netrin 1

Overview
Namenetrin 1 (AAY23350.1)
Smed IDSMED30013386
Length (bp)2169
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of netrin 1 (SMED30013386) t-SNE clustered cells

Violin plots show distribution of expression levels for netrin 1 (SMED30013386) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of netrin 1 (SMED30013386) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for netrin 1 (SMED30013386) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of netrin 1 vs. Ensembl Human
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 336.265 bits (861), Expect = 1.240e-105
Identity = 203/638 (31.82%), Postives = 327/638 (51.25%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHI------NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            G   RC+P F N         ++STCG+   +   V         +CH C     K  H   +LTD +  +N+T W S+ ++    NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N    + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+IR+                          F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA RC+++  D++  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD  KP++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + PE+   +C   + +++   KKYC+KD  + + +   ++ G+  +F + +  VY+  TS+             G  S         +WI+  D+ CKCP ++    YL++   +A    ++S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   46 GHPRRCIPDFVNAAFGKDV-RVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGRTWVPFQFYSTQCRKMY-------NRPHRAPITKQN-EQEAVCT---DSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVA-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRR----------GDQS---------LWIRSRDIACKCPKIKPLKKYLLL--GNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of netrin 1 vs. Ensembl Human
Match: NTN3 (netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030])

HSP 1 Score: 273.092 bits (697), Expect = 7.333e-82
Identity = 185/623 (29.70%), Postives = 271/623 (43.50%), Query Frame = 2
Query:  185 CYSEGKAFR-CVPPFTNIIENMIPDEI--TSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGD-NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFT---TNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYH--CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQA--------PENRCQHCNNKRK--RIRFKKYCRKDAVLLVTMQSR-EQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTY----LVILKLHAIKYLERSELLLDQKSVALPWQKTW 1981
            C+ EG A R CVP    ++   +  E+  +STCG+    R C       S  +  HS   LT      +   W S+ +     NV +T   GK FE+ ++SL       P S+ + KS D+G SW    +FS  C   +G  P   N  +            L   + PD           +LAF+   ++ P     +S     W++AT++R+ L +  T                                           R+  +V+  S  +A  D+ +GGRC+C GHA RCL   +D   H  CDC+H T G DC  C+  + D+ W  AT   +  C  C+CN H+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD  + LS    C  C CHP+G+     C+Q   QC CK GV GL+CNRC  GFQQ++SP+ PCV      K P+           P++   HC   R   RI  KK+C+KD  + V + +R E  G   RF + V  V+R    +                       +  +W+   D  C CP L  G  Y                    L+  + S+ LPW+  W
Sbjct:   30 CHDEGGAPRGCVP---GLVNAALGREVLASSTCGR-PATRACD-----ASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFVSLRFC-SAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEALCFPAPL---AQPDGS--------GLLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRVVLTRPST---------------------------------------AGDPRDMEAVVPYS--YAATDLQVGGRCKCNGHASRCL---LDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRATARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCV------KTPIPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDYAVQVAVGARGEARGAWTRFPVAVLAVFRSGEERARR-------------------GSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAGGRGPGLIAARGSLVLPWRDAW 561          
BLAST of netrin 1 vs. Ensembl Human
Match: NTN5 (netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208])

HSP 1 Score: 218.779 bits (556), Expect = 1.038e-62
Identity = 124/346 (35.84%), Postives = 178/346 (51.45%), Query Frame = 2
Query: 1019 GRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVID----LHKIPMAQAPENRCQ-HCN--NKRKRIRFKKYCRKDAVLLVTMQSREQHGEM-ARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCE 2032
            GRCQC+GHA RC         HC  +H+T G  CE CR    D  W  AT      C  C+CN H+++C FN +L+ +S  +SGGVC  C H+T GR+CH C  G+ RD S+P+     C  C+CHPIG+     C+Q + QCTCK GV GL+CNRC  G+QQ++SP  PC  + +    L   P A + + +CQ +CN  + R  +  ++YC++D VL   + + E  G    R  ++V  VY+           D                    W+   DL C C  LQ G  YL++    A+   + + L+LD+  +ALPW+  W R +K+   +E  G C 
Sbjct:  155 GRCQCHGHAARCAARARPPRCHC--RHHTTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGATG-GTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQD-------------------AWVPRADLTCGCLRLQPGTDYLLLGS--AVGDPDPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGCR 476          
BLAST of netrin 1 vs. Ensembl Human
Match: LAMC1 (laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:6492])

HSP 1 Score: 189.504 bits (480), Expect = 2.061e-49
Identity = 139/461 (30.15%), Postives = 208/461 (45.12%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDH------INCHSCMKDT----HSINYLTDQHLNNNITFWASDF----VNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFS-HASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQ-TKSPITPC 1531
            G+  RC+P F N   N+     T+TCG    +  CV         +CH C        H   +LTD +   + T+W S      V +  ++N+T   GK F+I Y+ L       P+S  I K       W  + Y+S  C  ++      F       I     +Q   CT    S +  L       +     P+ ++   S     W++AT+IR+TL +                  L  + + ++                    N P VLK S ++A++D ++GGRC+C GHA  C+KN  D    C+C+HNT G DCE C   F D+ W  AT  SA+EC  C+CN  S++C F+ +LY  +    GG C +C+ NTDG +C +C + + R     L ++  C  C C P+GS+    CD    +C+CK GV G  C+RCQ GF   T++   PC
Sbjct:   45 GRPQRCMPEFVNAAFNVTV-VATNTCG-TPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRLKF-HTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGF-------IRTGGDEQQALCTD-EFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNR------------------LNTFGDEVF--------------------NDPKVLK-SYYYAISDFAVGGRCKCNGHASECMKNEFDKLV-CNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGH--GGHCTNCQDNTDGAHCERCRENFFR-----LGNNEACSSCHCSPVGSLSTQ-CDSY-GRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPC 445          

HSP 2 Score: 65.855 bits (159), Expect = 3.005e-10
Identity = 57/197 (28.93%), Postives = 85/197 (43.15%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCR-CHPIGSIYPDV---CDQRNSQC-TCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCN 1600
            C C GH+  C  +P   T  C+C+ NTAG  CE C +G+    +  +T  ++++C+ C C   S  C    K   V       VC +C   T G+ C  C+ GY  D   PL  +     CR C    +I P+    C++   +C  C     G  C+RC+ GF                   P+A  P ++C+ CN
Sbjct:  724 CACNGHSETC--DP--ETGVCNCRDNTAGPHCEKCSDGY----YGDSTAGTSSDCQPCPCPGGS-SCAVVPKTKEV-------VCTNCPTGTTGKRCELCDDGYFGD---PLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGF----------------FGNPLAPNPADKCKACN 885          

HSP 3 Score: 64.3142 bits (155), Expect = 6.865e-10
Identity = 51/159 (32.08%), Postives = 69/159 (43.40%), Query Frame = 2
Query: 1031 CYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSG-----GVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQ 1492
            C    G CLK          C +NTAG  C+ C++GF     +    N A +CK CNCNL           Y    +QS      G C +C  +  G+ C  C+ G++      L     C +C CH +GS     CD R  QC C+ G+ G  C RC+
Sbjct:  842 CNRLTGECLK----------CIYNTAGFYCDRCKDGFFGNPLAP---NPADKCKACNCNL-----------YGTMKQQSSCNPVTGQC-ECLPHVTGQDCGACDPGFYN-----LQSGQGCERCDCHALGSTNGQ-CDIRTGQCECQPGITGQHCERCE 969          

HSP 4 Score: 56.225 bits (134), Expect = 2.674e-7
Identity = 45/140 (32.14%), Postives = 59/140 (42.14%), Query Frame = 2
Query: 1085 CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCT-CKTGVGGLSCNRCQKGF 1501
            C C     G+ CEMC  G+   R     +   + C  C CN HS+ C+              GVC +C  NT G +C +C+ GY+ D +   S    C  C C P GS    V   +   CT C TG  G  C  C  G+
Sbjct:  690 CTCPVGYGGQFCEMCLSGY---RRETPNLGPYSPCVLCACNGHSETCD-----------PETGVC-NCRDNTAGPHCEKCSDGYYGDSTAGTSSD--CQPCPC-PGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGY 811          
BLAST of netrin 1 vs. Ensembl Human
Match: LAMA5 (laminin subunit alpha 5 [Source:HGNC Symbol;Acc:HGNC:6485])

HSP 1 Score: 179.874 bits (455), Expect = 4.061e-46
Identity = 120/412 (29.13%), Postives = 187/412 (45.39%), Query Frame = 2
Query:  317 CHSCMKDTHSINYLTDQHLNNNITFWASDFVNHG---DNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFS---KDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHA-SDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRC-LKNPVDN-TYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKL-------YIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPD-VCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
            C  C     +  +     ++    +W S  ++ G   + VN+T   G++F + Y+ +       PD  ++ +S+D G ++  W +F+   +DC   FG Q ++       +IT    D +  CT+   S++  L N   V++     P   + + S     +  ATN+R  LR   TN L  HL G                                K    P+V +   ++++ DISIGGRC C+GHA  C  K+P D     C CQHNT G  C+ C  GF  + W  AT NSA EC+ CNC  H+  C ++ ++        +    Q GGVC+DC+H+T G  C +C  G++R  + PL   HVC +C C    S + D  C+    +C C+    G  C+ C +GF
Sbjct:  103 CDICTAANSNKAHPASNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGRTYQPWQFFASSKRDCLERFGPQTLE-------RITR---DDAAICTT-EYSRIVPLENGEIVVSLVNGRPGAMNFSYSPLLREFTKATNVR--LRFLRTNTLLGHLMG--------------------------------KALRDPTVTR-RYYYSIKDISIGGRCVCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCNCYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPLDSPHVCRRCNCE---SDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGF 465          

HSP 2 Score: 85.1149 bits (209), Expect = 3.186e-16
Identity = 64/204 (31.37%), Postives = 83/204 (40.69%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKR-------------WSVATVNSAAEC------KRCNCN--LHSKKCE------FNEKLYIVSNKQ----SG---------------GVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKG 1498
            CQC+GH+ RCL     +    DCQHNT G  CE C+ GFV  R              SV + N A  C       +C C        CE      F   L + S+ Q    SG               G C  C  +T G  C  C  G++ +   P +    C +C C P G+   + CD  +  C CK GV G  C+RCQ+G
Sbjct: 1864 CQCHGHSDRCLPG---SGVCVDCQHNTEGAHCERCQAGFVSSRDDPSAPCVSCPCPLSVPSNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLLFSDCDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGN----CTRCDCTPCGT---EACDPHSGHCLCKAGVTGRRCDRCQEG 2057          

HSP 3 Score: 74.7146 bits (182), Expect = 5.780e-13
Identity = 46/148 (31.08%), Postives = 63/148 (42.57%), Query Frame = 2
Query: 1073 NTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPI---GSIYPDVCDQRN--SQCTCKTGVGGLSCNRCQKGF 1501
            N   C C  +  G  C+ C  GF      +        C  C C+ HS +C               GVCVDC+HNT+G +C +C  G+      P +    C+ C C P+    + + + C  R   +QC CK G  G SC RC  GF
Sbjct: 1827 NVELCLCPASYRGDSCQECAPGFYRDVKGLFL----GRCVPCQCHGHSDRC-----------LPGSGVCVDCQHNTEGAHCERCQAGFVSSRDDPSAP---CVSCPC-PLSVPSNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGF 1955          

HSP 4 Score: 72.4034 bits (176), Expect = 2.909e-12
Identity = 58/223 (26.01%), Postives = 82/223 (36.77%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNP----------VDNTYH-----CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNC--------------------NLHSKKCEFNEKLYI----------VSNKQS-----GGVCVDCEHNTDGRYCHQCNK--------------GYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
            C CYGHA  C  +P          +D TY       DCQH+T G +CE C  GF   R     ++S   C+RCNC                    N   ++C+   + +            SN         G  V+C+ +  G   + C K              G H +   P  +   C  C+C   G +  D CD    QC C+ G  G +C+RC  G+
Sbjct:  359 CNCYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFY--RSPNHPLDSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSNDTREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCELCAPGFYGPGCQPCQCSSPG-VADDRCDPDTGQCRCRVGFEGATCDRCAPGY 578          

HSP 5 Score: 63.929 bits (154), Expect = 1.172e-9
Identity = 44/159 (27.67%), Postives = 62/159 (38.99%), Query Frame = 2
Query: 1025 CQ-CYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKG 1498
            CQ C       L    D    C CQ   AG  C+ CR G+          +    C+ C C+      +            +GG+C  C     G  C +C+ G+H   S        C+ C C   GS++   CD R+ QC+C+  V GL C+ C  G
Sbjct:  584 CQLCGCSPAGTLPEGCDEAGRCLCQPEFAGPHCDRCRPGY----------HGFPNCQACTCDPRGALDQLC---------GAGGLC-RCRPGYTGTACQECSPGFHGFPS--------CVPCHCSAEGSLHA-ACDPRSGQCSCRPRVTGLRCDTCVPG 713          

HSP 6 Score: 60.4622 bits (145), Expect = 1.420e-8
Identity = 50/188 (26.60%), Postives = 65/188 (34.57%), Query Frame = 2
Query: 1016 GGRCQCYGHA-----GRCLKN--------PVDN--------TYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCN------LHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKG 1498
            GG+C C+ H       RC           P D         T  C C   T   DC +C+             +    C+ CNC+      L    C+ +            G C  C  N  GR C  C+ G+H         +  C  C CH  G+  P VCD    QC CK  V G  C++C  G
Sbjct: 1454 GGQCPCHAHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCICPPRTIPPDCLLCQP-------QTFGCHPLVGCEECNCSGPGIQELTDPTCDTDS-----------GQC-KCRPNVTGRRCDTCSPGFH--------GYPRCRPCDCHEAGTA-PGVCDPLTGQCYCKENVQGPKCDQCSLG 1613          

HSP 7 Score: 55.8398 bits (133), Expect = 3.537e-7
Identity = 44/172 (25.58%), Postives = 62/172 (36.05%), Query Frame = 2
Query: 1082 HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHC 1597
            HC C+    G+ C+ C+EG           +    C+ C C   ++  E         + QSG     C   T G  C +C  GY   W  P      C +C+C P G      CD    +C C  G+ G  C+ C    QQ              H++P+   P     HC
Sbjct: 2039 HCLCKAGVTGRRCDRCQEGHFG-------FDGCGGCRPCACGPAAEGSE--------CHPQSGQC--HCRPGTMGPQCRECAPGY---WGLP---EQGCRRCQC-PGGR-----CDPHTGRCNCPPGLSGERCDTCS---QQ--------------HQVPVPGGPVGHSIHC 2164          
BLAST of netrin 1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 324.709 bits (831), Expect = 1.516e-101
Identity = 202/630 (32.06%), Postives = 314/630 (49.84%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-----DHI---NCHSCMK----DTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNP---NFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPE--NRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            G+  RCVP F N      P   + TCG N+  + C      D I    C +C       +H  + LTD +   N+T W S       NV++T S GK FE+ Y+S+     L PDS+ + KS D G +WT + ++S +C R FG  P       D  IT+S   +++   S      GN V  P    F  N P   NF    S     W++AT+I++   +                P   + +      N+Y +    + ++KQ+            F+++ ++++GGRC+C GHA RC+ + +   Y CDC+HNTAG +CEMC+    D+ W  AT NSA  C  CNCN H+K+C F+ +L+ +S  +SGGVC++C HNT GR CH C  G+ RD S P++H   C  C CHP+GS+    C+Q + QC CK GV G +CNRC KG+QQ++S +TPC+ +        +   E  ++C  C    KR+  KK+C++D  + + + SRE     A++++ V  V++  T                            +WI    + CKCP L++G  YL++ K  +    ER  L+++ ++V + W+     ++ +FS K+  G C +
Sbjct:   42 GRPVRCVPEFINAAFGK-PVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFCSRL-PDSMALYKSADFGKTWTPFQFYSSECRRIFGRDP-------DVSITKSNEQEAVCTASHIMGPGGNRVAFP----FLENRPSAQNF--ENSPVLQDWVTATDIKVVFSR--------------LSPDQAELYGLSNDVNSYGN--ETDDEVKQRY-----------FYSMGELAVGGRCKCNGHASRCIFDKM-GRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKS-CNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTENMQRGETS-------------------LWISPQGVICKCPKLRVGRRYLLLGKNDSDH--ERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPE 606          
BLAST of netrin 1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 324.709 bits (831), Expect = 1.516e-101
Identity = 202/630 (32.06%), Postives = 314/630 (49.84%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-----DHI---NCHSCMK----DTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNP---NFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPE--NRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            G+  RCVP F N      P   + TCG N+  + C      D I    C +C       +H  + LTD +   N+T W S       NV++T S GK FE+ Y+S+     L PDS+ + KS D G +WT + ++S +C R FG  P       D  IT+S   +++   S      GN V  P    F  N P   NF    S     W++AT+I++   +                P   + +      N+Y +    + ++KQ+            F+++ ++++GGRC+C GHA RC+ + +   Y CDC+HNTAG +CEMC+    D+ W  AT NSA  C  CNCN H+K+C F+ +L+ +S  +SGGVC++C HNT GR CH C  G+ RD S P++H   C  C CHP+GS+    C+Q + QC CK GV G +CNRC KG+QQ++S +TPC+ +        +   E  ++C  C    KR+  KK+C++D  + + + SRE     A++++ V  V++  T                            +WI    + CKCP L++G  YL++ K  +    ER  L+++ ++V + W+     ++ +FS K+  G C +
Sbjct:   42 GRPVRCVPEFINAAFGK-PVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFCSRL-PDSMALYKSADFGKTWTPFQFYSSECRRIFGRDP-------DVSITKSNEQEAVCTASHIMGPGGNRVAFP----FLENRPSAQNF--ENSPVLQDWVTATDIKVVFSR--------------LSPDQAELYGLSNDVNSYGN--ETDDEVKQRY-----------FYSMGELAVGGRCKCNGHASRCIFDKM-GRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKS-CNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTENMQRGETS-------------------LWISPQGVICKCPKLRVGRRYLLLGKNDSDH--ERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPE 606          
BLAST of netrin 1 vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 186.037 bits (471), Expect = 1.314e-48
Identity = 136/468 (29.06%), Postives = 214/468 (45.73%), Query Frame = 2
Query:  167 GGSNSLCYSEG--KAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHIN------CHSCMKD----THSINYLTDQHLNNNITFWASDFVNHGDN----VNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQ---PMDFNHYSDSKITESTVDQS-LTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPV---DNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
            G   + CY     +  RCVP F N   N+   ++T+TCG  +  + CV   +      C +C       +H   YLTD ++ NN T+W SD +  G       N+T   GK F+I Y+ L  I    P+S  I K     + W  W ++S  C  ++G+    P+   + + ++ T+   D S +T  +I       L   PS  AF           S+    W++A+ IRI+L +  T                  + + +++                     P VL+ S ++A++D ++GGRC+C GHA  C+ +     +N   C C+HNT G DC  C   + D+ W   T   A EC  CNC+  S +C F+++L+  +    GG C+DC+ NT G +C QC   +   W +P  ++  C+ C C+ IGS+    CD    +C CK GV G  C++C  GF
Sbjct:   34 GADGNPCYDRATRQPQRCVPDFVNAAFNL-EVQVTNTCGTKRPTKFCVQSGHTGQRSVCETCDDRHEGFSHPAKYLTDFNVGNNETWWQSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKFISP-RPESFTIYKKTHTDSEWEPWQFYSGSCRATYGLSDRAPILPGNEATAQCTKEFSDISPITGGNIA---FSTLEGRPSAHAF---------EESEVLQKWVTASAIRISLNRMNT------------------FGDEVFK--------------------DPQVLR-SYYYAISDFAVGGRCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETGH--GGHCIDCQGNTQGVHCEQCIANH---WRRPGENY--CVACGCNEIGSLSTQ-CDNE-GKCQCKPGVTGRFCDQCLDGF 439          

HSP 2 Score: 65.855 bits (159), Expect = 9.761e-11
Identity = 43/133 (32.33%), Postives = 60/133 (45.11%), Query Frame = 2
Query: 1091 CQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRC 1489
            C  NT G +CE C+ G+    W  A +     C+ C C     +   N+   +  N+Q G    DC  N  G  C QC  G++      ++    C +C C P+GS   + CD    QC CK GV G  C+RC
Sbjct:  859 CIFNTHGFNCENCKPGY----WGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQC--DCLPNVIGIQCDQCAHGFYN-----ITSGLGCQECNCDPLGS-EGNTCDVNTGQCQCKPGVTGQRCDRC 979          

HSP 3 Score: 58.5362 bits (140), Expect = 1.863e-8
Identity = 62/246 (25.20%), Postives = 90/246 (36.59%), Query Frame = 2
Query:  830 FLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTY--HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRC--------HPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVD 1537
            F  +    + +  H   YF    R N    I  ++     K R + S     D   L+++++G              NP   T+  HC+C     G+ CE C  GF   R           C +C+C+ HS  CE              G C+ CEHNT G  C +C +GY+ D  +       C KC C        H  G +   +C +      C  G  G  C+ C  G+       T CV+
Sbjct:  623 FPTTEAQTYRFRVHADPYFGWYPRINELDFIGILSNITAIKIRGTYS---YKDIGYLSNVNLG-----TAGVAPSAANPKQATWIEHCECLPGFVGQFCESCESGF---RRETKFGGPFNHCIKCDCHNHSNSCE-----------AESGSCI-CEHNTAGDTCERCARGYYGDALQGTEED--CQKCPCPNDGPCILHADGDV---ICTE------CPNGYTGRRCDECSDGYFGNPKDGTECVE 834          

HSP 4 Score: 55.8398 bits (133), Expect = 1.262e-7
Identity = 53/212 (25.00%), Postives = 78/212 (36.79%), Query Frame = 2
Query: 1022 RCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCN------LHS---------------KKCEFNEKLYIVSNKQSGGVCVDCE------------------------HNTDGRYCHQCNKGYHRDWSKPL-SHHHVCIKCRCHPIGSIYPD------VCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
            +C C+ H+  C       +  C C+HNTAG  CE C  G+    +  A   +  +C++C C       LH+               ++C+     Y   N + G  CV+C                          NT G  C  C  GY   W   L      C  C C   G+  P+       C+Q++ QC C   V G+ C++C  GF
Sbjct:  735 KCDCHNHSNSCEAE----SGSCICEHNTAGDTCERCARGY----YGDALQGTEEDCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYF-GNPKDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGY---WGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGF 934          
BLAST of netrin 1 vs. Ensembl Celegans
Match: lam-1 (LAMinin related. See also lmb [Source:UniProtKB/TrEMBL;Acc:V6CIX7])

HSP 1 Score: 170.244 bits (430), Expect = 1.824e-43
Identity = 132/466 (28.33%), Postives = 199/466 (42.70%), Query Frame = 2
Query:  263 TSTCGQNKKQRICV-----DHINCHSCMKDT------------HSI-NYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSF-GIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVD-----NTY---------HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRN--------SQCTCKTGVGGLSCNRCQKGF-QQTKSPITPCV 1534
            TSTCG   +QR C+     +   C  C   T            H I N +T+   + N  ++ S+  N   NV+I+F     F   ++ ++      P ++II +S D G +W  + YF+ DC  SF GI       ++D   T    D       +  S  G +V         T NP      +D+ ++ +  TN+R    K  T  L   L    Y P + + +                                  ++A+ +I + G C CYGHA RC+  P+D     NT           C+C HNT G +CE C+  + D  W  A  +   EC++CNCN H+ +C F+  +Y  S   SGGVC DC HNT G+ C QC   ++RD  + +   HVC+ C C   GS    +C+            +C CKT V G  C+RC+ G+   T++ +  CV
Sbjct:   55 TSTCGSQGRQRFCIVSHLEEQTKCFYCDSRTEWKPQREPYRLSHRIENVVTEVMDDKNRNWYQSE--NGAQNVSISFDLEAEFHFTHL-IMTFKSFRPAAMIIERSADFGKTWQVYRYFAYDCDSSFPGIPEGPPKKHTDVICTSQYSD-------VAPSTGGEIVYKVISPHIVTENP-----YADEISTLLKITNLRFNFTKLHT--LGDDL--LDYRPEIDEKY----------------------------------YYAIYEIVVRGSCSCYGHASRCI--PIDPHVSPNTVMERADIVHGRCECMHNTEGLNCEKCKAFYNDLPWRPAIGDEKNECRQCNCNRHALRCHFDRAVYESSGFVSGGVCDDCMHNTQGKNCEQCKPFFYRDPRRTIDDPHVCLPCECDKAGSQNKGICEGEEDAERGLVAGKCYCKTNVDGNRCDRCKNGYWNLTETNVDGCV 465          

HSP 2 Score: 56.6102 bits (135), Expect = 7.880e-8
Identity = 48/185 (25.95%), Postives = 69/185 (37.30%), Query Frame = 2
Query:  980 ISDFFALADISIGGRCQCYGHAGRCLKNPVDN-TYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPC 1531
            +  ++  A +    RC C        K   D  +  C C  N  G  C+ C E   +       + S A C+ C C+ +          ++  N   G     C+    GR C QC   Y   W  P +    C +C C+P GS     C + N  C C+ G GG  CN C +G+        PC
Sbjct: 1023 VDGYYGDAKLKTCQRCVCNELGTNSTKGACDRVSGQCPCHDNIIGMQCDQCAENHFN-------LASGAGCEACGCDSNGVVLNHEGVPHLQCNIFDGQC--QCKPGRGGRKCDQCEDLY---WGDPTTPDG-CHRCECNPTGSKSLQ-CHRNNGTCECQAGSGGALCNECARGYTGQWPYCNPC 1193          

HSP 3 Score: 55.8398 bits (133), Expect = 1.346e-7
Identity = 45/164 (27.44%), Postives = 73/164 (44.51%), Query Frame = 2
Query: 1016 GGRCQCYGHAGRC-LKNPVDNTYH--CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGS-IYPDVCDQRNSQCTCKTGVGGLSCNRCQK 1495
            GG    Y HA  C L+N  +NT    C+C+    G+ C  C +      W  +       C+RC+CN +       +     S   + G C+ C H+T+G  C  C  GY+ D     +    C +C C+ +G+      CD+ + QC C   + G+ C++C +
Sbjct:  928 GGPTSGYQHADTCYLRNSGNNTQDIVCNCKSGYQGERCGECAQ----NHWG-SPREVGGTCERCDCNGNI------DMAMEGSCDAATGECLKCLHHTEGAQCEHCVDGYYGD-----AKLKTCQRCVCNELGTNSTKGACDRVSGQCPCHDNIIGMQCDQCAE 1075          

HSP 4 Score: 53.5286 bits (127), Expect = 5.756e-7
Identity = 44/140 (31.43%), Postives = 56/140 (40.00%), Query Frame = 2
Query: 1109 GKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSI----YPDVCDQRNSQ-------CTCKTGVGGLSCNRCQK 1495
            G+ C  C+ GF    W         EC+ C CN H+  C+           QS G C++C   T G YC +C  GY+ D    L     C  C C P G      + D C  RNS        C CK+G  G  C  C +
Sbjct:  855 GRQCNQCQPGF----WGFP------ECRTCQCNDHANICD-----------QSSGACIECRDLTTGHYCDRCQDGYYGD--PRLGVGIPCKPCPC-PGGPTSGYQHADTCYLRNSGNNTQDIVCNCKSGYQGERCGECAQ 970          

HSP 5 Score: 49.6766 bits (117), Expect = 9.333e-6
Identity = 38/116 (32.76%), Postives = 55/116 (47.41%), Query Frame = 2
Query: 1157 SVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKT-GVGGLSCNRCQKGF 1501
            + A +N  +EC           C+    +  + N Q GG C +C+ N  GR C QC  G +            C KC C  +GS+  D CD+++ QC C+  G+ G  CN+CQ GF
Sbjct:  769 AAALLNKTSECN----------CDATGSVSGICNVQ-GGQC-ECKPNVVGRRCDQCAIGTYGFGPSG------CKKCDCDAVGSLGND-CDKQSGQCVCREKGIYGRQCNQCQPGF 865          
BLAST of netrin 1 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 148.288 bits (373), Expect = 2.795e-36
Identity = 127/468 (27.14%), Postives = 199/468 (42.52%), Query Frame = 2
Query:  317 CHSCMKDTHSINYLTDQHLNNNITFWASDFVNHG---DNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSK---DCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHA-SDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRC--LKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQS---------GGVCVDCEHNTDGRYCHQCNKGYHR----DWSKPL----------SHHHVCI----KCRCHP--------------------------IGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCV 1534
            C++  +++H    + D     N ++W S  ++ G   + VNIT    + F + Y+ + +     P S ++ +S D+G ++  W  F++   +C R FG++ +       S I+E   D S+TC +   S L  L N+  V+    + P+    A S+   ++  ATN+R+ L  + T  L  HL                               +   +   P+V +   F+A+ +I IGGRC C GHA  C  L+     +  C C+HNT G  CE C  GFV K+W  AT ++   C+ CNC   S +CE++ ++ +  NKQS         GGVC +C  NT+G  C++C+ GY R     W++P            H   C     KC C P                          +     DVC   + QC CK G GG  C  C  G+    +    CV
Sbjct:  104 CNAGNENSHPAANMVD----GNNSWWMSPPLSRGLQHNEVNITIDLEQEFHVAYVWIQMANSPRPGSWVLERSTDHGKTYQPWFNFAENAAECMRRFGMESL-------SPISE---DDSVTCRTDMAS-LQPLENAEMVIRILEHRPSSRQFATSEALQNFTRATNVRLRLLGTRT--LQGHL-------------------------------MDMNEWRDPTVTRRY-FYAIKEIMIGGRCVCNGHAVTCDILEPQRPKSLLCRCEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNCFGRSNECEYDAEVDL--NKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGACAEETGKCECLPRFVGEDCDQCASGYYDAPKCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVECV 520          

HSP 2 Score: 67.3958 bits (163), Expect = 4.246e-11
Identity = 47/160 (29.38%), Postives = 68/160 (42.50%), Query Frame = 2
Query: 1082 HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSI--YPDVCDQRNS----QCTCKTGVGGLSCNRCQKGF----QQTKSPITPC 1531
             C C     G  C++C  G+      V + +    C  C CN HS  C+ +            G+C DCEHNT+G +C  CN+G++ + +      + C+ C C P      +   CD        QC CK G  G  C+RC  GF    Q +    +PC
Sbjct: 1807 QCQCPAPYTGPSCQLCASGY----HRVQSGSFLGACVPCECNGHSATCDPDT-----------GICTDCEHNTNGDHCEFCNEGHYGNATN--GSPYDCMACAC-PFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPC 1948          

HSP 3 Score: 65.855 bits (159), Expect = 1.063e-10
Identity = 58/207 (28.02%), Postives = 79/207 (38.16%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNC-----NLHSKKCEFNEKLYIV----------------------------------------------SNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQ 1492
            C+C GH+  C  +P D     DC+HNT G  CE C EG     +  AT  S  +C  C C     N  +K C+ +E+  ++                                              S   + G C  CE NTDGR+C  C   ++ D     +    C  C C   GS Y   CD ++  C CK  V G SC+RC+
Sbjct: 1841 CECNGHSATC--DP-DTGICTDCEHNTNGDHCEFCNEG----HYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKN----CSSCECSQCGSQY---CDNKSGGCECKINVEGDSCDRCK 2033          

HSP 4 Score: 57.7658 bits (138), Expect = 3.296e-8
Identity = 42/150 (28.00%), Postives = 60/150 (40.00%), Query Frame = 2
Query: 1070 DNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYP-DVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKS 1516
            D+   C C+ N  G+ C+ C+  F +             C+ CNCN      +F        +K S G    C  +  GR C QC   +   W     H   C  C C+  G+I   + CD +  QC CK    G  C++C  GF +  S
Sbjct:  669 DSNGQCYCKGNFEGERCDRCKPNFYNFPI----------CEECNCNPSGVTRDFQG-----CDKVSPGELCSCRKHVTGRICDQCKPTF---WDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNS 800          

HSP 5 Score: 55.4546 bits (132), Expect = 1.637e-7
Identity = 43/142 (30.28%), Postives = 63/142 (44.37%), Query Frame = 2
Query: 1082 HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQC-NKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPD-VCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
             C C+    G+ CE C  G+ +            EC +C CN   ++C+           +  G C  C  + +G+ C +C +  +  D   PL     C KC CHP GS   + VCD  + QC C+  +GG  C+RC  GF
Sbjct: 1444 QCKCKPGVIGRRCERCAPGYYN----------FPECIKCQCNA-GQQCD-----------ERTGQCF-CPPHVEGQTCDRCVSNAFGYD---PLIG---CQKCGCHPQGSEGGNLVCDPESGQCLCRESMGGRQCDRCLAGF 1556          

HSP 6 Score: 53.9138 bits (128), Expect = 4.764e-7
Identity = 39/134 (29.10%), Postives = 61/134 (45.52%), Query Frame = 2
Query: 1085 CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNR 1486
            C C+ +  G+ C+ C+  F D ++     +    C+ C+CN++      N      +     G C+ C+ N DGR C QC  G++R  S    +   C  C C  IG      CD  + QC C+  V GL C++
Sbjct:  724 CSCRKHVTGRICDQCKPTFWDLQY-----HHEDGCRSCDCNVNGTISGLN------TCDLKTGQCM-CKKNADGRRCDQCADGFYRLNSY---NQMGCESCHCD-IGGALRAECDITSGQCKCRPRVTGLRCDQ 841          

HSP 7 Score: 53.5286 bits (127), Expect = 6.410e-7
Identity = 52/198 (26.26%), Postives = 67/198 (33.84%), Query Frame = 2
Query: 1040 HAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVD------CEHNTDGRYCHQCNKGY------------------HRDWS--------KPLSHHHVCIKCR------------CHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
            H G C     + T  C+C     G+DC+ C  G+ D          A +CK C CN+               N   G VC+       C+    G +C  C  GY                  H + S        KP      C KC+            C P+G+    VCDQ   QC CK G  G  C+RC   F
Sbjct:  434 HTGAC----AEETGKCECLPRFVGEDCDQCASGYYD----------APKCKPCECNV---------------NGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGYFGDDCKFCNCDPMGT-EGGVCDQTTGQCLCKEGFAGDKCDRCDIAF 601          
BLAST of netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0073942)

HSP 1 Score: 307.76 bits (787), Expect = 8.300e-94
Identity = 216/715 (30.21%), Postives = 325/715 (45.45%), Query Frame = 2
Query:  185 CYSEGKAFR-CVPPFTNIIENMIPDEITSTCGQNKKQRICV--DH-INCHSC-MKD---THSINYLTDQHLNNNITFWASDFV-NHGDNVNITFSFGKLFEIYYISLVLIP-LLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQP-MDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSH---ASDQYNSWMSATNIRITL----RKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSIL---PVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPC-------VDVIDLHKI-PMAQAPEN---------------------------RCQHCNNKRKRIRFKKYCRKDAVLLV--------------TMQSREQHGEMARFEM----------KVNYVYRIDTSKFTEMHPD----------------FLASMNG---------IMSNQFIHSTFPMWIKET-DLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNK 2011
            CY++    R C+P F N   +  P   +STCG +  QR C   DH  +CH+C M D   +     LTD + +NN+T W S+ V   GDNV +T S GK FE+ Y+ L L P    PDS++I KS D+G SW  + +FS  C R FG         +++ +   S V + L                 S +AF+T      S    +S     W++AT+IR+      R      L+    G T                 YS  L   P    ++       +       +A++D S+GGRC+C GHA +C  +      +C+C HNTAG+DCE C+    D+ W+ AT   A ECK CNCN H+++C FN +++ +S   SGGVC +C H+T GR CHQC +G++RD +KPL+H  VC  C CHPIGS    +C+  + QC CK GV GL+CNRC +G+QQ++S I PC       ++++D     P    PE+                            C  C    KR+   K+C++D  ++                +Q R    ++A +EM           +  VY    + +   +P+                F  S  G          M N  +      WI  T DL+C+CP +++  +YL++ +           L +   S+ + W++ W RRMK+F  +
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDA-PVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRHNEHEARCSDVTRPLV----------------SRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGAT-----------DLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTD-ASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQVQPGSARSPITGVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTTLKRGPMTWIIPTKDLECRCPRIRVNRSYLILGRDSEAPP---GYLGIGPHSIVIEWKEDWYRRMKRFQRR 721          
BLAST of netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0346088)

HSP 1 Score: 307.76 bits (787), Expect = 8.300e-94
Identity = 216/715 (30.21%), Postives = 325/715 (45.45%), Query Frame = 2
Query:  185 CYSEGKAFR-CVPPFTNIIENMIPDEITSTCGQNKKQRICV--DH-INCHSC-MKD---THSINYLTDQHLNNNITFWASDFV-NHGDNVNITFSFGKLFEIYYISLVLIP-LLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQP-MDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSH---ASDQYNSWMSATNIRITL----RKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSIL---PVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPC-------VDVIDLHKI-PMAQAPEN---------------------------RCQHCNNKRKRIRFKKYCRKDAVLLV--------------TMQSREQHGEMARFEM----------KVNYVYRIDTSKFTEMHPD----------------FLASMNG---------IMSNQFIHSTFPMWIKET-DLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNK 2011
            CY++    R C+P F N   +  P   +STCG +  QR C   DH  +CH+C M D   +     LTD + +NN+T W S+ V   GDNV +T S GK FE+ Y+ L L P    PDS++I KS D+G SW  + +FS  C R FG         +++ +   S V + L                 S +AF+T      S    +S     W++AT+IR+      R      L+    G T                 YS  L   P    ++       +       +A++D S+GGRC+C GHA +C  +      +C+C HNTAG+DCE C+    D+ W+ AT   A ECK CNCN H+++C FN +++ +S   SGGVC +C H+T GR CHQC +G++RD +KPL+H  VC  C CHPIGS    +C+  + QC CK GV GL+CNRC +G+QQ++S I PC       ++++D     P    PE+                            C  C    KR+   K+C++D  ++                +Q R    ++A +EM           +  VY    + +   +P+                F  S  G          M N  +      WI  T DL+C+CP +++  +YL++ +           L +   S+ + W++ W RRMK+F  +
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDA-PVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRHNEHEARCSDVTRPLV----------------SRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGAT-----------DLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTD-ASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQVQPGSARSPITGVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTTLKRGPMTWIIPTKDLECRCPRIRVNRSYLILGRDSEAPP---GYLGIGPHSIVIEWKEDWYRRMKRFQRR 721          
BLAST of netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0308337)

HSP 1 Score: 280.796 bits (717), Expect = 2.671e-84
Identity = 173/471 (36.73%), Postives = 245/471 (52.02%), Query Frame = 2
Query:  185 CYSEGKAFR-CVPPFTNIIENMIPDEITSTCGQNKKQRICV--DH-INCHSC-MKD---THSINYLTDQHLNNNITFWASDFV-NHGDNVNITFSFGKLFEIYYISLVLIP-LLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQP-MDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITL----RKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSIL---PVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCV 1534
            CY++    R C+P F N   +  P   +STCG +  QR C   DH  +CH+C M D   +     LTD + +NN+T W S+ V   GDNV +T S GK FE+ Y+ L L P    PDS++I KS D+G SW  + +FS  C R FG         +++ +   S V + L                 S +AF+T      S   D       W++AT+IR+      R      L+    G T                 YS  L   P    ++       +       +A++D S+GGRC+C GHA +C  +      +C+C HNTAG+DCE C+    D+ W+ AT   A ECK CNCN H+++C FN +++ +S   SGGVC +C H+T GR CHQC +G++RD +KPL+H  VC  C CHPIGS    +C+  + QC CK GV GL+CNRC +G+QQ++S I PC+
Sbjct:   40 CYNKAHEPRACIPDFVNAAYD-APVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRHNEHEARCSDVTRPLV----------------SRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGAT-----------DLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTD-ASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCI 480          
BLAST of netrin 1 vs. Ensembl Fly
Match: NetB (gene:FBgn0015774 transcript:FBtr0304875)

HSP 1 Score: 230.72 bits (587), Expect = 7.144e-65
Identity = 129/416 (31.01%), Postives = 201/416 (48.32%), Query Frame = 2
Query:  971 VLKISDFFALADISIGGRCQCYGHA------------------------------------GRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAP----------------------ENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGE---MARFEMKVN---YVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILK--LHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQ 2020
             L IS  +A++D ++GGRC+C GHA                                    GR  +     T  C C+HNTAG +CE C+  + D+ W  AT N A ECK C CN H+++C FN +LY +S + SGGVC +C+H+T GRYCH C +GY+RD +KP +H  VC +C CHP+GS     C+  + QC CK GV GL+CNRC +G+QQT+S + PC+ V     +  A++                       +  C  C    K++   K+C +D  +L  +   ++  +     +F ++     Y Y I+     + +P     M+G  S+        + +    ++C+CP ++L  +YL++ +    A  Y     L +   SV L W+  W  RMK+F  +  +
Sbjct:  387 TLPISQHYAVSDFAVGGRCKCNGHASECVATVSSGSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTMTCACKHNTAGPECERCKPFYFDRPWGRATDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHYCREGYYRDATKPPNHRKVCKRCDCHPVGSTG-KTCNHLSGQCPCKEGVTGLTCNRCARGYQQTRSHVAPCIKVPTNANMIQAESAGGGGGGGTGDYKDGGGSQVEEMKKYCGKCKASPKKLNLNKFCMEDYAILAKVIGHDRASQDISTEKFSIERQNEIYKYEINIQTIFKRNP-----MSGTTSSLLGRGNMMLLVPRKSIECQCPKIKLNKSYLILGRDSEAAPGY-----LAIGPSSVVLEWKDEWSLRMKRFQRRARK 791          

HSP 2 Score: 89.7373 bits (221), Expect = 3.807e-18
Identity = 68/234 (29.06%), Postives = 104/234 (44.44%), Query Frame = 2
Query:  173 SNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-----DHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVN--------HGDNVNITFSFGKLFEIYYISLVLIPL-LEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSE 823
            SN  CY EGK  +C+P F N      P + +S CG  + +R C      +   C SC +  +    LTD +  +N+T W S  VN          DNV +T S GK +E+ YISL   P    PDS+ I KS D G +W  + ++S  C + +G           +KI++    ++    S  D+       +    AF T      ++  D       W++AT+IR+   + E
Sbjct:   30 SNDPCYFEGKPRKCLPSFVNAAYGN-PVQASSVCGAQQPERYCELLRDGNAGECRSCEQQRYGPAALTDLNNPSNVTCWRSGAVNVPHDPDSAPPDNVTLTLSLGKKYELTYISLSFCPRSPRPDSLAIFKSSDFGQTWQPFQFYSSQCQKFYG-------RPDRAKISKFNEQEARCINSQHDTG-----GAAQRFAFNTLEGRPSANDLDSSLVLQDWVTATDIRVVFHRLE 250          
BLAST of netrin 1 vs. Ensembl Fly
Match: NetB (gene:FBgn0015774 transcript:FBtr0302018)

HSP 1 Score: 230.72 bits (587), Expect = 7.144e-65
Identity = 129/416 (31.01%), Postives = 201/416 (48.32%), Query Frame = 2
Query:  971 VLKISDFFALADISIGGRCQCYGHA------------------------------------GRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAP----------------------ENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGE---MARFEMKVN---YVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILK--LHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQ 2020
             L IS  +A++D ++GGRC+C GHA                                    GR  +     T  C C+HNTAG +CE C+  + D+ W  AT N A ECK C CN H+++C FN +LY +S + SGGVC +C+H+T GRYCH C +GY+RD +KP +H  VC +C CHP+GS     C+  + QC CK GV GL+CNRC +G+QQT+S + PC+ V     +  A++                       +  C  C    K++   K+C +D  +L  +   ++  +     +F ++     Y Y I+     + +P     M+G  S+        + +    ++C+CP ++L  +YL++ +    A  Y     L +   SV L W+  W  RMK+F  +  +
Sbjct:  387 TLPISQHYAVSDFAVGGRCKCNGHASECVATVSSGSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTMTCACKHNTAGPECERCKPFYFDRPWGRATDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHYCREGYYRDATKPPNHRKVCKRCDCHPVGSTG-KTCNHLSGQCPCKEGVTGLTCNRCARGYQQTRSHVAPCIKVPTNANMIQAESAGGGGGGGTGDYKDGGGSQVEEMKKYCGKCKASPKKLNLNKFCMEDYAILAKVIGHDRASQDISTEKFSIERQNEIYKYEINIQTIFKRNP-----MSGTTSSLLGRGNMMLLVPRKSIECQCPKIKLNKSYLILGRDSEAAPGY-----LAIGPSSVVLEWKDEWSLRMKRFQRRARK 791          

HSP 2 Score: 89.7373 bits (221), Expect = 3.807e-18
Identity = 68/234 (29.06%), Postives = 104/234 (44.44%), Query Frame = 2
Query:  173 SNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-----DHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVN--------HGDNVNITFSFGKLFEIYYISLVLIPL-LEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSE 823
            SN  CY EGK  +C+P F N      P + +S CG  + +R C      +   C SC +  +    LTD +  +N+T W S  VN          DNV +T S GK +E+ YISL   P    PDS+ I KS D G +W  + ++S  C + +G           +KI++    ++    S  D+       +    AF T      ++  D       W++AT+IR+   + E
Sbjct:   30 SNDPCYFEGKPRKCLPSFVNAAYGN-PVQASSVCGAQQPERYCELLRDGNAGECRSCEQQRYGPAALTDLNNPSNVTCWRSGAVNVPHDPDSAPPDNVTLTLSLGKKYELTYISLSFCPRSPRPDSLAIFKSSDFGQTWQPFQFYSSQCQKFYG-------RPDRAKISKFNEQEARCINSQHDTG-----GAAQRFAFNTLEGRPSANDLDSSLVLQDWVTATDIRVVFHRLE 250          
BLAST of netrin 1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 350.517 bits (898), Expect = 2.703e-111
Identity = 216/646 (33.44%), Postives = 332/646 (51.39%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEI--TSTCGQNKKQRICV-------DHINCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            CY E G   RC+P F N        E+  +STCG+    R CV        H NCH+C     K  H   YLTD +  +N+T W SD ++ +  NV +T S GK FE+ Y+SL       P+S+ I KS+D G SW  + Y+S  C + +       N  S + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+I++T                         F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA RC+K+  D    C+C+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD SKP+SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC  G+QQ++SPI PC+      KIP+A         + P +   +C   + +++   KKYC+KD  + V +   ++ GE  +F + +  VY+   S+                 +QF      +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   40 CYDENGHPRRCIPDFVNA---AFGKEVRASSTCGKTP-SRYCVVTEKGDERHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQYPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIFKSMDYGKSWVPFQYYSTQCRKMY-------NKPSKATITKQN-EQEAICT---DSHTDMHPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVT-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVKD-RDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCI------KIPIAPPTTTASSTEEPSDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYKQGESRIRR-------------GDQF------LWVRAKDVACKCPKIKSGKKYLLLGNDE--DSPGQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of netrin 1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 350.517 bits (898), Expect = 2.703e-111
Identity = 216/646 (33.44%), Postives = 332/646 (51.39%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEI--TSTCGQNKKQRICV-------DHINCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            CY E G   RC+P F N        E+  +STCG+    R CV        H NCH+C     K  H   YLTD +  +N+T W SD ++ +  NV +T S GK FE+ Y+SL       P+S+ I KS+D G SW  + Y+S  C + +       N  S + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+I++T                         F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA RC+K+  D    C+C+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD SKP+SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC  G+QQ++SPI PC+      KIP+A         + P +   +C   + +++   KKYC+KD  + V +   ++ GE  +F + +  VY+   S+                 +QF      +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   40 CYDENGHPRRCIPDFVNA---AFGKEVRASSTCGKTP-SRYCVVTEKGDERHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQYPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIFKSMDYGKSWVPFQYYSTQCRKMY-------NKPSKATITKQN-EQEAICT---DSHTDMHPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVT-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVKD-RDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCI------KIPIAPPTTTASSTEEPSDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYKQGESRIRR-------------GDQF------LWVRAKDVACKCPKIKSGKKYLLLGNDE--DSPGQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of netrin 1 vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 335.109 bits (858), Expect = 2.019e-105
Identity = 201/640 (31.41%), Postives = 317/640 (49.53%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV----DHINCHSCM-------KDTHSINYLTDQHLNNNITFWASDFVNHGD-NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTT-----NNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHK---IPMAQAPENRCQHCNNKRK--RIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            CY E G A RC+P F N         ++S CG+   +   +    D     +C        ++ H  +YLTD +  +N+T W S+ +     NV +T S GK FEI Y+SL       P+S+ I KS+D G +WT + ++S  C R +       N  + + IT+    ++L CT   D        S  ++AF+T     +  +F S  S     W++ T+IR+                F+ P H +               LP++ +  +    +P  L  + ++A+ D  +GGRC+C GHA RC++   D    C+C+HNT G +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD  K ++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SP+ PC+ +  +     I   + P +   +C   +   +I  KKYC+KD  + V++   E  G+ A+F + +  VY+                      +        +W+   DL CKCP + +G  +L++         ER  L  D+ S+ + W+  W RR++KF  KE +G C K
Sbjct:   26 CYEETGAARRCIPEFINAAFGQ-EVSVSSVCGRPVSRSCSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENLQSSPLNVTLTLSLGKKFEITYVSLQFCSP-RPESLAIYKSMDYGRTWTPYQFYSSQCRRMY-------NRPNKAAITKQNEQEAL-CT---DGHTDLYPLSGGLIAFSTLDGRPSGKDFDS--SPVLQDWVTVTDIRVV---------------FSRPQHTR--------------ALPMSGRESEDALGAPGSLP-TYYYAVGDFQVGGRCKCNGHASRCVRE-KDGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVIKPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETVGDWAKFSVSLMSVYK-------------------SRGDPLKRGDHMLWVHMKDLACKCPRIHMGKRFLILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 599          
BLAST of netrin 1 vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 335.109 bits (858), Expect = 2.249e-105
Identity = 206/642 (32.09%), Postives = 325/642 (50.62%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-------DHINCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLC 2029
            CY E G   RC+P F N         ++STCG +   R CV          +C+ C     K TH   YLTD +  +N+T W S+ +V +  NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N  S + IT+   +Q   CT   DS       +  ++AF+T +    +H  D       W++AT+I++T                         FNR++                 +  +   + + S F+A++D+ +GGRC+C GHA +C+K+   N   C+C+HNTAG +C+ C+    D+ W  AT   A EC  C+CNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD SK +SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A           P +   HC   + +++   KKYC+KD  + V +   ++ GE  +F + +  VY+    +                 +Q       +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ +PW+  W RR++KF  ++ +G C
Sbjct:   40 CYDENGNPRRCIPDFVNSAFGKDV-RVSSTCG-SPPSRYCVVTEKGEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQSENYVQYPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIFKSMDYGKTWVPFQFYSTQCKKMY-------NKPSKAAITKQN-EQEAICT---DSHTDMQPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVT-------------------------FNRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLV-CECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVAAPTSSYSSPDGPTDCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGGHRIRR-------------GDQL------LWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of netrin 1 vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 335.109 bits (858), Expect = 2.249e-105
Identity = 206/642 (32.09%), Postives = 325/642 (50.62%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-------DHINCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLC 2029
            CY E G   RC+P F N         ++STCG +   R CV          +C+ C     K TH   YLTD +  +N+T W S+ +V +  NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N  S + IT+   +Q   CT   DS       +  ++AF+T +    +H  D       W++AT+I++T                         FNR++                 +  +   + + S F+A++D+ +GGRC+C GHA +C+K+   N   C+C+HNTAG +C+ C+    D+ W  AT   A EC  C+CNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD SK +SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A           P +   HC   + +++   KKYC+KD  + V +   ++ GE  +F + +  VY+    +                 +Q       +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ +PW+  W RR++KF  ++ +G C
Sbjct:   40 CYDENGNPRRCIPDFVNSAFGKDV-RVSSTCG-SPPSRYCVVTEKGEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQSENYVQYPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIFKSMDYGKTWVPFQFYSTQCKKMY-------NKPSKAAITKQN-EQEAICT---DSHTDMQPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVT-------------------------FNRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLV-CECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVAAPTSSYSSPDGPTDCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGGHRIRR-------------GDQL------LWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of netrin 1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 323.553 bits (828), Expect = 5.848e-101
Identity = 208/630 (33.02%), Postives = 312/630 (49.52%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASD-FVNHGD-NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNS-----WMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPM---AQAPENRCQHCNNKRK--RIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            CY E G   RCVP F N   N    + +STCG     R+   H +     K ++  +YLTD +   N+T W S+ F  H   NV++T S GK FE+ Y+SL       P+S+ I KS+D G SW  + Y+S  C + +G +P      S + +T+    ++L CT   D +      +  ++AF+T +      A D  NS     W++AT+IR+                F   PHL                  +  K  +     P       ++++ +  +GGRC+C GHA RC K+  +    CDC+HNT G +C+ C+    D+ W  AT   A EC  C CNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD S+ ++    C  C CHP+G+     C+Q   QC CK GV GL+CNRC KG+QQ++SPI PC+ +  +   P     + P +  Q+C   +   +I  KKYC+KD V+ V +   E  G  A+F + +  VY+    +                 + F      +WI   DL CKCP + L   YLV+         ER  L  D+ S+ + W+  W RR++K   +E +G C K
Sbjct:   41 CYDEHGLPRRCVPEFVNAAFNK-EVQASSTCG-----RLATRHCDTTDPRK-SYPASYLTDLNTAGNMTCWRSETFPRHSSQNVSLTLSLGKKFEVTYVSLQFCSP-RPESVAIFKSMDYGKSWVPYQYYSSQCRKVYG-KP------SRASVTKQNEQEAL-CT---DGQTELYPLTGGLIAFSTLDGR--PSAQDLDNSPVLQDWLTATDIRV----------------FFSRPHL------------------LGNKESEASDEGPGF-----YYSVGEFQVGGRCKCNGHASRCGKD-KEARLICDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTSTEEPADCEQYCKPPKGNYKINLKKYCKKDFVVQVNVLEMEMVGSWAKFTVNILSVYKCRDDRIKR-------------GDNF------LWIHIKDLSCKCPKILLSRRYLVMGSSEGPS--ERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKCLK 587          
BLAST of netrin 1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 305.064 bits (780), Expect = 3.388e-94
Identity = 200/625 (32.00%), Postives = 300/625 (48.00%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASD-FVNHGD-NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNS-----WMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            CY E G   RCVP F N   N    + +STCG     R+   H +     K ++  +YLTD +   N+T W S+ F  H   NV++T S GK FE+ Y+SL       P+S+ I KS+D G SW  + Y+S  C + +G +P      S + +T+    ++L CT   D +      +  ++AF+T +      A D  NS     W++AT+IR+                F   PHL                  +  K  +     P       ++++ +  +GGRC+C GHA RC K+  +    CDC+HNT G +C+ C+    D+ W  AT   A EC  C CNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD S+ ++    C  C CHP+G+     C+Q   QC CK GV GL+CNRC KG+QQ++SPI PC+ +  +   P   + E                    + AV+ V +   E  G  A+F + +  VY+    +                 + F      +WI   DL CKCP + L   YLV+         ER  L  D+ S+ + W+  W RR++K   +E +G C K
Sbjct:   41 CYDEHGLPRRCVPEFVNAAFNK-EVQASSTCG-----RLATRHCDTTDPRK-SYPASYLTDLNTAGNMTCWRSETFPRHSSQNVSLTLSLGKKFEVTYVSLQFCSP-RPESVAIFKSMDYGKSWVPYQYYSSQCRKVYG-KP------SRASVTKQNEQEAL-CT---DGQTELYPLTGGLIAFSTLDGR--PSAQDLDNSPVLQDWLTATDIRV----------------FFSRPHL------------------LGNKESEASDEGPGF-----YYSVGEFQVGGRCKCNGHASRCGKD-KEARLICDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTSTE--------------------EPAVVQVNVLEMEMVGSWAKFTVNILSVYKCRDDRIKR-------------GDNF------LWIHIKDLSCKCPKILLSRRYLVMGSSEGPS--ERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKCLK 562          
BLAST of netrin 1 vs. Ensembl Xenopus
Match: ntn1 (netrin 1 [Source:NCBI gene;Acc:779839])

HSP 1 Score: 303.138 bits (775), Expect = 3.739e-93
Identity = 208/678 (30.68%), Postives = 327/678 (48.23%), Query Frame = 2
Query:  104 GICPFVIFAILIQCQA-------QHWLHGGS-NSLCY-SEGKAFRCVPPFTNIIENMIPDEITS-TCGQNKKQRIC--VDHIN-----CHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFT--TNNPNFFS-HASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPE-------NRCQ-HCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCE 2032
            G  PF I ++L            +   HGG+ +  CY ++ +   C+P F N+   +  + ITS TCG+   Q++C  +D  N     C  C     ++++  +Y+TD    +  T W S+  +    NV +T   G+ FE+ Y SL       PDS+ I KS+D G +W  + ++S  C R +       +  + S I++  +    TCT   D + G    +  ++AF      P+      S     W++AT+IR+                          FNR++    +   + + RK              + F+ +++I +GGRC+C GHA RC          C+CQHNT G +C+ C+  + D+ W  AT ++A EC  C CNLHS +C FN +LY +S ++SGGVC++C HNT GR+CH C +GY RD SKP++    C  C+CHPIG++   +C+Q   QC CKTGV G +CNRC  G+QQ++S   PCV + +      +   E         CQ +C     R+    +KYC+KD VL   + S E+ GE  +F   V  VYR                              P+W+ + DL C C  +Q+G +YL+I      +  + + L+LD+ S+ALPW+  W  ++++F  +E +G C 
Sbjct:    7 GFIPFYIISLLCPVPRGQENNSNKASTHGGTPDGPCYDAKQRPKYCIPDFINVA--LGQEVITSNTCGRTP-QKLCYFLDSTNVTSRRCQLCDQKRPENSYPPSYMTD---TDAQTCWKSESGITFPQNVTLTLPLGRRFELVYASLRFCSP-RPDSMAIYKSMDYGKTWIPFQFYSTHCRRVY-------DQATTSAISKP-MQHEATCT---DFQTGVKPLTKGLVAFMPLAGRPSARRFEYSPVLQDWVTATDIRVV-------------------------FNRLH----HGKKMGIRRK--------------TAFYGVSEIQVGGRCKCNGHASRCTAG--KEGLMCECQHNTIGPECDACKPFYYDRPWQRATPSNAHECVACECNLHSHRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGAVN-AMCNQTTGQCQCKTGVTGPTCNRCAPGYQQSRSAHMPCVRIQEEMTTTASYPQEWKAGTNGTECQSYCKPSHSRVHMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYRQRRVPIRR-------------------GDQPLWVPDHDLACDCLRVQVGKSYLIIGNDE--ESPDPARLILDKNSLALPWRDVWGHKLRRFQQQERRGKCR 599          
BLAST of netrin 1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 188.348 bits (477), Expect = 4.374e-49
Identity = 140/467 (29.98%), Postives = 207/467 (44.33%), Query Frame = 2
Query:  185 CYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDH------INCHSCMKDT----HSINYLTDQHLNNNITFWASDFVNHG----DNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFS-HASDQYNSWMSATNIRITLRKSETNFLNSHLDG-FTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQ-TKSPITPCV 1534
            CY EG   RC+P F N   N      T+TCG    +  CV         +CH C        H   YLTD +    IT+W S  +  G      +N+T   GK F+I Y+ L       P+S  + K       W  + Y+S  C +++         ++   I     +Q   CT    S +  L       +     P+ ++   S     W++AT+IR+TL     N LN+  D  F+ P  LK Y+                                   +A++D ++GGRC+C GHA  C++N  +    C+C+HNT G DCE C   + D+ W  +T +S  EC  CNCN  S++C F+ +LY  +    GG C  C  NTDG  C +C + Y+R       ++  C  C+C+P+GS+    CD    +C+CK GV G  C+RCQ GF   T++   PC 
Sbjct:    4 CYEEGSPQRCMPEFVNAAFNATV-VATNTCG-TPPEEYCVQTGVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTLHLGKAFDITYVRLKFH-TSRPESFALYKRTHEDGPWIPYQYYSGSCEKTY-------QKFNRGFIRTGEDEQQALCTD-EFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTL-----NRLNTFGDEVFSDPKVLKSYY-----------------------------------YAISDFAVGGRCKCNGHASECVRNEFEKIV-CNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTGH--GGHCTGCADNTDGPNCERCRENYYRQ-----DNNEPCHACQCNPVGSLSTQ-CDNY-GRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCA 409          

HSP 2 Score: 80.1073 bits (196), Expect = 9.806e-15
Identity = 63/197 (31.98%), Postives = 88/197 (44.67%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCR-CHPIGSIYPDV---CDQRNSQC-TCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCN 1600
            C C GH+  C  +P      CDCQHNTAG  CE C EG+    +  +T  SA++C+ C C   S  C    +   V       VC +C   T G+ C  C+ GY  D   PL  +     CR C    +I P+    CD+   +C  C    GG  C+RC+ GF                +  P+AQ P+ +C+ C+
Sbjct:  687 CTCNGHSDTC--DPESGV--CDCQHNTAGPHCERCSEGY----YGDSTTGSASDCQPCPCPGGS-SCAVVPRTKEV-------VCTNCPLGTTGKRCELCDDGYFGD---PLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGF----------------YGNPLAQNPDLKCRACS 848          

HSP 3 Score: 54.299 bits (129), Expect = 9.179e-7
Identity = 44/140 (31.43%), Postives = 59/140 (42.14%), Query Frame = 2
Query: 1085 CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCT-CKTGVGGLSCNRCQKGF 1501
            C C     G+ CE C  G+   R    +    + C  C CN HS  C+              GVC DC+HNT G +C +C++GY+ D +   +    C  C C P GS    V   +   CT C  G  G  C  C  G+
Sbjct:  653 CSCPTGYIGQFCERCAPGY---RRENPSQGPYSPCVLCTCNGHSDTCD-----------PESGVC-DCQHNTAGPHCERCSEGYYGDSTTGSASD--CQPCPC-PGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGY 774          
BLAST of netrin 1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 188.348 bits (477), Expect = 4.543e-49
Identity = 140/467 (29.98%), Postives = 207/467 (44.33%), Query Frame = 2
Query:  185 CYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDH------INCHSCMKDT----HSINYLTDQHLNNNITFWASDFVNHG----DNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFS-HASDQYNSWMSATNIRITLRKSETNFLNSHLDG-FTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQ-TKSPITPCV 1534
            CY EG   RC+P F N   N      T+TCG    +  CV         +CH C        H   YLTD +    IT+W S  +  G      +N+T   GK F+I Y+ L       P+S  + K       W  + Y+S  C +++         ++   I     +Q   CT    S +  L       +     P+ ++   S     W++AT+IR+TL     N LN+  D  F+ P  LK Y+                                   +A++D ++GGRC+C GHA  C++N  +    C+C+HNT G DCE C   + D+ W  +T +S  EC  CNCN  S++C F+ +LY  +    GG C  C  NTDG  C +C + Y+R       ++  C  C+C+P+GS+    CD    +C+CK GV G  C+RCQ GF   T++   PC 
Sbjct:   28 CYEEGSPQRCMPEFVNAAFNATV-VATNTCG-TPPEEYCVQTGVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTLHLGKAFDITYVRLKFH-TSRPESFALYKRTHEDGPWIPYQYYSGSCEKTY-------QKFNRGFIRTGEDEQQALCTD-EFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTL-----NRLNTFGDEVFSDPKVLKSYY-----------------------------------YAISDFAVGGRCKCNGHASECVRNEFEKIV-CNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTGH--GGHCTGCADNTDGPNCERCRENYYRQ-----DNNEPCHACQCNPVGSLSTQ-CDNY-GRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCA 433          

HSP 2 Score: 76.2554 bits (186), Expect = 1.316e-13
Identity = 63/197 (31.98%), Postives = 86/197 (43.65%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCR-CHPIGSIYPDV---CDQRNSQC-TCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCN 1600
            C C GH+  C  +P      CDCQHNTAG  CE C EG+    +  +T  SA++C+ C C   S  C    +   V       VC +C   T G+ C  C+ GY  D   PL  +     CR C    +I P+    CD+   +C  C    GG  C+RC+ GF                +  P+AQ P+ +   CN
Sbjct:  711 CTCNGHSDTC--DPESGV--CDCQHNTAGPHCERCSEGY----YGDSTTGSASDCQPCPCPGGS-SCAVVPRTKEV-------VCTNCPLGTTGKRCELCDDGYFGD---PLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGF----------------YGNPLAQNPDLKSCSCN 872          

HSP 3 Score: 54.299 bits (129), Expect = 9.261e-7
Identity = 44/140 (31.43%), Postives = 59/140 (42.14%), Query Frame = 2
Query: 1085 CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCT-CKTGVGGLSCNRCQKGF 1501
            C C     G+ CE C  G+   R    +    + C  C CN HS  C+              GVC DC+HNT G +C +C++GY+ D +   +    C  C C P GS    V   +   CT C  G  G  C  C  G+
Sbjct:  677 CSCPTGYIGQFCERCAPGY---RRENPSQGPYSPCVLCTCNGHSDTCD-----------PESGVC-DCQHNTAGPHCERCSEGYYGDSTTGSASD--CQPCPC-PGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGY 798          
BLAST of netrin 1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 335.495 bits (859), Expect = 2.031e-105
Identity = 202/638 (31.66%), Postives = 327/638 (51.25%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHI------NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            G   RC+P F N         ++STCG+   +   V         +CH C     K  H   +LTD +  +N+T W S+ ++    NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N    + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+IR+                          F+R++                 +  +   + + S ++A++D+ +GGRC+C GHA RC+++  D++  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD  KP++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + PE+   +C   + +++   KKYCRKD  + + +   ++ G+  +F + +  VY+  TS+             G  S         +WI+  D+ CKCP ++    YL++   +A    ++S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   46 GHPRRCIPDFVNAAFGKDV-RVSSTCGRPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGRTWVPFQFYSTQCRKMY-------NRPHRAPITKQN-EQEAVCT---DSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVA-------------------------FSRLH-------------TFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRR----------GDQS---------LWIRSRDIACKCPKIKPLKKYLLL--GNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of netrin 1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 335.495 bits (859), Expect = 2.031e-105
Identity = 202/638 (31.66%), Postives = 327/638 (51.25%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHI------NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            G   RC+P F N         ++STCG+   +   V         +CH C     K  H   +LTD +  +N+T W S+ ++    NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N    + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+IR+                          F+R++                 +  +   + + S ++A++D+ +GGRC+C GHA RC+++  D++  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD  KP++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + PE+   +C   + +++   KKYCRKD  + + +   ++ G+  +F + +  VY+  TS+             G  S         +WI+  D+ CKCP ++    YL++   +A    ++S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   46 GHPRRCIPDFVNAAFGKDV-RVSSTCGRPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGRTWVPFQFYSTQCRKMY-------NRPHRAPITKQN-EQEAVCT---DSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVA-------------------------FSRLH-------------TFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRR----------GDQS---------LWIRSRDIACKCPKIKPLKKYLLL--GNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of netrin 1 vs. Ensembl Mouse
Match: Ntn3 (netrin 3 [Source:MGI Symbol;Acc:MGI:1341188])

HSP 1 Score: 276.559 bits (706), Expect = 1.869e-83
Identity = 188/621 (30.27%), Postives = 275/621 (44.28%), Query Frame = 2
Query:  173 SNSLCYSEGKAFR-CVPPFTNIIENMIPDEI--TSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGD-NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNN--PNFFS-HASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYH--CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCV--DVIDLHKIPMAQAPENRCQHCNNKRK--RIRFKKYCRKDAVLLVTMQSR-EQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSE----LLLDQKSVALPWQKTW 1981
            S   CY E +  R C+P    ++   +  E+  +STCG++   R+C       S  +  HS + LT      +   W SD +     NV +T   GK FE+ ++SL       P S+ + KS D+G SW    +FS  C   +G  P   +         S       C   P ++     +   +LAF+  +  P       S     W++AT+IRI L +      ++   G T P               YS                         ++  ++ +GGRC+C GHA RCL   +D   H  CDCQH T G DC  C+  + D+ W  AT   A  C  C+CN H+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD  + LS    C  C CHP+G+     C+Q   QC CK GV GL+CNRC  GFQQ++SP+ PCV   V    +      P++   HC   R   RI  KK+CRKD  + V + +R E  G   RF + V  V+R    +                       +  +W+   D  C CP L  G  YL++           +     L   + S+ LPW+  W
Sbjct:   26 SADPCYDEAREPRSCIP---GLVNAALGREVLASSTCGRSAN-RVCDS-----SDPQRAHSADLLTSAPGTASPLCWRSDLLQQAPFNVTLTVPLGKAFELVFVSLRFC-SAPPTSVALLKSQDHGRSWVPLGFFSSSCTLDYGRLPAPADG-------PSGPGPEALCFPAPQAQ----PDGGGLLAFSVQDGSPQGLDLDNSPVLQDWVTATDIRIVLTRPAIQG-DTRDGGVTVP---------------YS-------------------------YSATELQVGGRCKCNGHASRCL---LDTHGHLVCDCQHGTEGPDCSRCKPFYCDRPWQRATGQEAHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRVLSDRRACRACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPVPGPTEESSPVEPQDCESHCRPARGSYRISLKKFCRKDYAVQVAVGARGEARGSWTRFPVAVLAVFRSGEERAR-------------------RGSSALWVPTLDAACGCPRLLPGRRYLLLGGGPGAAAGSTAGRGQGLSAARGSLVLPWRDAW 561          
BLAST of netrin 1 vs. Ensembl Mouse
Match: Ntn5 (netrin 5 [Source:MGI Symbol;Acc:MGI:2685330])

HSP 1 Score: 208.764 bits (530), Expect = 2.878e-60
Identity = 120/364 (32.97%), Postives = 179/364 (49.18%), Query Frame = 2
Query:  974 LKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVID----LHKIPMAQAPENRCQ-HCNNKRKRIR--FKKYCRKDAVLLVTMQ-SREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVI---LKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCE 2032
            ++      L    + GRCQC+GHA RC          C C+H+T G  CE CR    D  W  AT      C  C+CN H+++C FN +L+ +S  +SGGVC  C H+T GR+CH C  G+ RD S+P++ H  C  C+CHPIG+    +C+Q + QC+CK GV GL+CNRC  G+QQ++SP  PC  + +        P+A   + +CQ +CN     +    ++YC++D VL   +  S  Q  E    E      +R+                 G             W+   DL C C  L+ G  YL++    + H     + + L+L++  +ALPW+  W R +++   KE  G C 
Sbjct:   24 VEFGGKAGLVTTGVRGRCQCHGHAARCATR--AQPPRCRCRHHTTGPGCESCRPSHRDWPWRPATPQHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPITSHKACRACQCHPIGATG-GMCNQTSGQCSCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTPATTPVASRSDPQCQGYCNVSVSSVHMSLQRYCQQDYVLHAQVSASSSQPSEAVGPEW-----WRLAVHVLAVFKQRAWPVRRGGQE---------AWVPRADLICGCLRLRPGADYLLLGRAAQTHDDDNYDPARLILNRHGLALPWRPRWARPLRRLQQKERGGACR 370          
BLAST of netrin 1 vs. Ensembl Mouse
Match: Lamc1 (laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914])

HSP 1 Score: 187.193 bits (474), Expect = 9.718e-49
Identity = 139/461 (30.15%), Postives = 206/461 (44.69%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDH------INCHSCMKDT----HSINYLTDQHLNNNITFWASDF----VNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFS-HASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQ-TKSPITPC 1531
            G+  RC+P F N   N+     T+TCG    +  CV         +CH C        H   +LTD +   + T+W S      V + +++N+T   GK F+I Y+ L       P+S  I K       W  + Y+S  C  ++      F       I     +Q   CT    S +  L       +     P+ ++   S     W++AT+IR+TL +                  L  + + ++                    N P VLK S ++A++D ++GGRC+C GHA  C+KN  D    C+C+HNT G DCE C   F D+ W  AT  SA+EC  C+CN  S++C F+ +LY  +    GG C +C  NTDG  C +C + + R     L +   C  C C P+GS+    CD    +C+CK GV G  C+RCQ GF   T++   PC
Sbjct:   43 GRPQRCMPEFVNAAFNVTV-VATNTCG-TPPEEYCVQTGVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLKFH-TSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGF-------IRTGGDEQQALCTD-EFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNR------------------LNTFGDEVF--------------------NDPKVLK-SYYYAISDFAVGGRCKCNGHASECVKNEFDK-LMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGH--GGHCTNCRDNTDGAKCERCRENFFR-----LGNTEACSPCHCSPVGSLSTQ-CDSY-GRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPC 443          

HSP 2 Score: 65.4698 bits (158), Expect = 2.488e-10
Identity = 55/195 (28.21%), Postives = 85/195 (43.59%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDV---CDQRNSQC-TCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHC 1597
            C C GH+  C  +P   T  CDC+ NTAG  CE C +G+    +  +T+ ++++C+ C C   S  C    K   V       VC  C   T G+ C  C+ GY  D         +C  C+C+   +I P+    C++   +C  C     G  C+RC++GF                   P+A  P ++C+ C
Sbjct:  722 CTCNGHSETC--DP--ETGVCDCRDNTAGPHCEKCSDGY----YGDSTLGTSSDCQPCPCPGGS-SCAIVPKTKEV-------VCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCN--DNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGF----------------FGNPLAPNPADKCKAC 882          

HSP 3 Score: 63.1586 bits (152), Expect = 1.233e-9
Identity = 51/154 (33.12%), Postives = 65/154 (42.21%), Query Frame = 2
Query: 1046 GRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSG-----GVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQ 1492
            G CLK          C +NTAG  C+ C+EGF     +    N A +CK C CN            Y    +QS      G C  C  +  GR C  C+ GY+      L     C +C CH +GS     CD R  QC C+ G+ G  C RC+
Sbjct:  845 GECLK----------CIYNTAGFYCDRCKEGFFGNPLAP---NPADKCKACACNP-----------YGTVQQQSSCNPVTGQC-QCLPHVSGRDCGTCDPGYYN-----LQSGQGCERCDCHALGSTNGQ-CDIRTGQCECQPGITGQHCERCE 967          

HSP 4 Score: 57.3806 bits (137), Expect = 8.045e-8
Identity = 45/140 (32.14%), Postives = 59/140 (42.14%), Query Frame = 2
Query: 1085 CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCT-CKTGVGGLSCNRCQKGF 1501
            C C     G+ CE C  G+   R    ++   + C  C CN HS+ C+              GVC DC  NT G +C +C+ GY+ D +  L     C  C C P GS    V   +   CT C TG  G  C  C  G+
Sbjct:  688 CTCPVGYGGQFCETCLPGY---RRETPSLGPYSPCVLCTCNGHSETCD-----------PETGVC-DCRDNTAGPHCEKCSDGYYGDST--LGTSSDCQPCPC-PGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGY 809          
BLAST of netrin 1 vs. UniProt/SwissProt
Match: sp|Q90922|NET1_CHICK (Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.095e-105
Identity = 210/670 (31.34%), Postives = 336/670 (50.15%), Query Frame = 2
Query:   89 QSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV------DHI-NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDV---IDLHKIPMAQAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            Q LR G     +FA+                 CY E G   RC+P F N        +++STCG+    R CV      + + +CH C     K  H  ++LTD +  +N+T W SD +V +  NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N  S + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+I++T                         F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA RC+++  DN   CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD SKP+SH   C +C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+ +            + P +   +C   + +++   KKYC+KD  + + +   E++ +  +F + +  VY+                     SN+       +W+   D+ CKCP ++    YL++         ++S ++ D+ S+ + W+ TW RR++KF  +E +G C K
Sbjct:   21 QPLRGGYPGLNMFAV----------QTAQPDPCYDEHGLPRRCIPDFVNSAFGK-EVKVSSTCGK-PPSRYCVVTEKGEEQVRSCHLCNASDPKRAHPPSFLTDLNNPHNLTCWQSDSYVQYPHNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGKTWVPFQFYSTQCRKMY-------NKPSRAAITKQN-EQEAICT---DSHTDVRPLSGGLIAFSTLDGRPTAHDFDNSPVLQDWVTATDIKVT-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVRDRDDNLV-CDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKECDCHPVGAA-GQTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPAAPPPTAASSTEEPADCDSYCKASKGKLKINMKKYCKKDYAVQIHILKAEKNADWWKFTVNIISVYKQG-------------------SNRLRRGDQTLWVHAKDIACKCPKVKPMKKYLLLGSTE--DSPDQSGIIADKSSLVIQWRDTWARRLRKFQQREKKGKCRK 605          
BLAST of netrin 1 vs. UniProt/SwissProt
Match: sp|O95631|NET1_HUMAN (Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2)

HSP 1 Score: 336.265 bits (861), Expect = 5.957e-105
Identity = 203/638 (31.82%), Postives = 327/638 (51.25%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHI------NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            G   RC+P F N         ++STCG+   +   V         +CH C     K  H   +LTD +  +N+T W S+ ++    NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N    + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+IR+                          F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA RC+++  D++  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD  KP++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + PE+   +C   + +++   KKYC+KD  + + +   ++ G+  +F + +  VY+  TS+             G  S         +WI+  D+ CKCP ++    YL++   +A    ++S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   46 GHPRRCIPDFVNAAFGKDV-RVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGRTWVPFQFYSTQCRKMY-------NRPHRAPITKQN-EQEAVCT---DSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVA-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRR----------GDQS---------LWIRSRDIACKCPKIKPLKKYLLL--GNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of netrin 1 vs. UniProt/SwissProt
Match: sp|O09118|NET1_MOUSE (Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=3)

HSP 1 Score: 335.495 bits (859), Expect = 1.420e-104
Identity = 202/638 (31.66%), Postives = 327/638 (51.25%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHI------NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            G   RC+P F N         ++STCG+   +   V         +CH C     K  H   +LTD +  +N+T W S+ ++    NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N    + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+IR+                          F+R++                 +  +   + + S ++A++D+ +GGRC+C GHA RC+++  D++  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD  KP++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + PE+   +C   + +++   KKYCRKD  + + +   ++ G+  +F + +  VY+  TS+             G  S         +WI+  D+ CKCP ++    YL++   +A    ++S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   46 GHPRRCIPDFVNAAFGKDV-RVSSTCGRPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGRTWVPFQFYSTQCRKMY-------NRPHRAPITKQN-EQEAVCT---DSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVA-------------------------FSRLH-------------TFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRR----------GDQS---------LWIRSRDIACKCPKIKPLKKYLLL--GNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of netrin 1 vs. UniProt/SwissProt
Match: sp|Q924Z9|NET1_RAT (Netrin-1 OS=Rattus norvegicus OX=10116 GN=Ntn1 PE=1 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 4.801e-102
Identity = 200/638 (31.35%), Postives = 324/638 (50.78%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHI------NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            G   RC+P F N         ++STCG+   +   V         +CH C     K  H   +LTD +  +N+T W S+ ++    NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N    + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+IR+                          F+R++                 +  +   + + S ++A++D+ +GGRC+C GHA RC+++  D++  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD  KP++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + PE+   +C   + +++   KKYCRKD  + + +   ++ G+  +F + +  VY+  TS+             G  S         +WI+  D+  KCP ++    YL++   +A    ++S ++ D+  + + W+ TW RR +KF  +E +G C+K
Sbjct:   46 GHPRRCIPDFVNAAFGKDV-RVSSTCGRPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGRTWVPFQFYSTQCRKMY-------NRPHRAPITKQN-EQEAVCT---DSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVA-------------------------FSRLH-------------TFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVAPPTTAASSMEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRR----------GDQS---------LWIRSRDIAXKCPKIKPLKKYLLL--GNAEDSPDQSGIVADKSXLVIQWRDTWARRXRKFQQREKKGKCKK 603          
BLAST of netrin 1 vs. UniProt/SwissProt
Match: sp|Q2HXW4|NET1_PIG (Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 6.305e-102
Identity = 198/635 (31.18%), Postives = 321/635 (50.55%), Query Frame = 2
Query:  197 GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHI------NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGL 2026
            G   RC+P F N         ++STCG+   +   V         +CH C     K  H   +LTD +  +N+T W S+ ++    NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + +       N    + IT+   +Q   CT   DS       S  ++AF+T +    +H  D       W++AT+IR+                          F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA RC+++  D++  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY RD  KP++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + PE+   +C   + +++   KKYC+KD  + + +   ++ G+  +F + +  VY+   S+      +                   +WI+  D+ CKCP ++    YL++   +A    ++S ++ D+ S+ + W+ TW RR++KF  +E + L
Sbjct:   46 GHPRRCIPDFVNAAFGKDV-RVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGRTWVPFQFYSTQCRKMY-------NRPHRAPITKQN-EQEAVCT---DSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVA-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYFRDLGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGVTCNRCAKGYQQSRSPIAPCI------KIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGASRIRRGDQN-------------------LWIRSRDIACKCPKIKPLKKYLLL--GNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKEL 600          
BLAST of netrin 1 vs. TrEMBL
Match: Q49BF9 (Netrin 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1399.03 bits (3620), Expect = 0.000e+0
Identity = 668/669 (99.85%), Postives = 668/669 (99.85%), Query Frame = 2
Query:   83 MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV 2089
            MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQ ICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV
Sbjct:    1 MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQWICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV 669          
BLAST of netrin 1 vs. TrEMBL
Match: Q8WPG7 (Netrin 1 (Fragment) OS=Dugesia japonica OX=6161 GN=Djnet1 PE=2 SV=1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 269/325 (82.77%), Postives = 294/325 (90.46%), Query Frame = 2
Query: 1115 DCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV 2089
            +CE+CR GFVDKRW++A +NSA ECKRCNCNLHSKKC F+EKLYI+SN+QSGGVCVDCEHNTDGRYCH C KGYHRDWSKPLSH HVC+KCRCHPIGS+YPD CDQRNSQC CK GV GLSCNRCQKGFQQT+SPI PCV+  DLHKIPMAQAPEN+CQ CNNKRKRIRFKKYCRKDAVLLVTMQSREQHG+M RFEM+VN+VYRIDT KF+E +PDFLASMNGI+SNQF HSTFPMWIKE DLKCKCPSL LGMTYLV+LKLH IKYLERSELLLDQKSVALPWQKTWERRMKKF++KE QGLC KWKLKR Y  + + +  YV
Sbjct:    1 NCEVCRIGFVDKRWTIAAINSAGECKRCNCNLHSKKCSFDEKLYILSNRQSGGVCVDCEHNTDGRYCHVCKKGYHRDWSKPLSHQHVCLKCRCHPIGSVYPDKCDQRNSQCMCKPGVTGLSCNRCQKGFQQTRSPIHPCVETYDLHKIPMAQAPENKCQQCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGDMVRFEMRVNHVYRIDTLKFSETNPDFLASMNGIISNQFSHSTFPMWIKEADLKCKCPSLLLGMTYLVVLKLHTIKYLERSELLLDQKSVALPWQKTWERRMKKFASKEQQGLCVKWKLKRSYRHQYRQSNRYV 325          
BLAST of netrin 1 vs. TrEMBL
Match: G4VPQ4 (Putative netrin OS=Schistosoma mansoni OX=6183 GN=Smp_146840 PE=4 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 4.765e-148
Identity = 257/644 (39.91%), Postives = 370/644 (57.45%), Query Frame = 2
Query:  176 NSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSC----MKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLE-PDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIP-DSKLGNLVNSPSVLAFTTNNPNFFSHA-SDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRK--NNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMS----NQFIHST---------FPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWK 2041
            NSLC S  ++F+C PPF +I    +    TSTCG+++ Q +C  + NC  C     K   S  YLTD+H   N T WAS ++  G+ VN+T S GK FE+YYISL    +   P SI I KS D G +W  WHYFS DCYR+FG+ P    H  +S IT + + + L     P +S   + V S  V+AF+T      +   S     WM+ T++RI+L     +F  S+   +           RI R    N  + L VN +        P +L   DF+A ADI+IGGRC+C GHA  C+    +    C C+H+T+G+DCE C+ G++D+ W  AT   A  CK+C+CNLHS +C F+  LY++SN+ SGG+C +C+HNT GR CHQC +GY+RDW+KP+SH +VC+ CRCHPIGSI    CD+R+ QC CK GV GL+C+RCQ G+ QT+SP+ PC               +  C  C+  ++RI+ KK+CRKDAV   + +SRE H  MARFEM +  ++RI+   F      +  +    +     NQ  H            P+W++  +LKCKCP ++LG++YL++    +     R+ELL   K+  LPW+ +W+RR+ +F  +E++G CEK++
Sbjct:   71 NSLCQSGSQSFQCAPPFKDISRG-VSVYSTSTCGEHQPQNLCRSNTNCQLCSVNSTKWKFSSEYLTDRHDVENQTCWASGYIRPGEAVNLTISLGKRFEVYYISLQPCSIGSIPHSIAIYKSSDFGRTWRPWHYFSTDCYRAFGL-PTSNEH--NSHITSANLQEVLCVALQPRESYYSHQVPSDWVIAFSTTLGRPATRPWSPALIDWMTMTDVRISL----MSFHQSNEPEY-----------RIKRNAYRNSQTDLKVNIRKSVNVTIDPKILSEIDFYAFADIAIGGRCKCNGHASECILGS-NGKLICACEHHTSGEDCEYCKPGYMDRPWDRATTQDANVCKKCDCNLHSNECRFSNSLYLLSNRISGGICENCQHNTIGRNCHQCAEGYYRDWTKPISHENVCLPCRCHPIGSIVRHDCDRRSGQCRCKQGVAGLTCDRCQDGYHQTRSPLNPCT------------KGDINCPPCSTNKERIKLKKFCRKDAVFEASFKSRELHENMARFEMHITQIWRINKEFFKGSSSIYWPASKSFIDFEQHNQGEHEEEIRRKSNELVPVWVRLNELKCKCPYIELGVSYLIVTDFESFTNKIRNELLFSTKTAILPWRSSWKRRLIRFRRRENRGACEKFR 682          
BLAST of netrin 1 vs. TrEMBL
Match: A0A3Q0KP82 (Putative netrin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 4.074e-143
Identity = 266/717 (37.10%), Postives = 384/717 (53.56%), Query Frame = 2
Query:  176 NSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSC----MKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLE-PDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPD----SKLGNLVNS--------------------PS--VLAFTTNNPNFFSHA-SDQYNSWMSATNIRITLR----------KSETNFLNSHLDGFTYPPHLKQYFNRI------YRKNNYSSI-LPVNRKLK---------QKKRN-----------------------SPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPEN-RCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMS----NQFIHST---------FPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWK 2041
            NSLC S  ++F+C PPF +I    +    TSTCG+++ Q +C  + NC  C     K   S  YLTD+H   N T WAS ++  G+ VN+T S GK FE+YYISL    +   P SI I KS D G +W  WHYFS DCYR+FG+ P    H  +S IT + + + L     P     S  G  V S                    PS  V+AF+T      +   S     WM+ T++RI+L           + + N   S L   +      Q  N++      Y  +N++   L   R L+         QK+ N                        P +L   DF+A ADI+IGGRC+C GHA  C+    +    C C+H+T+G+DCE C+ G++D+ W  AT   A  CK+C+CNLHS +C F+  LY++SN+ SGG+C +C+HNT GR CHQC +GY+RDW+KP+SH +VC+ CRCHPIGSI    CD+R+ QC CK GV GL+C+RCQ G+ QT+SP+ PC        + +A  P +  C  C+  ++RI+ KK+CRKDAV   + +SRE H  MARFEM +  ++RI+   F      +  +    +     NQ  H            P+W++  +LKCKCP ++LG++YL++    +     R+ELL   K+  LPW+ +W+RR+ +F  +E++G CEK++
Sbjct:   71 NSLCQSGSQSFQCAPPFKDISRG-VSVYSTSTCGEHQPQNLCRSNTNCQLCSVNSTKWKFSSEYLTDRHDVENQTCWASGYIRPGEAVNLTISLGKRFEVYYISLQPCSIGSIPHSIAIYKSSDFGRTWRPWHYFSTDCYRAFGL-PTSNEH--NSHITSANLQEVLCVALQPRESYYSHQGRRVRSMNSYIFNKPNITRNFGGMGVPSDWVIAFSTTLGRPATRPWSPALIDWMTMTDVRISLMSFHQSNEPEYRIKRNAYRSQLSDHSKLTQNSQTINKLPLFQSNYFYDNFNKYQLKRTRNLRDGQTITELPQKEMNHTNNIDSQTDLKVNIRKSVNVTIDPKILSEIDFYAFADIAIGGRCKCNGHASECILGS-NGKLICACEHHTSGEDCEYCKPGYMDRPWDRATTQDANVCKKCDCNLHSNECRFSNSLYLLSNRISGGICENCQHNTIGRNCHQCAEGYYRDWTKPISHENVCLPCRCHPIGSIVRHDCDRRSGQCRCKQGVAGLTCDRCQDGYHQTRSPLNPCTKDFTSRAVALAHTPGDINCPPCSTNKERIKLKKFCRKDAVFEASFKSRELHENMARFEMHITQIWRINKEFFKGSSSTYWPASKSFIDFEQHNQGEHEEEIRRKSNELVPVWVRLNELKCKCPYIELGVSYLIVTDFESFTNKIRNELLFSTKTAILPWRSSWKRRLIRFRRRENRGACEKFR 782          
BLAST of netrin 1 vs. TrEMBL
Match: A0A4Z2DC78 (Netrin-B isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_002313 PE=4 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 4.567e-139
Identity = 258/708 (36.44%), Postives = 378/708 (53.39%), Query Frame = 2
Query:  212 CVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDT----HSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLE-PDSIIISKSIDNGTSWTEWHYFSKDCYRSFGI-----------------------QPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHA-SDQYNSWMSATNIRITL----------------------------RKSETNF--------------LNSH--------LDGFTYPPHLKQYFNR--IYRKNNYSSIL---PVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPEN-RCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFL-ASMNGIMSNQFIHSTF------------PMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWK 2041
            C PPF +I    +    TSTCG+++ Q +C    +C  C  ++     S +YLTD+H  NN T WAS  +  G+ VN+T S GK FE+YYISL    +   P SI I KS D G +W  WHYFS DCYR+FG+                       QP +  +    +   S  +      ++ ++  G  V S  V+AF+T      +   S     WM+ T++RI+L                            ++S  N               LN H         DG +     +Q  N   + +  NY S+L   P+N  +      SP VL   DF+A ADI+IGGRC+C GHA  C+ +  +    C C+H+T+G DCE C+ G++D+ W  AT   A  CK+C+CNLHS +C F+  LY++SN+ SGGVC +C+HNT GR CHQC +GY+RDW+KP+SH +VC+ CRCHPIGSI    CD+R+ QC CK GV GL+C+RCQ G+ QT+SP+ PC        + +A  P +  C  C+  ++RI+ KK+CRKDAV   + +SRE HG MARFEM +  ++RI+          +  AS + I   ++ H  +            P+W++  +LKCKCP ++LG++YL++    +     R+ELL   K+  LPW+ +W+RR+ +F  +E++G CEK++
Sbjct:   85 CSPPFKDISRG-VTVHATSTCGEHQPQSLCRSSTDCQLCSVNSTEWKFSSDYLTDRHNINNQTCWASGHIQPGEVVNLTISLGKRFEVYYISLQPCSIGSMPHSIAIYKSSDFGRTWRPWHYFSTDCYRAFGLPTSNEHSIHITSANLQEVLCVALQPRESYYNHQGRKVRSMNNYIFNKPNVTNNFGGIGVPSDWVIAFSTTLGRPVTRPWSPALIDWMTMTDVRISLMNFHQNNEPEYRTKRTAHQNQLPHYSKLKQSSQNINRLPLFQSNYFYENLNKHQPKRTRSSRDGHSGNELARQEINHTNMMQNQNYLSVLTKQPLNATV------SPEVLSEIDFYAFADIAIGGRCKCNGHASECVLSS-NGKLTCACEHHTSGDDCEYCKPGYMDRPWDRATPQDANICKKCDCNLHSNECRFSNSLYLLSNRVSGGVCENCQHNTVGRNCHQCAEGYYRDWTKPISHENVCLPCRCHPIGSIVRHDCDRRSGQCRCKQGVAGLTCDRCQDGYHQTRSPLNPCTKDFTSRAVALAHTPGDINCPPCSTNKERIKLKKFCRKDAVFQASFKSRELHGNMARFEMYITQIWRINKEFLKGSSSIYWPASKSFIDFERYDHDEYDEEIQRKSNELVPVWVRLNELKCKCPYIELGISYLIVTDFESFTNKVRNELLFSIKTAILPWRSSWKRRLIRFRRRENRGACEKFR 784          
BLAST of netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 349.747 bits (896), Expect = 3.663e-111
Identity = 214/648 (33.02%), Postives = 320/648 (49.38%), Query Frame = 2
Query:  164 HGGSNSLCYSE-GKAFRCVPPFTNIIENMIPDEI--TSTCGQNKKQRICVDHIN------CHSC----MKDTHSINYLTDQHLNNNITFWASDFVNHG--DNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPE------NRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
             G S   CY E G A RC+P F N        E+  +STCG     R C           CH+C     K  H  +YLTD +  +N+T W S+        NV +T S GK FE+ Y+S+       PDS+ I KS+D G +W  + ++S  C + F       N  + + IT+   +Q   CT   D+       S  ++AF+T +    +H  D       W++AT++R+T  +             T P                                 P   + S F+A++D+ +GGRC+C GHA RC+K        CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD SKP+SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+ +        A +PE      + C+    K K I  KKYC+KD  + V +   ++ GE  +F + +  VY+   S+                 +Q       +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   30 QGSSPDPCYDEHGAARRCIPDFVNA---AFGKEVRASSTCGLKGPSRYCAQDKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQGNVTLTLSLGKKFEVTYVSVQFCSK-RPDSMAIFKSMDYGKTWVPFQFYSTQCRKVF-------NRPNRAAITKQN-EQEAVCT---DAHADGRPLSGGLVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSR------------LTAP-------------------------------GEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTTASSPEEPADCDSYCKASKGKLK-INMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYKQGESRIRR-------------GDQL------LWVRAKDVACKCPKIKTGKKYLLLGNDE--DSPGQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 596          
BLAST of netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 350.132 bits (897), Expect = 2.432e-109
Identity = 213/646 (32.97%), Postives = 318/646 (49.23%), Query Frame = 2
Query:  164 HGGSNSLCYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHIN------CHSC----MKDTHSINYLTDQHLNNNITFWASDFVNHG--DNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPE------NRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
             G S   CY E G A RC+P F N          +STCG     R C           CH+C     K  H  +YLTD +  +N+T W S+        NV +T S GK FE+ Y+S+       PDS+ I KS+D G +W  + ++S  C + F       N  + + IT+   +Q   CT   D+       S  ++AF+T +    +H  D       W++AT++R+T  +             T P                                 P   + S F+A++D+ +GGRC+C GHA RC+K        CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD SKP+SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+ +        A +PE      + C+    K K I  KKYC+KD  + V +   ++ GE  +F + +  VY+   S+                 +Q       +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:  207 QGSSPDPCYDEHGAARRCIPDFVNAAFGK-EVRASSTCGLKGPSRYCAQDKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQGNVTLTLSLGKKFEVTYVSVQFCSK-RPDSMAIFKSMDYGKTWVPFQFYSTQCRKVF-------NRPNRAAITKQN-EQEAVCT---DAHADGRPLSGGLVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSR------------LTAP-------------------------------GEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTTASSPEEPADCDSYCKASKGKLK-INMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYKQGESRIRR-------------GDQL------LWVRAKDVACKCPKIKTGKKYLLLGNDE--DSPGQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 773          
BLAST of netrin 1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 344.354 bits (882), Expect = 9.277e-109
Identity = 207/644 (32.14%), Postives = 325/644 (50.47%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEI--TSTCGQNKKQRICV-------DHINCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPM---------AQAPENRCQHCNNKRKRIR--FKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLC 2029
            CY E G+  RC+P F N        E+  +STCG     R CV           CH+C     K  H   YLTD +  +N+T W S+ +V H  NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + F       N  S + IT+   +Q   CT   DS       +  ++AF+T +    +H  D       W++AT++R+T                         F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA +C+K+       C+C+HNTAG +C+ C+    D+ W  AT   A EC  C+CNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD +K +SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+         A+ P +   HC   + +++   KKYC+KD  + V +   ++ GE  +F + +  VY+    +                 +Q       +W++  D+ CKCP ++ G  YL +L         +S ++ D+ S+ +PW+  W RR++KF  ++ +G C
Sbjct:   57 CYDENGQPRRCIPDFVNA---AFGKEVRASSTCGAQTAARYCVVTERGEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQSESYVQHPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGKTWVPFQFYSTQCKKMF-------NRPSRAAITKQN-EQEAVCT---DSHTDMRPLAGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVT-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVASPTATYTSAEEPTDCDSHCKASKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGEHRIRR-------------GDQL------LWVRAKDVACKCPKIKPGKKYL-LLGSDDDDSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 620          
BLAST of netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 272.707 bits (696), Expect = 1.038e-80
Identity = 186/642 (28.97%), Postives = 284/642 (44.24%), Query Frame = 2
Query:  164 HGGSNSLCYSE-GKAFRCVPPFTNIIENMIPDEI--TSTCGQNKKQRICVDHIN------CHSC----MKDTHSINYLTDQHLNNNITFWASDFVNHG--DNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
             G S   CY E G A RC+P F N        E+  +STCG     R C           CH+C     K  H  +YLTD +  +N+T W S+        NV +T S GK FE+ Y+S+       PDS+ I KS+D G +W  + ++S  C + F       N  + + IT+   +Q   CT   D+       S  ++AF+T +    +H  D       W++AT++R+T  +             T P                                 P   + S F+A++D+ +GGRC+C GHA RC+K        CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD SKP+SH   C +    P  +      +  +    CK   G L                                              +I  KKYC+KD  + V +   ++ GE  +F + +  VY+   S+                 +Q       +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:  207 QGSSPDPCYDEHGAARRCIPDFVNA---AFGKEVRASSTCGLKGPSRYCAQDKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQGNVTLTLSLGKKFEVTYVSVQFCSK-RPDSMAIFKSMDYGKTWVPFQFYSTQCRKVF-------NRPNRAAITKQN-EQEAVCT---DAHADGRPLSGGLVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSR------------LTAP-------------------------------GEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKEIPVAPPTTTASSPEEPADCDSYCKASKGKL----------------------------------------------KINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYKQGESRIRR-------------GDQL------LWVRAKDVACKCPKIKTGKKYLLLGNDE--DSPGQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 723          
BLAST of netrin 1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 265.774 bits (678), Expect = 1.390e-79
Identity = 177/633 (27.96%), Postives = 286/633 (45.18%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEI--TSTCGQNKKQRICV-------DHINCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLC 2029
            CY E G+  RC+P F N        E+  +STCG     R CV           CH+C     K  H   YLTD +  +N+T W S+ +V H  NV +T S GK FE+ Y+SL       P+S+ I KS+D G +W  + ++S  C + F       N  S + IT+   +Q   CT   DS       +  ++AF+T +    +H  D       W++AT++R+T                         F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA +C+K+       C+C+HNTAG +C+ C+    D+ W  AT   A EC  C+CNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY+RD +K +SH   C +       + Y    +  +    CK   G +                                              ++  KKYC+KD  + V +   ++ GE  +F + +  VY+    +                 +Q       +W++  D+ CKCP ++ G  YL +L         +S ++ D+ S+ +PW+  W RR++KF  ++ +G C
Sbjct:   57 CYDENGQPRRCIPDFVNA---AFGKEVRASSTCGAQTAARYCVVTERGEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQSESYVQHPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGKTWVPFQFYSTQCKKMF-------NRPSRAAITKQN-EQEAVCT---DSHTDMRPLAGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVT-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACKEIPVASPTATYTSAEEPTDCDSHCKASKGKM----------------------------------------------KVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGEHRIRR-------------GDQL------LWVRAKDVACKCPKIKPGKKYL-LLGSDDDDSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 570          
BLAST of netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009682.1 (pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 gene:ENSPMAG00000008750.1 transcript:ENSPMAT00000009682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 1.851e-41
Identity = 109/366 (29.78%), Postives = 170/366 (46.45%), Query Frame = 2
Query:  446 GKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQ--SLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQT-KSPITPCV 1534
            GK F+I Y+ L       P+S  I K       WT + Y+S  C  ++G +   F    D + T    D+   ++  +  +     L   PS   F  N+P            W+++T IR+TL +                  L  + + ++                    N   VL+ S ++A++D ++GGRC+C GHA  C+KN +     C C+HNT G DCE C   + D+ W  AT  SA EC  C+CN  + +C F+ +LY  +    GG C +C  NTDG+ C +C + ++R   +  S H  C+ C C+P+GS Y   CD++  +C+CK GV G  C++C  GF    ++   PC 
Sbjct:    1 GKAFDITYVRLKFH-TSRPESFAIYKRASMDGPWTPYQYYSGSCEPTYGKRNRGFLRSGDDEQTPLCTDEFSDISPLTGGNVAFSTLEGRPSAYNFD-NSPVL--------QDWVTSTEIRVTLNR------------------LNTFGDEVF--------------------NDHKVLR-SYYYAISDFAVGGRCKCNGHASECVKNEL-GALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGH--GGHCTNCRDNTDGKTCERCLENFYR---RSASEH--CLPCNCNPVGS-YSRQCDEQ-GRCSCKQGVMGERCDQCLPGFHSMDEAGCRPCT 307          
BLAST of netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008925.1 (pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 gene:ENSPMAG00000008054.1 transcript:ENSPMAT00000008925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 3.504e-28
Identity = 96/375 (25.60%), Postives = 154/375 (41.07%), Query Frame = 2
Query:  449 KLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFS---KDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTY--PPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEF-------NEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVC-----------DQRNSQCTCKTGVGGLSCNRCQKGFQ 1504
            ++F++ Y+ +       P + I+ +S+D G ++  W Y+S    +C   +GI P   N            D  + CTS     L  ++    +     N        S +   + SA  IR+ L++  T  LN+ L   ++  P  +     R Y                              ++++ DIS+GG C C GHA  C  N       C C+HNT G++C+ C  G+  +RW   T+N+   C++CNC+  ++ C +       N  L +      GGVCV+C  NT G  C  C  G++R      +  + C  C+C P GS+   VC           D    QC C+ G  G  C RC   ++
Sbjct:    1 QVFQVAYVIVKAANSPRPGNWILERSLD-GATYHPWQYYSVSDSECLTRYGITPTVGNPVYRR-------DDEVICTSYYVVLL--MLARGKIHTSLINGRPSADDPSPKLLDFTSARYIRLRLQRIRT--LNADLMTLSHRDPREVDPIVTRRY------------------------------YYSIKDISVGGMCICSGHASTCPWNEDTQKMECQCEHNTCGENCQHCCPGYNQRRWRPGTINNGNTCEKCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPYPCRLCQCDPQGSLS-QVCIKDEKHADPEKDLSPGQCLCRPGFAGERCERCAFAYR 332          

HSP 2 Score: 65.4698 bits (158), Expect = 3.224e-11
Identity = 61/219 (27.85%), Postives = 81/219 (36.99%), Query Frame = 2
Query: 1016 GGRCQ---CYGHAGRCLKNPVDNTYH-CDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLH----------------------------SKKCEFNEKLYIVSNKQSGGVCVDCEHN-------------------------TDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
            GGRC+   C+GHA  C     D       C+HNT G  CE+CR GF    +  AT  +A +C  C C L                               +CE     +       GG C  CE N                         T G +C +C  G++ D +        C  C+CHP G+  P  CD+ N QC C+  V G +C +C  GF
Sbjct:  619 GGRCEPCRCHGHADDCDDLSGDCMLPLSGCRHNTMGPHCELCRPGF----YGNATRGTADDCLPCTCPLSIASNNFSPTCHQDPRGVLTCDQCLPGYIGLRCERCADDFFGEPSSPGGSCRRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGG----CQPCQCHPEGATAPQ-CDRINGQCPCRPSVVGRTCEQCAIGF 828          

HSP 3 Score: 58.151 bits (139), Expect = 6.930e-9
Identity = 50/152 (32.89%), Postives = 61/152 (40.13%), Query Frame = 2
Query: 1076 TYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNL-HSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGS-----IYPDV-----CDQRNSQCTCKTGVGGLSCNRCQKG 1498
            T  C C  NT G  C  C    +D  W V   N  A C+ CNC+  HS+    +E         + G C  C     GR C +C +G    W  P      C  C CHP G+       P       CD+R  QC CK  VGG  C+ C  G
Sbjct:  900 TGRCLCPPNTEGTRCHRC----IDDHWGV---NPHAGCRACNCSAAHSRGARCDE---------ASGQC-SCLDGYGGRTCGECAQGR---WGYP-----ACRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCACKENVGGTRCDACLPG 1026          

HSP 4 Score: 54.299 bits (129), Expect = 8.997e-8
Identity = 50/173 (28.90%), Postives = 69/173 (39.88%), Query Frame = 2
Query: 1016 GGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKG-FQQTKSPITPC 1531
            GGR  C    G+CL+          C+  TAG  CE C +GF               C+ C C+         +++    N Q       C  +  GR C QC  G++      LS    C  C CHP+G+    V    + +C C  GV G SC+RC  G +   +   TPC
Sbjct:  748 GGR-VCDARTGQCLR----------CRERTAGFHCERCADGFY------GDATGTGGCQPCQCHPEGATAPQCDRI----NGQ-----CPCRPSVVGRTCEQCAIGFYG-----LSSGAGCSPCPCHPVGTA--GVACSADGRCHCWPGVEGRSCDRCTSGHYGFKEGGCTPC 887          
BLAST of netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004606.1 (pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004606.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 1.212e-22
Identity = 64/249 (25.70%), Postives = 106/249 (42.57%), Query Frame = 2
Query:  446 GKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQ--SLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAE 1186
            GK F+I Y+ L       P+S  I K     + W  + ++S  C R+FG+    F    D + T    D+   ++  +  +     L   P  LAF  N+             W++AT++R++LR+                  L  + + ++                      P VL+ S ++A++D+++GGRC+C+GHA  C +   D    C CQHNT G DCE C      + W+ A+ + A E
Sbjct:    3 GKAFQITYVRLRFH-TSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGLPSRGFLRAGDEERTALCSDEFSDISPLTGGNVAFSTLEGRPGALAFDGND--------KLQQEWVTATDVRVSLRR------------------LNTFGDEVF--------------------GDPKVLR-SYYYAVSDLAVGGRCKCHGHASECGRG-SDGRLVCRCQHNTTGDDCERCLPSHNSRPWAQASSDDAHE 202          
BLAST of netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004614.1 (pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 2.873e-18
Identity = 62/242 (25.62%), Postives = 101/242 (41.74%), Query Frame = 2
Query:  455 FEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQ-----SLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVA 1165
            F+I Y+ L       P+S  I K     + W  + ++S  C R+FG+    F    D + T    D+      LT  ++  S L  L +S   L+  T               W++AT++R++LR+                  L  + + ++                      P VL+ S ++A++D+++GGRC+C+GHA  C +   D    C CQHNT G DCE C      + W+ A
Sbjct:    1 FQITYVRLRF-HTSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGLPSRGFLRAGDEERTALCSDEFSDISPLTGGNVAFSTLEGLFHSTGPLSSATQ-------------EWVTATDVRVSLRR------------------LNTFGDEVF--------------------GDPKVLR-SYYYAVSDLAVGGRCKCHGHASECGRGS-DGRLVCRCQHNTTGDDCERCLPSHNSRPWAQA 188          
BLAST of netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007784.1 (pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1 gene:ENSPMAG00000007035.1 transcript:ENSPMAT00000007784.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 3.736e-17
Identity = 73/300 (24.33%), Postives = 111/300 (37.00%), Query Frame = 2
Query:  425 VNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDS---KLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSN---KQSGGVCVDCEHNTDG 1306
            V+I    G     Y I   L P  +P+ + I +    G+ W +W  F+KDC           + Y+ SK        S+ C   P       GN+       +  T  PN        YN++ +   ++  +  +E   L   L+G                      +L V        R          + A++++ + GRC+C+GHA RC  +       C  Q NT G +CE+CR  F DK W      +   C+ C C   +  C +   L        +  GGVC DC  NT G
Sbjct:  109 VSIELRGGSYQVFYVIVQFLSP--QPEGVRIQRRPAAGSPWVDWQVFAKDC----------VSMYNMSKNGPLEKPDSVNCLQFPREVPLSRGNVT-----FSVLTPEPNL----RPGYNAFYATPALQAFVLAAEVRVL---LEG---------------------RLLGVAGVAGGPLR---------PYHAVSEVIVSGRCECHGHAERCDSSTTPYRCLCSAQSNTEGPNCELCRPLFRDKPWRAGDTRNQNACRPCLCYGRALSCRYEAILDPHPGLHWRGGGGVCQDCTQNTTG 354          
BLAST of netrin 1 vs. Ensembl Nematostella
Match: EDO36836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI5])

HSP 1 Score: 295.434 bits (755), Expect = 2.389e-91
Identity = 197/624 (31.57%), Postives = 307/624 (49.20%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-----DHINCHSC----MKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNS--PSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNN-KRKRIRFKKYCRKDAVLLVTMQSREQH--GEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKF 2002
            CY+E  +A  C P F ++  N     ++ TCG+ K +R C          C  C     K +H   YLTD H  NN+T W +D V   +NV +  SFGK ++I Y+SL    +  PDS+ I KS+D G SW  + ++S  C + +G         ++ +I+    +Q   CT       G+L+       +AF+T      +   D       W+ AT+I++                          FN I R     S  P                + S ++A+++ ++GGRC C GHA  C+ +  +    CDC+HNT G DC  CR  F D+ W  AT +SA ECK CNCNLH++ C F+ +L+ +S  +SGGVCV C HNT GRYCH C +G+++D +K ++H  VC +C CHP GS    VC+Q   QC CK GV G SC++C  G++ TKS I PC++  ++     +  P +R Q C+  +R  ++ K++CRKD  L VT+   E+       R  + +N +++   ++       ++                  WIK+ D +C+CP L+ G +Y +   L       +  ++L+ +SV LPW +   +R+ +F
Sbjct:    5 CYNEFNRAQLCQPAFHDLAYNK-DVYVSHTCGE-KSRRFCPPMSVRGRTACGFCDERNAKTSHPAKYLTDVHNENNVTCWQADPVQSRENVTLILSFGKTYDITYVSLQFCGI-RPDSMGIYKSMDYGKSWQAYQFYSSRCEKMYG-------RVTNGEISPEN-EQVALCTD------GHLLRPLYGGRIAFSTLEGRPSASKMDYSAVMQEWVMATDIKVE-------------------------FNMISR-----SARP----------------RDSLYYAVSEFNVGGRCHCNGHASECVSD-RNGRQVCDCKHNTVGVDCGACRPFFNDRPWRPATHHSANECKMCNCNLHARTCVFSMELFKLSGGRSGGVCVKCRHNTAGRYCHYCREGFYKDPNKHITHIKVCRQCNCHPHGS-RGRVCNQSTGQCPCKEGVVGRSCDKCAPGYKSTKSNIVPCIETPNVVMSQESSTPRSRDQGCSQCRRVPLKVKRFCRKDFALKVTVVRVEKKLPNSWVRATVNINTLFKRSRTRRVRRGDGYV------------------WIKKRDFRCRCPKLKPGRSYFIAGNLRGQS--RKRSIVLNGRSVVLPWNEKLLKRIYRF 543          
BLAST of netrin 1 vs. Ensembl Nematostella
Match: EDO36523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF3])

HSP 1 Score: 175.252 bits (443), Expect = 1.906e-45
Identity = 133/468 (28.42%), Postives = 210/468 (44.87%), Query Frame = 2
Query:  185 CY-SEGKAFRCVPPFTN------IIENMIPDEITSTCGQNKKQRICVD------HINCHSCMKDTHSINY----LTDQHLNNNITFWASDFV--NHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFS-HASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPV---DNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQK---GFQQT 1510
            CY S+G+A RC+P F N      +I N       +TCG   K + CV          C  C     ++ +    +TD   + N T+W S+ +  N    V +T   GK +++ YI  +      P+S+ I K     + W  + YFS  C +++G+        + + I +    Q   CT    S +  L       +   + P+ ++   S     W++A  +RI LR+  T                  + + ++                      P+VL+ S ++A+ D+SIGGRC+C GHA  C +  +        C CQH+T G DCE C+  + D+ W+ A+  +A EC RCNCN  ++ C F+E LY  +    GG C +C+ NTDG  C +C + ++R  S        C+ C C+P+GS+          QC CK GV G+ C++CQ    GF QT
Sbjct:   21 CYDSQGRAQRCMPQFGNAAFGKRVISN-------NTCGDPPK-KFCVQTGVLEVRKECEMCNSSDPALEHPALKITDIKDDTNRTWWQSETLLENPDKPVTLTLDLGKSYDVSYIR-IRFRSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGV--------TTNGIVDPRNQQVALCTDAF-STITPLTGGNVAFSTLEDRPDAYNFDNSPALQEWVTAVAVRIHLRRMNT------------------FGDEVF--------------------GDPNVLR-SYYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQTGH--GGRCQNCKQNTDGPNCERCKENFYRKTS-----LEPCVACGCNPVGSVSLQC--NSEGQCRCKPGVTGIKCDKCQANYFGFSQT 422          

HSP 2 Score: 64.6994 bits (156), Expect = 1.108e-10
Identity = 44/144 (30.56%), Postives = 63/144 (43.75%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDV---CDQRNSQC 1447
            CQCYGH+  C  +PV  T  C+C+HNT G  C+ C +G+    +   T  +  +CK+C C   ++  +    +          VC DC     G  C  C  GY+ D          C KC C   G+I P+    CD+    C
Sbjct:  704 CQCYGHSDTC--DPV--TGKCNCKHNTTGIRCDKCIDGY----YGNPTQGTPDDCKKCPCKFGTRCIQIGANV----------VCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCS--GNIDPNAIGSCDRLTGDC 827          

HSP 3 Score: 55.4546 bits (132), Expect = 7.900e-8
Identity = 53/184 (28.80%), Postives = 78/184 (42.39%), Query Frame = 2
Query: 1025 CQCY--------GHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKS---PITPCVDVI 1543
            C+CY        GH    L  P D+   C C  N +G  C+ CR  +    W+VA   S   C+ CNC+       +N    + +     G C  C+    GR C QC+  ++            C+ C C+  GS+    CD++   C C+ GV G+ C+ CQ+ F    +      PC DVI
Sbjct:  864 CECYVQGTVSPPGH-DPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEY----WNVA---SGKGCEPCNCDTTGS---WNNTCSVTT-----GQC-HCKPGVTGRRCDQCSIDHY------AFSELGCLACNCNLQGSLNV-TCDEQGV-CQCRPGVLGIKCDSCQENFHNLTAGCIACPPCYDVI 1022          
BLAST of netrin 1 vs. Ensembl Nematostella
Match: EDO39502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X8])

HSP 1 Score: 173.711 bits (439), Expect = 6.685e-45
Identity = 117/389 (30.08%), Postives = 171/389 (43.96%), Query Frame = 2
Query:  389 FWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSF-GIQPMDFNHYSDSKITE--STVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYP-PHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTY------HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRN--------SQCTCKTGVGGLSCNRCQKGF 1501
            +W S+  N  +NV +       F   ++ ++      P  ++I +S D G  W  + YFS DC + F GI   +     D   T   STV+ S               N   +     +     +  S +  + +  TNIRI   K     L++  D    P P +K+ +                                  ++A+ D+ I G C CYGHA +CL  P   T        C+C HNT GK+CE C++G+ D  W  A  ++  EC++CNCN H+ KC F+  +Y  S   SGGVC DCEHNT GR C +C   +++D SK  S    CI C C P G +    C+ +N         +C CK  VGG+ C+RC+ GF
Sbjct:   97 WWQSE--NGRENVYLQLDLESEFHFTHL-IMRFRTFRPAGMVIERSWDYGKKWQIYRYFSADCDKIFPGIPKGEPKDIDDVICTNKYSTVEPS--------------TNGEVIFRALKSQIPIKNAYSSKVQNLLKITNIRINFTK-----LHTLGDDLLDPRPEIKRKY----------------------------------YYAVYDLVIRGSCSCYGHAEQCLPEPGQPTTPGMVYGRCNCTHNTTGKNCERCQDGYFDVPWRPADADNPNECRKCNCNGHAVKCRFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGF 429          

HSP 2 Score: 87.0409 bits (214), Expect = 1.781e-17
Identity = 61/165 (36.97%), Postives = 80/165 (48.48%), Query Frame = 2
Query: 1025 CQCYGHAGRCLKNPVDNTYHC-DCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYI-VSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDV---CDQRNSQC-TCKTGVGGLSCNRCQKGF 1501
            C+CYGHA  C  NP   T  C DCQHNT GK+CE C  GF    + +AT  +  +CKRC C   S   +F+E  Y+  S      +C  C+    GR C +C  GY   +  PL     C  C C+   +I P V   CD+    C  C     G +C RC+ G+
Sbjct:  850 CRCYGHASSC--NP--KTGVCVDCQHNTVGKNCEACAVGF----YGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGY---YGNPLVPGGSCKPCSCN--NNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGY 1001          

HSP 3 Score: 53.5286 bits (127), Expect = 2.994e-7
Identity = 40/139 (28.78%), Postives = 56/139 (40.29%), Query Frame = 2
Query: 1082 HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKG 1498
             C C+ N  G  C+ C+ GF +      T ++   CK C CN      E N            G C  C+   +G  C +C   Y    S P      C  C C  +G  Y + CD++  QC C+ G+ G  C R + G
Sbjct:  410 RCICKRNVGGVRCDRCKAGFFN-----LTTDNPDGCKACGCNPLGTIGECNPDT---------GRCT-CKRYVEGEDCDRCASEYWGLSSTPAG----CSNCACD-VGGSYDNQCDKQTGQCRCRKGITGRQCERVKTG 528          

HSP 4 Score: 53.1434 bits (126), Expect = 4.100e-7
Identity = 41/137 (29.93%), Postives = 62/137 (45.26%), Query Frame = 2
Query: 1091 CQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
            C +NTAG +CE C+ G+            A  C  C C+        N   +   N ++G    +C  + +G+ C +C +G+   W+  LS    C +C C   GS+   +C+Q   QC CK G GG  C  C+  F
Sbjct:  985 CLYNTAGFNCERCKPGYFGDAI-------ARNCTSCVCDKKGT----NPGFHYSCNHKTGQC--NCLPDVEGKQCDRCAEGF---WN--LSSGKGCQQCDCCIEGSLR-SMCNQITGQCQCKAGFGGPRCCECEDNF 1102          

HSP 5 Score: 51.2174 bits (121), Expect = 1.723e-6
Identity = 39/138 (28.26%), Postives = 61/138 (44.20%), Query Frame = 2
Query: 1076 TYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRC 1489
            T  C+C  +  GK C+ C EGF    W+++   S   C++C+C +          L  + N+ +G     C+    G  C +C   +   W  P      C  C C+P GS++   CD+   +C CK G  G  C+ C
Sbjct: 1032 TGQCNCLPDVEGKQCDRCAEGF----WNLS---SGKGCQQCDCCIEGS-------LRSMCNQITGQC--QCKAGFGGPRCCECEDNF---WGSPPDG---CSACNCNPAGSVHLQ-CDRDTGKCLCKVGHIGDKCDMC 1146          
BLAST of netrin 1 vs. Ensembl Nematostella
Match: EDO36501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF6])

HSP 1 Score: 165.622 bits (418), Expect = 3.206e-42
Identity = 130/448 (29.02%), Postives = 191/448 (42.63%), Query Frame = 2
Query:  263 TSTCGQNKKQRICVDHIN-CHSCMKDT----HSINYLTDQHLNNNITFWASDF------VNHGDN--VNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMD--FNHYSD--SKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTT--NNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAE-CKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGF-QQTKSPITPCVDVI 1543
            TSTCG    +   V  +N C  C   +    H I Y+ D+   ++ TFW S+        N  D+  VN++ SF K ++I    +       P   I+ KS D G +W    Y+S +C + FG++  D   N + D  +K TE     S      P        N      F    N  +FF     QY   +SAT++R+ +    T+ L    D  T    LKQY+                                   +A++D+ +  RC+C+GHA  C   P +   +CDC HNT G DCE C   F +K W  AT  +    C+RC C+ H+  C +       S ++  G C DC HNT+G +C +C   ++R+ S  L+H  +C  C C P G      C+Q   QC C+  V G  C+ C   F   T  PI  C + +
Sbjct:   50 TSTCGSPPSEYCRVKPLNGCFKCNASSPTERHPIEYIADKSPGSDATFWQSETWWDWYQKNPRDDLKVNVSISFNKTYDITGHIMFTFESPRPSKAILEKSFDKGQTWDPLQYYSFNCRKDFGMENTDPTENRFGDFSAKCTEKYSSSS------PQQ------NGKVTFDFLRRYNKASFFDTQVQQY---LSATDLRLRMEYPGTDGLEVAKDEVT----LKQYY-----------------------------------YAVSDLEVIARCKCHGHARWC-DFPHETGKNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADSCTY-------SQQEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTCNQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECL 435          

HSP 2 Score: 57.3806 bits (137), Expect = 2.356e-8
Identity = 74/343 (21.57%), Postives = 131/343 (38.19%), Query Frame = 2
Query:  527 IDNGTSWT-EWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASD---QYNSWMSATNIRITLRKSETNFLNSHLDGFTYP-PHLKQYFNRIYRKNNYSSILPVNRK---LKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQH-NTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHR--DWSKPLSHH-------HVCIKCRCHPIGSIYPD--VCDQRNSQCTCKTGVGGLSCNRCQK 1495
            +D G+ ++ +W +  +D   +   Q  +F+  +   +T                 LG  VN      FT N  N +    +   +Y+S     N+++     +TN      D    P P +  Y+ R++  N      P  R    L++   +  S+   + F +   + +    + +  +   +     +  +C C+  N  G  CE+C +GF   R +    NS + C  C C   S  C+              G C  C   + G YC QC  G     D ++ L  +       + C  C C    ++Y +  VC+    QCTCK  + G +C+RC +
Sbjct:  953 VDLGSPFSIDWTFVQRDVSMARVSQGRNFSFVTSGNMT-----------------LGTKVN------FTKNQLNSYGELLEMKLKYSS-QGPLNVKMFWELEKTNGGIVRFDVKPTPSPEVTSYYVRLHEANGIWKTEPNRRNASDLQELLSDLMSITLNAQFMSNGSVLLS-EIKLHSASQGIVGEKAGHVENCTCESGNYTGLSCELCNQGFTRNRPN----NSYSACSLCRCTGRSLDCDGET-----------GQCKGCRLGSQGLYCEQCQPGVDNTTDCTQCLPEYWGLKEGSNGCQDCDCVLPNTLYGNSTVCNATTGQCTCKEKISGRTCDRCHE 1255          

HSP 3 Score: 52.373 bits (124), Expect = 7.481e-7
Identity = 48/206 (23.30%), Postives = 73/206 (35.44%), Query Frame = 2
Query: 1022 RCQCYGHAGRCLKNPVDNTYHCD-CQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNC----------------------NLHSKKCEFNEKLYIVSNKQSGGVCVDC-----------------------EHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGF 1501
            RC+C+ HA  C  +  +    CD C HNT G  CE C++ F   R    ++N    C  CNC                      N+  ++C+     +     +  G C +C                       + N   R C +C  GY   W  P +    C +C C   GS+   +C +    C C+T + G  C     G+
Sbjct:  325 RCECHSHADSCTYSQQEGYGTCDDCYHNTEGHFCERCKDKFY--RNMSLSLNHPEICPDCNCFPQGITNNGTCNQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGY---WDFPKTLDTDCKRCDCDYGGSVL-QICSKTTGSCMCRTNIIGTRCTDVTTGY 524          
BLAST of netrin 1 vs. Ensembl Nematostella
Match: EDO46760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNY3])

HSP 1 Score: 128.257 bits (321), Expect = 3.002e-30
Identity = 110/416 (26.44%), Postives = 169/416 (40.62%), Query Frame = 2
Query:  341 HSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRC--LKNPVDNTYHCDCQHN----TAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQS---GGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIG-SIYPDVCDQRNS-------QCTCKTGVGGLSCNRCQKGFQQTKSP-ITPCV 1534
            H   Y+TD    +  T+W S   ++   V +   + +L   + I L   P   P++I+I +S D G+++  W YF+ DC  SFG++                               GNLVN  S+            HA             ++T  K      NS   G          F +  + +N   I   N  L Q +++         +FAL  + + GRC+C+GHA +   +K    +   C C+ +    T G+ CE C   + +K +   T +    C +C CN H+  C +N  L      ++   GGVC++C HNT G++CH C   + R+  K LS   VC  C+C   G       C + +S       QC CK    G  C+ C+ GF   KS   T CV
Sbjct:  332 HPSEYMTDA---DTTTYWQSAVTDNA-TVEVDLLYQELQIFFVIMLFYGP--PPEAILIERSRDRGSTYKPWQYFASDCQSSFGME-----------------------------NNGNLVNPDSINCIQYQRCECHGHAQ------------KVTFIKG-----NSSSPGRCRCECDPSTFTQGEKASNVR-IQLYNHTLIQNEKHR--------YFALKRVLVTGRCECHGHAQKVTFIKGNSSSPGRCRCECDPSTFTQGEKCESCLPMYNNKAFLRGTNDDPYPCVKCECNNHATACYYNSSLDPSPASRTVGGGGVCINCLHNTAGQFCHVCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCV 686          

HSP 2 Score: 87.0409 bits (214), Expect = 1.785e-17
Identity = 61/192 (31.77%), Postives = 84/192 (43.75%), Query Frame = 2
Query:  986 DFF-----ALADISIGGRCQCYG---HAGRCLKNPVDNTY-----HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYH--RDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKS 1516
            DFF     +L+ + +   CQC G     G+      D+T       C+C+  T G+ C+ C+ GF D + S +T      C  C CN        N      S  QS G C  C+ N  GR C  C  G++  RD + P      C  C C P G++   VCD  + QC CK G  GL C+ C+ G+    S
Sbjct:  610 DFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHST-----GCVTCGCNTAGT---VNRN---ASCDQSRGQCY-CKSNVTGRTCDTCESGFYGLRD-NDPSG----CRACECDPFGTLPGSVCDAGSGQCRCKAGSTGLRCHLCEDGYHSLDS 784          

HSP 3 Score: 56.9954 bits (136), Expect = 3.049e-8
Identity = 36/141 (25.53%), Postives = 63/141 (44.68%), Query Frame = 2
Query: 1082 HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDV-CDQRNSQCTCKTGVGGLSCNRCQKGF 1501
             C C+  + G  C +C +G+        +++S+  CK CNC+    K        + +  ++ G C  C+   +G+ C +C  GY   ++    +   C  C C P G     + C+  +  CTCK  V   +C +C KG+
Sbjct:  760 QCRCKAGSTGLRCHLCEDGY-------HSLDSSG-CKTCNCSTIGAKPGL-----VNTCDKTNGQCY-CKTYVEGKTCDRCKTGY---YNLTTVNQDGCSLCSCDPKGIQGSSLTCEVSSGNCTCKKYVREPTCGQCMKGY 883          

HSP 4 Score: 53.1434 bits (126), Expect = 4.336e-7
Identity = 39/150 (26.00%), Postives = 58/150 (38.67%), Query Frame = 2
Query: 1082 HCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPC 1531
            +C C+       C  C +G+    +++++ N    C+ CNCN              +    S G C  C  N  G  C QC   Y+ + S      + C  C C   GS+  + C+     C CK  +GG  C+RC  G         PC
Sbjct:  864 NCTCKKYVREPTCGQCMKGY----FNLSSSNPEG-CQACNCNPKGTLGGDRTPAGELECSGSNGKCA-CLTNVQGLRCDQCVSAYYWNPSG-----YGCSPCNCDASGSLATN-CNS-TGYCQCKPNIGGRRCDRCMPGSYGGPGSCKPC 1000          
BLAST of netrin 1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 349.747 bits (896), Expect = 5.000e-111
Identity = 210/640 (32.81%), Postives = 330/640 (51.56%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHI--------NCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDV-IDLHKIPMAQAP-----ENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            CY E G   RC+P F N        +++STCG+   +   V           NCHSC     K  H   YLTD +  +N+T W S+ F+ +  NV +T S GK FE+ Y+SL       P+S++I KS+DNG +W  + ++S  C + +       N  + + IT+   +Q   CT   DS       +  ++AF+T +    +H  D       W++AT+I++                          F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA RC+K+  D +  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD SKP+SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+ + +     P +        E+ C+    K K I  KKYC+KD  + V +   ++ GE  +F + +  VY+   S+                 +QF      +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   38 CYDEHGNPRRCIPDFVNAAFGK-EVKVSSTCGKTPSRYCVVTSAEKGEERTRNCHSCDASDPKKYHPPAYLTDLNNPHNLTCWQSENFIQYPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMVIYKSMDNGKTWVPFQFYSTQCRKMY-------NKPNRAVITKQN-EQEAVCT---DSHTDMYPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVV-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVKD-RDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVSPPTTPASSTEEASDCESYCKASKGKLK-INMKKYCKKDYAVQVHILKADKMGEWWKFTVNIISVYKQGESRIRR-------------GDQF------LWVRAKDVACKCPKIKPGKKYLLLGNDEVSP--SQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of netrin 1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 342.813 bits (878), Expect = 9.804e-109
Identity = 205/628 (32.64%), Postives = 324/628 (51.59%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDV-IDLHKIPMAQAP-----ENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            CY E G   RC+P F N        +++STCG+              S  K  H   YLTD +  +N+T W S+ F+ +  NV +T S GK FE+ Y+SL       P+S++I KS+DNG +W  + ++S  C + +       N  + + IT+   +Q   CT   DS       +  ++AF+T +    +H  D       W++AT+I++                          F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA RC+K+  D +  CDC+HNTAG +C+ C+    D+ W  AT   A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD SKP+SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+ + +     P +        E+ C+    K K I  KKYC+KD  + V +   ++ GE  +F + +  VY+   S+                 +QF      +W++  D+ CKCP ++ G  YL++          +S ++ D+ S+ + W+ TW RR++KF  +E +G C+K
Sbjct:   38 CYDEHGNPRRCIPDFVNAAFGK-EVKVSSTCGKTCDA----------SDPKKYHPPAYLTDLNNPHNLTCWQSENFIQYPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMVIYKSMDNGKTWVPFQFYSTQCRKMY-------NKPNRAVITKQN-EQEAVCT---DSHTDMYPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVV-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVKD-RDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVSPPTTPASSTEEASDCESYCKASKGKLK-INMKKYCKKDYAVQVHILKADKMGEWWKFTVNIISVYKQGESRIRR-------------GDQF------LWVRAKDVACKCPKIKPGKKYLLLGNDEVSP--SQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 580          
BLAST of netrin 1 vs. Ensembl Medaka
Match: ntn1b (netrin-1 [Source:NCBI gene;Acc:101161061])

HSP 1 Score: 330.102 bits (845), Expect = 1.453e-103
Identity = 205/642 (31.93%), Postives = 324/642 (50.47%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-------DHINCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHC--NNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLC 2029
            CY E G   RC+P F N         ++STCG N   R CV          +CH+C     K  H   YLTD +  +N+T W S+ +V +  NV +T S GK FE+ Y+SL       P+S+ I KS+D G SW  + ++S  C + +       N  + + IT+   +Q   CT   DS       +  ++AF+T +    +H  D       W++AT+I++                          F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA +C+K+   N   C+C+HNTAG +C+ C+    D+ W  AT   A EC  C+CNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY RD SKP+SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + P +   +C  +  + +I  KKYC+KD  + V +   ++ GE  +F + +  VY+    +                 +Q       +W++  D+ C+CP ++ G  YL++           S ++ D+ S+ +PW+  W RR++KF  ++ +G C
Sbjct:   40 CYDENGNPRRCIPDFVNSAFGKDV-RVSSTCG-NPAARFCVVSEKGEERTRDCHTCDSNDPKKAHPPAYLTDLNNPHNLTCWQSETYVQYPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGKSWVPFQFYSTQCKKMY-------NRQNKATITKQN-EQEAICT---DSHTDMHPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVI-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLV-CECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYFRDMSKPISHRRACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVASPTSTYSSYEEPSDCDSYCKASKGKMKITMKKYCKKDYAVQVHVLKGDKAGEWWKFTVNIISVYKQGRHRIRR-------------GDQL------LWVRAKDVACRCPKIKPGRKYLLLGTDD--DSPGHSGVVADKGSLLIPWKDLWGRRLRKFQQRDKRGKC 600          
BLAST of netrin 1 vs. Ensembl Medaka
Match: ntn1b (netrin-1 [Source:NCBI gene;Acc:101161061])

HSP 1 Score: 330.102 bits (845), Expect = 1.462e-103
Identity = 205/642 (31.93%), Postives = 324/642 (50.47%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICV-------DHINCHSC----MKDTHSINYLTDQHLNNNITFWASD-FVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMA---------QAPENRCQHC--NNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLC 2029
            CY E G   RC+P F N         ++STCG N   R CV          +CH+C     K  H   YLTD +  +N+T W S+ +V +  NV +T S GK FE+ Y+SL       P+S+ I KS+D G SW  + ++S  C + +       N  + + IT+   +Q   CT   DS       +  ++AF+T +    +H  D       W++AT+I++                          F+R++                 +  +   + + S F+A++D+ +GGRC+C GHA +C+K+   N   C+C+HNTAG +C+ C+    D+ W  AT   A EC  C+CNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +GY RD SKP+SH   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SPI PC+      KIP+A         + P +   +C  +  + +I  KKYC+KD  + V +   ++ GE  +F + +  VY+    +                 +Q       +W++  D+ C+CP ++ G  YL++           S ++ D+ S+ +PW+  W RR++KF  ++ +G C
Sbjct:   41 CYDENGNPRRCIPDFVNSAFGKDV-RVSSTCG-NPAARFCVVSEKGEERTRDCHTCDSNDPKKAHPPAYLTDLNNPHNLTCWQSETYVQYPQNVTLTLSLGKKFEVTYVSLQFCSP-RPESMAIYKSMDYGKSWVPFQFYSTQCKKMY-------NRQNKATITKQN-EQEAICT---DSHTDMHPLTGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVI-------------------------FSRLH-------------TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLV-CECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYFRDMSKPISHRRACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCI------KIPVASPTSTYSSYEEPSDCDSYCKASKGKMKITMKKYCKKDYAVQVHVLKGDKAGEWWKFTVNIISVYKQGRHRIRR-------------GDQL------LWVRAKDVACRCPKIKPGRKYLLLGTDD--DSPGHSGVVADKGSLLIPWKDLWGRRLRKFQQRDKRGKC 601          
BLAST of netrin 1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 322.398 bits (825), Expect = 2.361e-100
Identity = 208/659 (31.56%), Postives = 318/659 (48.25%), Query Frame = 2
Query:  185 CYSE-GKAFRCVPPFTNII---ENMIPDEITSTCGQNKKQRICV-----DHINCHSCM-------KDTHSINYLTDQHLNNNITFWASDFVNHGD-NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ---YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISD----FFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRC---QHCNNKRK--RIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKY-------------LERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEK 2035
            CY E G A RC+P F N     E M+    +S CG+   +   V     +  +  +C        +  H  +YLTD +  +N+T W S+ +N    NV +T S GK FEI Y+SL       P+S+ I KS+D G +W  + ++S  C R +       N  + + IT+    ++L CT   D        S  ++AF+T +    S   D       W++ T+IR+   +                P L + F      NN               R+   V   S     F+A+ D  +GGRC+C GHA RCLK+  +    CDC+HNT G +C+ C+    D+ W  A    A EC  CNCNLH+++C FN +LY +S ++SGGVC++C HNT GR+CH C +G++RD  +P++H   C  C CHP+G+     C+Q   QC CK GV G++CNRC KG+QQ++SP+ PC+ +  ++   +  + E       +C   +   +I  KKYC+KD  + V +   E  G+ A+F + +  VY+      +   P  L   + I+           W+   DL CKCP +Q+   +LV+                      ER  L+ D+ S+ + W+  W RR++KF  KE +G C K
Sbjct:   37 CYDETGTARRCIPEFINAAFGKEVMV----SSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENLNTSPHNVTLTLSLGKKFEITYVSLQFCSP-RPESLAIYKSMDYGKTWMPYQFYSSQCRRMY-------NKPNKATITKQNEQEAL-CT---DGHTDLYPLSGGLIAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVVFGR----------------PQLSREFVLGAGSNNGG-------------RDDDPVAVTSTLSTYFYAVGDFQVGGRCKCNGHASRCLKDK-EGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTEEPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETVGDWAKFSVSLVSVYK------SRGEP--LKRGDNIL-----------WVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of netrin 1 vs. Planmine SMEST
Match: SMESG000006806.1 (SMESG000006806.1)

HSP 1 Score: 1399.8 bits (3622), Expect = 0.000e+0
Identity = 668/669 (99.85%), Postives = 668/669 (99.85%), Query Frame = 2
Query:   83 MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV 2089
            MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCV CEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV
Sbjct:    1 MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVGCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV 669          
BLAST of netrin 1 vs. Planmine SMEST
Match: SMESG000006806.1 (SMESG000006806.1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 2
Query:   83 MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKR 1195
            MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKR
Sbjct:    1 MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKR 371          
BLAST of netrin 1 vs. Planmine SMEST
Match: SMESG000006806.1 (SMESG000006806.1)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 297/298 (99.66%), Postives = 297/298 (99.66%), Query Frame = 2
Query: 1196 CNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV 2089
            CNCNLHSKKCEFNEKLYIVSNKQSGGVCV CEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV
Sbjct:   19 CNCNLHSKKCEFNEKLYIVSNKQSGGVCVGCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNYV 316          
BLAST of netrin 1 vs. Planmine SMEST
Match: SMESG000069610.1 (SMESG000069610.1)

HSP 1 Score: 451.055 bits (1159), Expect = 1.992e-150
Identity = 254/626 (40.58%), Postives = 359/626 (57.35%), Query Frame = 2
Query:  179 SLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ-YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPD-FLASMNGIMSNQFIHS--TFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQ-KSVALPWQKTWERRMKKFSNKEHQGLCEKWK 2041
            S CY+ G A++C+PPFTNI+ENMIP +I + C   KK+ +C         +K     N +TD HL +N T W S  +   ++VNITFSF K FE+YYISL       P++I   KS + G +W  WHY + +C   F ++         +       +Q+  C  +   KL    N P V+AF T     + +  D     WMSA++IRITL K                               + +  P    + +  RNSP  +      +++DISIGGRC+C GHA  C KNP+ N   C CQHNT G+DCE C++ ++D  W+ ATVNS A+CK+C CNLHS  C F++ LYI+  + +GGVC +C+HNT G  CH CN GY+RDW+KPL H  VC KC CH IG+ +PD CD+R  QC CK+GV G  CNRC  GF+Q+ S  TPCV  I +      ++ EN+C+ C++KR RIRF+K+CRKDAV  VT+QS+E  G+  RF++ V+ ++    S   +++P  F+ S+    S   +++  T P+W+K  DLKC C  LQLG TYL I+K     Y  R+ELL+   +S+ L W  TW+RR+ +F  K+ +G C K++
Sbjct:    7 SPCYAHGSAYQCMPPFTNIVENMIP-KIETLC---KKKEVCP--------IKSPRD-NLITDYHLTHNQTCWKSVPL-QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPL---KLSLTDNEP-VVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFK-------------------------------FDNPKPKKSNIFRFARNSPKKI-----LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQM------ESAENKCKACDSKRTRIRFRKFCRKDAVFSVTLQSQEIIGDFIRFDVTVDNIWHSKNS-IKDLYPGIFIESIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLFIIKSTTYHYQNRAELLIKSPRSIILIWNPTWKRRLNRFKQKKEKGECSKFQ 571          
BLAST of netrin 1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 419.853 bits (1078), Expect = 4.041e-137
Identity = 236/653 (36.14%), Postives = 358/653 (54.82%), Query Frame = 2
Query:  158 WLHG------GSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHIN---------CHSCMKDTHSI--NYLTDQHLNNNITFWASDFV--NHGDN-VNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTT--NNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKR 2050
            W+H         +S CY  G+  +C+P FTNIIEN +  E TSTCG N  ++IC +  +         C  C     S   +++TD+H+  N T W S  +  N G N VNIT S  K FE+YYI+L +   L PDSI I KS+D G SW  W +FS+DCYR+F    M   +  +S+IT + + + L        +  +   + +VL F+T    P+    + D    WM+ T++RI+L +             + P  LK+ +        ++  LP         +  P V      F L+D+++GGRC+C GHA RCL +  D    CDC HNT G++CE C+  ++D+ W  AT  +A  CK C+CNLHS +C FN ++Y+ +N  +GGVC++C H+T G  C  C  G+ R+W+KP  H   C  C+CH IGSI  + CD++  QC C+ GV G +C+RC+ G++Q+ S + PC+    +  +         C+ CN KRKRI FKK+CR+ +V   T  S+E HG M R+E+K++ ++R+D + +     +FL      M       T+  WI   D++C CP ++LG +YL++ +     YL   EL +D +SV LPW  +WERR++KF  +E +G CE++  K+
Sbjct:   15 WIHSVKVIFESQSSPCYLNGRPQQCLPSFTNIIEN-VKAETTSTCGTNGPEQICRNWYDKTTAEARQYCSICDAKHRSYPPSHITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGTL-PDSIAIYKSLDFGVSWKPWQFFSQDCYRAFK---MPTTNEQNSQITPANIHEVLCVELKAPERYNDYGQAETVLPFSTIYGRPSGPPWSQDLV-EWMTMTDLRISLMR--------FTPEKSTPYRLKELYY-------HTESLPQAPPNLVNHKTEPIV-----HFGLSDLAVGGRCKCNGHANRCLIDDNDEI-KCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKYCDCNLHSYRCYFNSQIYVRNNYTNGGVCINCRHHTTGNNCENCENGFFRNWTKPQEHRAACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPSSGMADMANTSPV---CKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVW-----EFLPRETPAM------HTYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDSRSVMLPWHNSWERRLQKFQKREKRGKCEQYFKKK 626          
The following BLAST results are available for this feature:
BLAST of netrin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN11.240e-10531.82netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN37.333e-8229.70netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030][more]
NTN51.038e-6235.84netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208][more]
LAMC12.061e-4930.15laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
LAMA54.061e-4629.13laminin subunit alpha 5 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of netrin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-61.516e-10132.06Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
unc-61.516e-10132.06Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
lam-21.314e-4829.06Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
lam-11.824e-4328.33LAMinin related. See also lmb [Source:UniProtKB/T... [more]
epi-12.795e-3627.14Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of netrin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NetA8.300e-9430.21gene:FBgn0015773 transcript:FBtr0073942[more]
NetA8.300e-9430.21gene:FBgn0015773 transcript:FBtr0346088[more]
NetA2.671e-8436.73gene:FBgn0015773 transcript:FBtr0308337[more]
NetB7.144e-6531.01gene:FBgn0015774 transcript:FBtr0304875[more]
NetB7.144e-6531.01gene:FBgn0015774 transcript:FBtr0302018[more]
back to top
BLAST of netrin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntn1a2.703e-11133.44netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn1a2.703e-11133.44netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn22.019e-10531.41netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn1b2.249e-10532.09netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
ntn1b2.249e-10532.09netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
back to top
BLAST of netrin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps165.848e-10133.02ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
rps163.388e-9432.00ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
ntn13.739e-9330.68netrin 1 [Source:NCBI gene;Acc:779839][more]
utp44.374e-4929.98UTP4 small subunit processome component [Source:Xe... [more]
utp44.543e-4929.98UTP4 small subunit processome component [Source:Xe... [more]
back to top
BLAST of netrin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ntn12.031e-10531.66netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn12.031e-10531.66netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn31.869e-8330.27netrin 3 [Source:MGI Symbol;Acc:MGI:1341188][more]
Ntn52.878e-6032.97netrin 5 [Source:MGI Symbol;Acc:MGI:2685330][more]
Lamc19.718e-4930.15laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914][more]
back to top
BLAST of netrin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90922|NET1_CHICK1.095e-10531.34Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=... [more]
sp|O95631|NET1_HUMAN5.957e-10531.82Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2[more]
sp|O09118|NET1_MOUSE1.420e-10431.66Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=... [more]
sp|Q924Z9|NET1_RAT4.801e-10231.35Netrin-1 OS=Rattus norvegicus OX=10116 GN=Ntn1 PE=... [more]
sp|Q2HXW4|NET1_PIG6.305e-10231.18Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1[more]
back to top
BLAST of netrin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q49BF90.000e+099.85Netrin 1 OS=Schmidtea mediterranea OX=79327 PE=2 S... [more]
Q8WPG70.000e+082.77Netrin 1 (Fragment) OS=Dugesia japonica OX=6161 GN... [more]
G4VPQ44.765e-14839.91Putative netrin OS=Schistosoma mansoni OX=6183 GN=... [more]
A0A3Q0KP824.074e-14337.10Putative netrin OS=Schistosoma mansoni OX=6183 PE=... [more]
A0A4Z2DC784.567e-13936.44Netrin-B isoform 1 OS=Schistosoma japonicum OX=618... [more]
back to top
BLAST of netrin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN13.663e-11133.02netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN12.432e-10932.97netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b9.277e-10932.14netrin-1-like [Source:NCBI gene;Acc:111191060][more]
NTN11.038e-8028.97netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b1.390e-7927.96netrin-1-like [Source:NCBI gene;Acc:111191060][more]
back to top
BLAST of netrin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009682.11.851e-4129.78pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 ge... [more]
ENSPMAT00000008925.13.504e-2825.60pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 ... [more]
ENSPMAT00000004606.11.212e-2225.70pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 g... [more]
ENSPMAT00000004614.12.873e-1825.62pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 g... [more]
ENSPMAT00000007784.13.736e-1724.33pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1... [more]
back to top
BLAST of netrin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of netrin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368362.389e-9131.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365231.906e-4528.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395026.685e-4530.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365013.206e-4229.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467603.002e-3026.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of netrin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN15.000e-11132.81netrin-1 [Source:NCBI gene;Acc:101155405][more]
NTN19.804e-10932.64netrin-1 [Source:NCBI gene;Acc:101155405][more]
ntn1b1.453e-10331.93netrin-1 [Source:NCBI gene;Acc:101161061][more]
ntn1b1.462e-10331.93netrin-1 [Source:NCBI gene;Acc:101161061][more]
ntn22.361e-10031.56netrin-3 [Source:NCBI gene;Acc:101160359][more]
back to top
BLAST of netrin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006806.10.000e+099.85SMESG000006806.1[more]
SMESG000006806.10.000e+0100.00SMESG000006806.1[more]
SMESG000006806.10.000e+099.66SMESG000006806.1[more]
SMESG000069610.11.992e-15040.58SMESG000069610.1[more]
SMESG000050895.14.041e-13736.14SMESG000050895.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013386
GenBankAAY23350.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013386 ID=SMED30013386|Name=netrin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2169bp
GCCAAAGTTGAGAATTTGCATTTGTTTTTTTTATTACTAACTTTCATTTA
AAATATTCACTATATACATATATAAATATATAATGAACCAATCTTTAAGG
AATGGGATTTGCCCATTTGTCATTTTTGCGATTTTAATACAGTGCCAGGC
TCAACATTGGCTTCATGGCGGATCGAACTCCCTTTGTTATAGTGAAGGCA
AAGCATTCCGATGCGTTCCGCCGTTTACAAATATCATCGAAAATATGATC
CCAGATGAAATAACAAGTACTTGTGGACAGAATAAAAAGCAAAGGATCTG
CGTCGATCATATCAACTGCCACAGTTGTATGAAAGATACTCATTCTATCA
ACTACTTGACTGACCAACATTTAAACAACAATATCACATTTTGGGCATCT
GATTTTGTGAACCACGGAGACAATGTTAATATAACTTTTTCATTTGGAAA
ATTATTCGAGATTTATTACATTTCCTTAGTACTCATTCCTTTGTTGGAGC
CGGACTCGATTATTATTTCAAAAAGTATTGACAATGGCACCTCATGGACC
GAATGGCATTATTTTTCCAAAGATTGCTATCGTTCATTTGGAATCCAACC
GATGGATTTCAATCACTACTCGGATTCTAAAATCACTGAGAGCACCGTCG
ACCAGTCTCTGACCTGCACCAGTATTCCTGATTCAAAGCTTGGAAATTTA
GTCAACTCTCCATCGGTATTGGCATTTACCACAAATAATCCAAACTTTTT
CTCCCATGCTTCCGATCAATACAATTCTTGGATGAGTGCTACAAATATTC
GAATAACTCTTCGTAAATCGGAAACAAATTTCCTGAATTCTCACCTGGAC
GGATTTACGTATCCGCCGCATTTGAAACAATATTTCAATCGAATATATAG
GAAAAACAATTACTCTTCGATTTTGCCTGTCAATCGAAAATTAAAACAAA
AAAAACGAAATTCTCCGAGTGTCTTGAAAATATCTGATTTCTTTGCACTT
GCCGACATCTCGATCGGCGGACGGTGTCAGTGCTATGGCCATGCAGGGCG
CTGCTTGAAAAATCCCGTTGACAATACATACCATTGTGATTGCCAGCACA
ATACCGCTGGAAAGGACTGTGAAATGTGCCGGGAAGGATTTGTGGATAAA
CGTTGGTCAGTTGCCACAGTTAATTCAGCGGCAGAATGTAAACGATGCAA
TTGTAATTTGCATTCGAAAAAGTGTGAATTCAATGAAAAGCTTTATATAG
TATCAAACAAACAAAGCGGTGGTGTGTGTGTCGATTGTGAGCACAACACC
GATGGACGGTATTGCCATCAATGCAACAAAGGCTACCACAGGGATTGGAG
CAAGCCTCTGAGTCATCATCATGTGTGCATCAAATGCCGATGCCATCCAA
TCGGATCGATTTATCCAGATGTTTGCGATCAAAGAAATAGTCAATGTACC
TGTAAAACTGGTGTAGGCGGTCTTTCGTGCAATCGTTGTCAAAAGGGTTT
CCAACAAACGAAATCCCCTATTACACCTTGTGTAGATGTCATTGATCTCC
ATAAAATTCCGATGGCTCAAGCTCCAGAAAATAGATGCCAGCATTGCAAT
AACAAAAGAAAACGAATACGATTCAAAAAGTATTGCAGAAAAGATGCAGT
TTTATTGGTAACAATGCAATCAAGAGAACAGCATGGGGAAATGGCACGAT
TTGAAATGAAAGTAAATTACGTTTACCGAATTGACACCTCGAAATTCACC
GAGATGCACCCAGATTTTTTGGCATCAATGAACGGCATAATGTCCAATCA
ATTTATTCATTCGACCTTTCCAATGTGGATCAAGGAAACAGATCTCAAAT
GTAAATGTCCTTCTTTGCAACTTGGAATGACTTATTTGGTCATTCTCAAA
TTACACGCAATAAAATATTTGGAAAGATCTGAATTGTTGTTGGATCAAAA
AAGTGTCGCACTTCCGTGGCAGAAAACCTGGGAACGCCGAATGAAAAAGT
TTTCAAATAAAGAGCATCAGGGTCTATGTGAGAAATGGAAATTGAAGCGT
CGATATTATAGACGACAGAAACACACAAAAAATTATGTGTAAACTTTGCG
TGAAAAGTCACTAATAATAACTGGCATATTAATGTTTAATTCATTCAAAT
TATTTCATTTTATCTCGAT
back to top

protein sequence of SMED30013386-orf-1

>SMED30013386-orf-1 ID=SMED30013386-orf-1|Name=SMED30013386-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=670bp
MNQSLRNGICPFVIFAILIQCQAQHWLHGGSNSLCYSEGKAFRCVPPFTN
IIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNN
ITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSID
NGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPD
SKLGNLVNSPSVLAFTTNNPNFFSHASDQYNSWMSATNIRITLRKSETNF
LNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKI
SDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCR
EGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCV
DCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQ
RNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPEN
RCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRI
DTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMT
YLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCE
KWKLKRRYYRRQKHTKNYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000025nervous system
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000044cephalic ganglia
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000080peripheral nervous system
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000143ventral region of the whole animal
PLANA:0000231vitelline gland
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR038684Laminin_N_sf
IPR018933Netrin_module_non-TIMP
IPR002049Laminin_EGF
IPR008211Laminin_N
IPR013032EGF-like_CS
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018933Netrin module, non-TIMP typeSMARTSM00643c345ccoord: 514..643
e-value: 0.0024
score: 27.1
IPR018933Netrin module, non-TIMP typePFAMPF01759NTRcoord: 581..641
e-value: 3.3E-8
score: 33.3
IPR008211Laminin, N-terminalSMARTSM00136LamNT_2coord: 38..313
e-value: 2.6E-13
score: 20.8
IPR008211Laminin, N-terminalPFAMPF00055Laminin_Ncoord: 44..313
e-value: 5.0E-36
score: 124.5
IPR008211Laminin, N-terminalPROSITEPS51117LAMININ_NTERcoord: 40..314
score: 28.813
IPR002049Laminin EGF domainSMARTSM00180lamegf_3coord: 315..369
e-value: 8.5E-7
score: 38.6
coord: 435..483
e-value: 7.7E-8
score: 42.0
coord: 372..432
e-value: 9.1E-5
score: 31.8
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 372..422
e-value: 2.7E-6
score: 27.4
coord: 435..478
e-value: 2.2E-7
score: 30.9
coord: 315..358
e-value: 3.2E-7
score: 30.4
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 455..483
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 335..369
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 372..434
score: 8.979
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 315..371
score: 9.074
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 435..485
score: 14.596
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldGENE3DG3DSA:2.40.50.120coord: 497..648
e-value: 1.3E-11
score: 46.4
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 498..649
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 338..438
e-value: 1.6E-27
score: 97.7
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 439..483
e-value: 3.8E-8
score: 35.1
NoneNo IPR availablePANTHERPTHR10574:SF292NETRIN-3coord: 31..651
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 31..651
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 371..427
e-value: 2.29696E-4
score: 37.3338
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 314..358
e-value: 1.19941E-5
score: 40.8006
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 435..484
e-value: 7.55691E-9
score: 50.0454
NoneNo IPR availableCDDcd03579NTR_netrin-1_likecoord: 514..649
e-value: 2.01648E-42
score: 147.008
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.684
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 372..425
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 315..374
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 435..477
IPR038684Laminin, N-terminal domain superfamilyGENE3DG3DSA:2.60.120.1490coord: 29..276
e-value: 1.2E-39
score: 138.3
coord: 280..337
e-value: 4.6E-10
score: 41.3
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 335..346
IPR001134Netrin domainPROSITEPS50189NTRcoord: 502..649
score: 16.285