCTGAATTCG
AGCTCCTAGCGATACAAGAAAAAGAAGGGAAAAGGAAAACTGAACAAAAA
CCTGCAAAGAGCAGAAAAATCAAAATAGTCAAAGAAATGGACGAAATCAA
AAAGAATCATCCAGACGAAGAAATCCAGCAAAAGCATGCCAAAACAAAAC
TAGATATGAAAAATCAAAGATTTTCAAAAAGCCTGGATGCAATCTTTAAA
GAGATATCTTATTATGACTGATAATTTTTTGTAAAAATTTTTCTAAGTTC
AACCCCCCCTACCAAAAATTTTTATGAATTTTATAACAAGCATCTTTTAA
ACTCTGAAAATTGTAAACCGAT
back to top

protein sequence of SMED30013392-orf-1

>SMED30013392-orf-1 ID=SMED30013392-orf-1|Name=SMED30013392-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MVVVIKVKALQQIMNEEGRFIWQVHQTAARDNSIVIEISLATQRFQKAIA
MLAEKKKIQKRSKRGNSNGNSSNRSNPYIQTALQSRKHIPSNTKIPKVLS
SRYTSRAS*
back to top

protein sequence of SMED30013392-orf-2

>SMED30013392-orf-2 ID=SMED30013392-orf-2|Name=SMED30013392-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=794bp
MDDLVNNYQSDQETVDPNQVRKSEEIKKSKKKKEKKEKKEKKPRKEKKEK
KKHRKRRHENSYNENNEVEFKKLKRGKESFPDIEDFEVEKKIPFNDQSKQ
NNENAVFKTPNAVPKHAQIPLSVEEVLATKHAEEEAEKKPKYFSKAEREA
LAIQRREEKVKESKKKALYEKNLQTKYIEEGRIKSRDGDRRSRRSHGDGR
SGDKTAEQNEEDKKREEEAIKERYLGQKRLTKRRQRRLNERKFVFAWDEG
EDTSADYNPLYKKKHEAQFFGRGHIGGIDINAQKKALGQFYTKMMSDRRS
DGQKDQEAKRLKNISNREAKVKWDERPWTEKHLDEMTNRDWRIFREDFSI
TTKGGNIPNSIRCWEEAGLSDKLLDVIINKAKYKEPTPIQRQAIPIGLQN
RDIIGVAETGSGKTAAFLIPLLSWIEKLPRLQKMEQNELGPYAIILVPTR
DLAIQILEETMKFGQPLGIKAVTIIGGNSREEQVFQLRLGAEIVIATPGR
LVDVLENRYIVLNQCTYVIMDEVDRMIDMNFEADVRKILSYLPEATEKPD
TDDAEDTEKLLQNFHTTQKYRQTVMFTATMQPSVERLARTFLRRPATVYI
GSIGKPTERTKQVIYMLTENQKRDKLREIMSRNFVPPIIIFVNQKKGADV
LAKGLEKMNLKAISFHGGKGQEHREYAMAALKSKEKDILVATNLAGRGID
IKDVSLVLNYDMPKTIDEYIHRVGRTGRAGKEGLAISFVTKDDSPLFYDL
KELLKESPLSEIPSELLSHPDAQQKYGTFTSKKRRNEETLYIA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0000166nucleotide binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: cellular component
TermDefinition
GO:0071013catalytic step 2 spliceosome
GO:0005634nucleus
GO:0005682U5 snRNP
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0000375RNA splicing, via transesterification reactions
GO:0006397mRNA processing
GO:0008150biological_process
GO:0008380RNA splicing
GO:0010501RNA secondary structure unwinding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 21..41
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 603..792
e-value: 7.1E-54
score: 183.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 323..602
e-value: 1.8E-88
score: 298.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 180..217
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 59..74
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 32..58
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 17..31
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..74
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..16
NoneNo IPR availablePANTHERPTHR24031:SF23ATP-DEPENDENT RNA HELICASE DDX23-RELATEDcoord: 223..742
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 223..742
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 611..739
e-value: 2.74424E-52
score: 176.159
NoneNo IPR availableCDDcd17945DEADc_DDX23coord: 373..599
e-value: 4.10786E-123
score: 366.645
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 382..613
e-value: 1.5E-58
score: 210.5
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 394..598
score: 29.051
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 649..730
e-value: 1.2E-31
score: 121.2
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 623..730
e-value: 5.4E-26
score: 91.1
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 609..770
score: 22.544
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 387..586
e-value: 7.1E-49
score: 165.9
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 362..391
score: 9.809
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 24..543
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 440..750