SMED30013385

Overview
NameSMED30013385
Smed IDSMED30013385
Length (bp)1506
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30013385 (SMED30013385) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30013385 (SMED30013385) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013385 (SMED30013385) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013385 (SMED30013385) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013385

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30013385SMESG000032700.1 SmedASXL_015025SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30013385SMESG000032700.1 SmedASXL_015025SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30013385SMESG000032700.1 dd_Smed_v4_26944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013385SMESG000032700.1 dd_Smed_v4_26944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013385SMESG000032700.1 dd_Smed_v4_26944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013385SMESG000032700.1 Contig41149newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30013385SMESG000032700.1 dd_Smed_v6_26944_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30013385 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002254:34913..37460 +7335
Homology
BLAST of SMED30013385 vs. Ensembl Human
Match: BTBD17 (BTB domain containing 17 [Source:HGNC Symbol;Acc:HGNC:33758])

HSP 1 Score: 66.2402 bits (160), Expect = 6.193e-11
Identity = 63/289 (21.80%), Postives = 125/289 (43.25%), Query Frame = -3
Query:  431 LKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQND--FSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFD--SACYQPRNYLNLVVDR---FNNKIANRFSNSLDKKAIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVV--DAAGFYL 1270
            L+  Q+    F  F+++LY GE+     + + L  LA KY V SL+    +YM R  ++     ++ WY +      + + ++C   +  N   +    + + A+  + L ++L+ S +V+  E  ++   + WL            A++ L  IR+ M+ P  LF+++ ++       P +      L+ +A+++ +    +   ++ FD   + + PRNYL          NN   +  S S   +   + + +     W + +      L V+ R V  DAAG  L
Sbjct:  106 LQEPQDCAAVFDKFIRYLYCGELTVLLTQAIPLHRLATKYGVSSLQRGVADYM-RAHLAGGAGPAVGWYHYAVGTGDEALRESCLQFLAWNLSAVAASTE-WGAVSPELLWQLLQRSDLVLQDELELFHALEAWL---GRARPPPAVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVAD----LLLQAYQFHAASPLH--YAKFFDVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLFSP--RWLPVSLRPVYADAAGTAL 381          
BLAST of SMED30013385 vs. Ensembl Human
Match: BTBD2 (BTB domain containing 2 [Source:HGNC Symbol;Acc:HGNC:15504])

HSP 1 Score: 49.2914 bits (116), Expect = 1.983e-10
Identity = 45/181 (24.86%), Postives = 78/181 (43.09%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N  +    N+    +  ++ D  ++   C   I  N    +   + F  +D+D L  +LE  ++ + +E  ++     W  ++      +V  +       K L LIRF +MT      IEE   F+  P    +L
Sbjct:  171 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRAD---NAFMLLTQARLFDEPQLASLCLENIDKNTADAI-TAEGFTDIDLDTLVAVLERDTLGI-REVRLFNAVVRWSEAECQRQQLQVTPENRRKVLGKALGLIRFPLMT------IEE---FAAGPAQSGIL 337          

HSP 2 Score: 36.5798 bits (83), Expect = 1.983e-10
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++ A LF NE L D+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  105 ERFAFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 160          
BLAST of SMED30013385 vs. Ensembl Human
Match: BTBD1 (BTB domain containing 1 [Source:HGNC Symbol;Acc:HGNC:1120])

HSP 1 Score: 48.521 bits (114), Expect = 4.173e-8
Identity = 46/183 (25.14%), Postives = 77/183 (42.08%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLM--NSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVN-------AKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   L+FLY+ E+    + V+  L  A KY V +L     E++ +     HL   N+    +  ++ D  ++   C  TI  +    +   + F  +DID LC +LE  ++ + +E  ++     W  ++       V          K L LIRF +MT      IEE   F+  P    +L
Sbjct:  129 FLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTK-----HLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDAISA-EGFTDIDIDTLCAVLERDTLSI-RESRLFGAVVRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 295          

HSP 2 Score: 29.261 bits (64), Expect = 4.173e-8
Identity = 18/62 (29.03%), Postives = 30/62 (48.39%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVG----------ETKYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++ A LF +E LSD++  +G            +  AH+F+L+A S V   MF+      S +
Sbjct:   57 ERFAFLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAE 118          
BLAST of SMED30013385 vs. Ensembl Human
Match: BTBD1 (BTB domain containing 1 [Source:HGNC Symbol;Acc:HGNC:1120])

HSP 1 Score: 48.1358 bits (113), Expect = 7.666e-8
Identity = 46/183 (25.14%), Postives = 77/183 (42.08%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLM--NSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVN-------AKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   L+FLY+ E+    + V+  L  A KY V +L     E++ +     HL   N+    +  ++ D  ++   C  TI  +    +   + F  +DID LC +LE  ++ + +E  ++     W  ++       V          K L LIRF +MT      IEE   F+  P    +L
Sbjct:  129 FLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTK-----HLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDAISA-EGFTDIDIDTLCAVLERDTLSI-RESRLFGAVVRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 295          

HSP 2 Score: 28.8758 bits (63), Expect = 7.666e-8
Identity = 18/62 (29.03%), Postives = 30/62 (48.39%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVG----------ETKYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++ A LF +E LSD++  +G            +  AH+F+L+A S V   MF+      S +
Sbjct:   57 ERFAFLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAE 118          
BLAST of SMED30013385 vs. Ensembl Human
Match: KLHL7 (kelch like family member 7 [Source:HGNC Symbol;Acc:HGNC:15646])

HSP 1 Score: 44.669 bits (104), Expect = 1.762e-7
Identity = 52/228 (22.81%), Postives = 97/228 (42.54%), Query Frame = -3
Query:  617 FLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWL-YSDDHFVDFEVN--AKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPK-IKKVLRAL-------------------ITKAHRYRSLCLFNGSISETFDSACYQPRNY 1231
             ++F Y   I   ++ V  LL  A++Y +E ++ +  +++K    +    N L      + LDC E+       I  +F ++ Y  D F  LD+  +  +L   ++ V  E  +Y+    WL Y + +   F V+  AK   PLI  + ++      ++ +    DNP+ +K V+  +                     K H YR + LF GS  ++     + P++Y
Sbjct:   98 LVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQVDAS---NCLGISVLAECLDCPELKATADDFIHQHFTEV-YKTDEFLQLDVKRVTHLLNQDTLTVRAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKT----VQAEPLIQDNPECLKMVISGMRYHLLSPEDREELVDGTRPRRKKHDYR-IALFGGSQPQSCRY--FNPKDY 314          

HSP 2 Score: 30.8018 bits (68), Expect = 1.762e-7
Identity = 15/45 (33.33%), Postives = 27/45 (60.00%), Query Frame = -2
Query: 1329 GFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMF 1463
            GF+  +  + + ++L D+ L V E K  AH+ +L+A+S   + MF
Sbjct:   29 GFMGVMNNMRKQKTLCDVILMVQERKIPAHRVVLAAASHFFNLMF 73          
BLAST of SMED30013385 vs. Ensembl Celegans
Match: W07A12.4 (pep chromosome:WBcel235:II:9146280:9152311:1 gene:WBGene00012322.1 transcript:W07A12.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07A12.4)

HSP 1 Score: 68.9366 bits (167), Expect = 3.173e-12
Identity = 51/181 (28.18%), Postives = 87/181 (48.07%), Query Frame = -3
Query:  731 KNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSL--KWYSWVKMLDCKEIVKNCWITICSNFQKLLY--LPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKK----LLPLIRFSMMTPVNLFEIEEQNDFSDNPKI 1249
            +  F  FL+F+Y+  +V   D  + LL LADKYNV +L+ +  ++ +   +    +  L   W+S+        ++K+C   I   F+ LL       +  L  D + EIL+ +++ V  EF ++E  + W+ + +H       A      LLPLIRF  M    L E+E+      +PK+
Sbjct:   94 QKAFAPFLRFMYSNHVVLHKDNCLPLLVLADKYNVTTLKKVCLDFAQSEILPVIDLKELFSVWFSYATKAYHPSLIKSCMQAIALEFETLLTEEWEKDWQELHRDQMIEILKCNNLKVASEFKLWEALQKWIQAPNHSERRGNTAGPLLAFLLPLIRFPFMNGDELNEVEKSAISEMHPKL 274          

HSP 2 Score: 58.151 bits (139), Expect = 6.843e-9
Identity = 33/94 (35.11%), Postives = 46/94 (48.94%), Query Frame = -2
Query: 1191 DEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFKIFICWRNCIHK 1472
            D++  +  +A  + N   SD+ +KVGE  Y AH+ ILS SSDV  RM   KW        G    + L E+  CQK+F  F +        +HK
Sbjct:   27 DDRETLCDMAKFYNNAQFSDVNMKVGEESYPAHRLILSKSSDVFDRMMSQKWN-------GDKFDLELVEDELCQKAFAPFLRFMYSNHVVLHK 113          
BLAST of SMED30013385 vs. Ensembl Celegans
Match: W07A12.4 (pep chromosome:WBcel235:II:9147952:9152311:1 gene:WBGene00012322.1 transcript:W07A12.4d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07A12.4)

HSP 1 Score: 68.5514 bits (166), Expect = 3.239e-12
Identity = 51/181 (28.18%), Postives = 87/181 (48.07%), Query Frame = -3
Query:  731 KNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSL--KWYSWVKMLDCKEIVKNCWITICSNFQKLLY--LPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKK----LLPLIRFSMMTPVNLFEIEEQNDFSDNPKI 1249
            +  F  FL+F+Y+  +V   D  + LL LADKYNV +L+ +  ++ +   +    +  L   W+S+        ++K+C   I   F+ LL       +  L  D + EIL+ +++ V  EF ++E  + W+ + +H       A      LLPLIRF  M    L E+E+      +PK+
Sbjct:   92 QKAFAPFLRFMYSNHVVLHKDNCLPLLVLADKYNVTTLKKVCLDFAQSEILPVIDLKELFSVWFSYATKAYHPSLIKSCMQAIALEFETLLTEEWEKDWQELHRDQMIEILKCNNLKVASEFKLWEALQKWIQAPNHSERRGNTAGPLLAFLLPLIRFPFMNGDELNEVEKSAISEMHPKL 272          

HSP 2 Score: 58.9214 bits (141), Expect = 4.628e-9
Identity = 34/102 (33.33%), Postives = 49/102 (48.04%), Query Frame = -2
Query: 1191 NNYEETLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFKIFICWRNCIHK 1496
            N+  +   D++  +  +A  + N   SD+ +KVGE  Y AH+ ILS SSDV  RM   KW        G    + L E+  CQK+F  F +        +HK
Sbjct:   17 NSGSDWFGDDRETLCDMAKFYNNAQFSDVNMKVGEESYPAHRLILSKSSDVFDRMMSQKWN-------GDKFDLELVEDELCQKAFAPFLRFMYSNHVVLHK 111          
BLAST of SMED30013385 vs. Ensembl Celegans
Match: W07A12.4 (pep chromosome:WBcel235:II:9148356:9152311:1 gene:WBGene00012322.1 transcript:W07A12.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07A12.4)

HSP 1 Score: 68.5514 bits (166), Expect = 3.346e-12
Identity = 51/181 (28.18%), Postives = 87/181 (48.07%), Query Frame = -3
Query:  731 KNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSL--KWYSWVKMLDCKEIVKNCWITICSNFQKLLY--LPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKK----LLPLIRFSMMTPVNLFEIEEQNDFSDNPKI 1249
            +  F  FL+F+Y+  +V   D  + LL LADKYNV +L+ +  ++ +   +    +  L   W+S+        ++K+C   I   F+ LL       +  L  D + EIL+ +++ V  EF ++E  + W+ + +H       A      LLPLIRF  M    L E+E+      +PK+
Sbjct:   94 QKAFAPFLRFMYSNHVVLHKDNCLPLLVLADKYNVTTLKKVCLDFAQSEILPVIDLKELFSVWFSYATKAYHPSLIKSCMQAIALEFETLLTEEWEKDWQELHRDQMIEILKCNNLKVASEFKLWEALQKWIQAPNHSERRGNTAGPLLAFLLPLIRFPFMNGDELNEVEKSAISEMHPKL 274          

HSP 2 Score: 58.5362 bits (140), Expect = 6.051e-9
Identity = 33/94 (35.11%), Postives = 46/94 (48.94%), Query Frame = -2
Query: 1191 DEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFKIFICWRNCIHK 1472
            D++  +  +A  + N   SD+ +KVGE  Y AH+ ILS SSDV  RM   KW        G    + L E+  CQK+F  F +        +HK
Sbjct:   27 DDRETLCDMAKFYNNAQFSDVNMKVGEESYPAHRLILSKSSDVFDRMMSQKWN-------GDKFDLELVEDELCQKAFAPFLRFMYSNHVVLHK 113          
BLAST of SMED30013385 vs. Ensembl Celegans
Match: W07A12.4 (pep chromosome:WBcel235:II:9146261:9152311:1 gene:WBGene00012322.1 transcript:W07A12.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07A12.4)

HSP 1 Score: 68.5514 bits (166), Expect = 4.575e-12
Identity = 51/178 (28.65%), Postives = 86/178 (48.31%), Query Frame = -3
Query:  731 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSL--KWYSWVKMLDCKEIVKNCWITICSNFQKLLY--LPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKK----LLPLIRFSMMTPVNLFEIEEQNDFSDNPKI 1240
            F  FL+F+Y+  +V   D  + LL LADKYNV +L+ +  ++ +   +    +  L   W+S+        ++K+C   I   F+ LL       +  L  D + EIL+ +++ V  EF ++E  + W+ + +H       A      LLPLIRF  M    L E+E+      +PK+
Sbjct:  177 FAPFLRFMYSNHVVLHKDNCLPLLVLADKYNVTTLKKVCLDFAQSEILPVIDLKELFSVWFSYATKAYHPSLIKSCMQAIALEFETLLTEEWEKDWQELHRDQMIEILKCNNLKVASEFKLWEALQKWIQAPNHSERRGNTAGPLLAFLLPLIRFPFMNGDELNEVEKSAISEMHPKL 354          

HSP 2 Score: 58.5362 bits (140), Expect = 5.768e-9
Identity = 33/94 (35.11%), Postives = 46/94 (48.94%), Query Frame = -2
Query: 1191 DEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFKIFICWRNCIHK 1472
            D++  +  +A  + N   SD+ +KVGE  Y AH+ ILS SSDV  RM   KW        G    + L E+  CQK+F  F +        +HK
Sbjct:  107 DDRETLCDMAKFYNNAQFSDVNMKVGEESYPAHRLILSKSSDVFDRMMSQKWN-------GDKFDLELVEDELCQKAFAPFLRFMYSNHVVLHK 193          
BLAST of SMED30013385 vs. Ensembl Celegans
Match: tag-30 (pep chromosome:WBcel235:IV:11850950:11854946:-1 gene:WBGene00006415.1 transcript:F38H4.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-30)

HSP 1 Score: 51.9878 bits (123), Expect = 8.823e-12
Identity = 39/157 (24.84%), Postives = 69/157 (43.95%), Query Frame = -3
Query:  791 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNA-------KKLLPLIRFSMM 1240
            F   LKFLY+ E+    + V+  L  A KY V ++      ++K+  V     N+    S  K+ D  ++++ C   I  N  + L   + F  +D+D LCE+L    + + +E  +++    W   +        N         + +PLIRF +M
Sbjct:  247 FLALLKFLYSDEVKIEAESVMTTLYTAKKYAVPAMEKECVRFLKQRLVPD---NAFMMLSQAKLFDEPDLMQKCLEVIDKNTLEALNG-EGFTEIDLDTLCEVLTRDGLRI-REIFLFQAVLRWAKFEAERRGMPANGDSRRAVLSRSIPLIRFPLM 398          

HSP 2 Score: 36.965 bits (84), Expect = 8.823e-12
Identity = 23/77 (29.87%), Postives = 41/77 (53.25%), Query Frame = -2
Query: 1257 SDEKGFIKKIAMLFQNESLSDIQLKVG----ETKYFAHKFILSASSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENA 1475
            +D+K   ++I  ++ NE+L+D+   VG      +  AHKF+LS  S V   MF+      +T+   + E+  +E +A
Sbjct:  170 ADKKTLRERIEHMYCNETLADVFFVVGIDDSRQRIPAHKFVLSIGSVVFDAMFNGGLTPKNTEEALEIELPDVEPSA 246          
BLAST of SMED30013385 vs. Ensembl Fly
Match: Tango10 (gene:FBgn0030330 transcript:FBtr0332955)

HSP 1 Score: 53.9138 bits (128), Expect = 1.598e-14
Identity = 42/165 (25.45%), Postives = 74/165 (44.85%), Query Frame = -3
Query:  776 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQK----LLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNA------KKLLPLIRFSMMTPVNL 1240
            F  F+K+LY G+I  T   V+ +L L+DKYN+  L +L  +YM ++         L   SW++         N        F K    ++     F  +D   L  +L+ + +VV  E+ ++++ + WL      ++   +       ++ +  IRF MMTP  L
Sbjct:  197 FPQFIKYLYVGQIEVTLQTVMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYL--VSWLQYTLSFTPTHNDLTETLKRFLKWNLEMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDILQTWLLHRREQMEATGSGGFMELIEQTVSHIRFGMMTPRQL 359          

HSP 2 Score: 45.0542 bits (105), Expect = 1.598e-14
Identity = 32/87 (36.78%), Postives = 42/87 (48.28%), Query Frame = -2
Query: 1224 TLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDN-KWKLGSTQNPGQSEMIVLEENAECQKSFFLFFK 1481
            T+ D    + KIA L+  + +SDI L V   ++ AH+ IL ASSDV   M  N +W      N     +I L E A C   F  F K
Sbjct:  122 TMIDANSVLNKIANLYAEQLMSDIVLLVDGKEFPAHRVILCASSDVFQVMLMNPEW------NECSKHVIELHEEACCSAVFPQFIK 202          
BLAST of SMED30013385 vs. Ensembl Fly
Match: Tango10 (gene:FBgn0030330 transcript:FBtr0073552)

HSP 1 Score: 53.9138 bits (128), Expect = 1.598e-14
Identity = 42/165 (25.45%), Postives = 74/165 (44.85%), Query Frame = -3
Query:  776 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQK----LLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNA------KKLLPLIRFSMMTPVNL 1240
            F  F+K+LY G+I  T   V+ +L L+DKYN+  L +L  +YM ++         L   SW++         N        F K    ++     F  +D   L  +L+ + +VV  E+ ++++ + WL      ++   +       ++ +  IRF MMTP  L
Sbjct:  197 FPQFIKYLYVGQIEVTLQTVMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYL--VSWLQYTLSFTPTHNDLTETLKRFLKWNLEMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDILQTWLLHRREQMEATGSGGFMELIEQTVSHIRFGMMTPRQL 359          

HSP 2 Score: 45.0542 bits (105), Expect = 1.598e-14
Identity = 32/87 (36.78%), Postives = 42/87 (48.28%), Query Frame = -2
Query: 1224 TLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDN-KWKLGSTQNPGQSEMIVLEENAECQKSFFLFFK 1481
            T+ D    + KIA L+  + +SDI L V   ++ AH+ IL ASSDV   M  N +W      N     +I L E A C   F  F K
Sbjct:  122 TMIDANSVLNKIANLYAEQLMSDIVLLVDGKEFPAHRVILCASSDVFQVMLMNPEW------NECSKHVIELHEEACCSAVFPQFIK 202          
BLAST of SMED30013385 vs. Ensembl Fly
Match: Tango10 (gene:FBgn0030330 transcript:FBtr0073553)

HSP 1 Score: 53.9138 bits (128), Expect = 1.598e-14
Identity = 42/165 (25.45%), Postives = 74/165 (44.85%), Query Frame = -3
Query:  776 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQK----LLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNA------KKLLPLIRFSMMTPVNL 1240
            F  F+K+LY G+I  T   V+ +L L+DKYN+  L +L  +YM ++         L   SW++         N        F K    ++     F  +D   L  +L+ + +VV  E+ ++++ + WL      ++   +       ++ +  IRF MMTP  L
Sbjct:  197 FPQFIKYLYVGQIEVTLQTVMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYL--VSWLQYTLSFTPTHNDLTETLKRFLKWNLEMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDILQTWLLHRREQMEATGSGGFMELIEQTVSHIRFGMMTPRQL 359          

HSP 2 Score: 45.0542 bits (105), Expect = 1.598e-14
Identity = 32/87 (36.78%), Postives = 42/87 (48.28%), Query Frame = -2
Query: 1224 TLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDN-KWKLGSTQNPGQSEMIVLEENAECQKSFFLFFK 1481
            T+ D    + KIA L+  + +SDI L V   ++ AH+ IL ASSDV   M  N +W      N     +I L E A C   F  F K
Sbjct:  122 TMIDANSVLNKIANLYAEQLMSDIVLLVDGKEFPAHRVILCASSDVFQVMLMNPEW------NECSKHVIELHEEACCSAVFPQFIK 202          
BLAST of SMED30013385 vs. Ensembl Fly
Match: KLHL18 (gene:FBgn0037978 transcript:FBtr0082556)

HSP 1 Score: 45.8246 bits (107), Expect = 4.294e-7
Identity = 46/209 (22.01%), Postives = 92/209 (44.02%), Query Frame = -3
Query:  659 FLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWL-YSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFE-----------------IEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSI 1231
             + ++Y+G++   N  V  L+  A    + ++R+    ++  +   PH  N L   ++   + C++++      I  NF K+    + F ALD + L E++    + V  E  I+E C  W+ Y++D   +      ++L  +R  +++P  L +                 ++E  DF   P+ + +L++  T   R RS   F G I
Sbjct:   95 LINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLI-SRFHPH--NVLGIRTFADSMICRQLIDAADKYIDQNFAKVSQSEE-FLALDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAEDKRSEL---FPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQSFRT---RQRSGEFFTGQI 293          

HSP 2 Score: 27.7202 bits (60), Expect = 4.294e-7
Identity = 12/33 (36.36%), Postives = 19/33 (57.58%), Query Frame = -2
Query: 1323 LSDIQLKVGETKYFAHKFILSASSDVLSRMFDN 1421
            L D+ LKV +  + AH+ +L+A+      MF N
Sbjct:   38 LCDVTLKVEDQTFSAHRVVLAATIPYFYAMFTN 70          
BLAST of SMED30013385 vs. Ensembl Fly
Match: KLHL18 (gene:FBgn0037978 transcript:FBtr0335434)

HSP 1 Score: 45.8246 bits (107), Expect = 4.294e-7
Identity = 46/209 (22.01%), Postives = 92/209 (44.02%), Query Frame = -3
Query:  659 FLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWL-YSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFE-----------------IEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSI 1231
             + ++Y+G++   N  V  L+  A    + ++R+    ++  +   PH  N L   ++   + C++++      I  NF K+    + F ALD + L E++    + V  E  I+E C  W+ Y++D   +      ++L  +R  +++P  L +                 ++E  DF   P+ + +L++  T   R RS   F G I
Sbjct:   95 LINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLI-SRFHPH--NVLGIRTFADSMICRQLIDAADKYIDQNFAKVSQSEE-FLALDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAEDKRSEL---FPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQSFRT---RQRSGEFFTGQI 293          

HSP 2 Score: 27.7202 bits (60), Expect = 4.294e-7
Identity = 12/33 (36.36%), Postives = 19/33 (57.58%), Query Frame = -2
Query: 1323 LSDIQLKVGETKYFAHKFILSASSDVLSRMFDN 1421
            L D+ LKV +  + AH+ +L+A+      MF N
Sbjct:   38 LCDVTLKVEDQTFSAHRVVLAATIPYFYAMFTN 70          
BLAST of SMED30013385 vs. Ensembl Zebrafish
Match: btbd17a (BTB (POZ) domain containing 17a [Source:ZFIN;Acc:ZDB-GENE-130531-68])

HSP 1 Score: 79.337 bits (194), Expect = 2.184e-15
Identity = 58/234 (24.79%), Postives = 112/234 (47.86%), Query Frame = -3
Query:  611 RDNRK*LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN----SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLN 1294
            + N   L L+        F  F+++LY GE+    D+   L  LA KY +  L+   T+YM +N    S + H++    WY +   +    +  NC   +  N   +L  P+ +  + I+ L  +L+ S +V+  E  ++E  + WL  ++      + A+  L L+R++M+ P  LF ++ Q+      +  + +R L+  ++++ S       +++ FD  C  + PRNYL+
Sbjct:  102 KRNSSTLVLQETAECTAVFDKFIRYLYCGELSLQLDQATPLHSLATKYAISGLQQGLTQYMSQNLASDSPTGHVVG---WYQYATKVGDMTLKDNCLQFLSWNLSSVLQSPE-WPLVSIELLMTLLQRSDLVLKNELELFEAVETWLTQNN---PDSLTAENALRLVRYAMIPPRELFRLQRQSPIMT--RYHESVRDLLYMSYQFHSASPLQ--LAKFFDMNCSLFVPRNYLS 324          
BLAST of SMED30013385 vs. Ensembl Zebrafish
Match: btbd2b (BTB (POZ) domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-140106-73])

HSP 1 Score: 53.9138 bits (128), Expect = 9.483e-13
Identity = 47/181 (25.97%), Postives = 77/181 (42.54%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N       N+    +  ++ D  ++   C   I  N    L   + F  +D+D L  +LE  ++ V +E  ++     W  ++ H    +   +       K L LIRF +MT      IEE   F+  P    +L
Sbjct:  210 FLSLLKFLYSDEVHIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNL---RADNAFMLLTQARLFDEPQLASLCLENIDKNTGDALAA-EGFTDIDLDTLVAVLERDTLGV-REVHLFGAAVRWAEAEAHRQQLQPTPENKRRVLGKALSLIRFPLMT------IEE---FAAGPAQSAIL 376          

HSP 2 Score: 39.2762 bits (90), Expect = 9.483e-13
Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = -2
Query: 1299 NYEETLSDEKGFIKKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1493
            N++ T S  K   ++ A LF NE LSD+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  134 NWQATKSTVK---ERFAFLFNNEVLSDVHFLVGKGMGVQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 199          
BLAST of SMED30013385 vs. Ensembl Zebrafish
Match: btbd17b (BTB (POZ) domain containing 17b [Source:ZFIN;Acc:ZDB-GENE-091204-214])

HSP 1 Score: 70.0922 bits (170), Expect = 2.438e-12
Identity = 57/235 (24.26%), Postives = 119/235 (50.64%), Query Frame = -3
Query:  608 KTRDNRK*LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN--SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLNL 1300
            +TR++   + LK   +    F  F+++LY G+I    ++ + L  LA KY+V  L+   T+YM ++  S SP   + + WY +   +    +  +C   +  N   +L   + ++++  + L  +L+ S +V+  E  +YE  + W+  +      +  A+  L  IR++M++P NLF +++++      K  + +R L+  A ++ +       +++ +D  C  + PRNYL+L
Sbjct:   97 QTRNSTA-MVLKETSDCAAVFEKFVRYLYCGDITVRLNQAIPLHKLATKYHVWDLQQGLTQYMTQHLSSDSP-AGHVVAWYQYATQIGDVTLQNSCLQYLSWNLSSVLQSAE-WSSVSGELLLSLLQRSDLVLQSELELYEALEAWINQNQ---PSDETAENALKAIRYAMISPQNLFHLQKKSPLM--LKYYESVRDLLFLAFQFHAASPIQ--LAKYYDVNCSLFTPRNYLSL 321          
BLAST of SMED30013385 vs. Ensembl Zebrafish
Match: btbd17b (BTB (POZ) domain containing 17b [Source:ZFIN;Acc:ZDB-GENE-091204-214])

HSP 1 Score: 70.0922 bits (170), Expect = 2.570e-12
Identity = 58/235 (24.68%), Postives = 119/235 (50.64%), Query Frame = -3
Query:  608 KTRDNRK*LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN--SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLNL 1300
            +TR++   + LK   +    F  F+++LY G+I    ++ + L  LA KY+V  L+   T+YM ++  S SP   + + WY +   +    +  +C   +  N   +L   + ++++  + L  +L+ S +V+  E  +YE  + W+  +    +   NA   L  IR++M++P NLF +++++      K  + +R L+  A ++ +       +++ +D  C  + PRNYL+L
Sbjct:  134 QTRNSTA-MVLKETSDCAAVFEKFVRYLYCGDITVRLNQAIPLHKLATKYHVWDLQQGLTQYMTQHLSSDSP-AGHVVAWYQYATQIGDVTLQNSCLQYLSWNLSSVLQSAE-WSSVSGELLLSLLQRSDLVLQSELELYEALEAWINQNQPSDETAENA---LKAIRYAMISPQNLFHLQKKSPLM--LKYYESVRDLLFLAFQFHAASPIQ--LAKYYDVNCSLFTPRNYLSL 358          
BLAST of SMED30013385 vs. Ensembl Zebrafish
Match: btbd17b (BTB (POZ) domain containing 17b [Source:ZFIN;Acc:ZDB-GENE-091204-214])

HSP 1 Score: 70.0922 bits (170), Expect = 2.570e-12
Identity = 58/235 (24.68%), Postives = 119/235 (50.64%), Query Frame = -3
Query:  608 KTRDNRK*LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN--SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLNL 1300
            +TR++   + LK   +    F  F+++LY G+I    ++ + L  LA KY+V  L+   T+YM ++  S SP   + + WY +   +    +  +C   +  N   +L   + ++++  + L  +L+ S +V+  E  +YE  + W+  +    +   NA   L  IR++M++P NLF +++++      K  + +R L+  A ++ +       +++ +D  C  + PRNYL+L
Sbjct:  134 QTRNSTA-MVLKETSDCAAVFEKFVRYLYCGDITVRLNQAIPLHKLATKYHVWDLQQGLTQYMTQHLSSDSP-AGHVVAWYQYATQIGDVTLQNSCLQYLSWNLSSVLQSAE-WSSVSGELLLSLLQRSDLVLQSELELYEALEAWINQNQPSDETAENA---LKAIRYAMISPQNLFHLQKKSPLM--LKYYESVRDLLFLAFQFHAASPIQ--LAKYYDVNCSLFTPRNYLSL 358          
BLAST of SMED30013385 vs. Ensembl Xenopus
Match: klhdc7a (kelch domain containing 7A [Source:Xenbase;Acc:XB-GENE-6031023])

HSP 1 Score: 50.8322 bits (120), Expect = 5.284e-11
Identity = 49/181 (27.07%), Postives = 78/181 (43.09%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSD----DHFVDFEVNAK---KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N       N+    +  ++ D  ++   C   I  N    L   + F  +D+D L  +LE  ++ + +E  ++     W  ++     H V  E   K   K L LIRF +MT      IEE   F+  P    +L
Sbjct:  168 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNL---RADNAFMLLTQARLFDEPQLASLCLENIDKNTSDALNA-EGFTDIDLDTLVAVLERDTLGI-REIRLFNAVVRWSEAECQRQQHPVTSENKRKSLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 334          

HSP 2 Score: 36.965 bits (84), Expect = 5.284e-11
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++   LF NE LSD+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  102 ERFTFLFNNEVLSDVHFLVGKGLGSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 157          
BLAST of SMED30013385 vs. Ensembl Xenopus
Match: klhdc7a (kelch domain containing 7A [Source:Xenbase;Acc:XB-GENE-6031023])

HSP 1 Score: 50.8322 bits (120), Expect = 5.459e-11
Identity = 49/181 (27.07%), Postives = 78/181 (43.09%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSD----DHFVDFEVNAK---KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N       N+    +  ++ D  ++   C   I  N    L   + F  +D+D L  +LE  ++ + +E  ++     W  ++     H V  E   K   K L LIRF +MT      IEE   F+  P    +L
Sbjct:  165 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNL---RADNAFMLLTQARLFDEPQLASLCLENIDKNTSDALNA-EGFTDIDLDTLVAVLERDTLGI-REIRLFNAVVRWSEAECQRQQHPVTSENKRKSLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 331          

HSP 2 Score: 36.5798 bits (83), Expect = 5.459e-11
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++   LF NE LSD+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:   99 ERFTFLFNNEVLSDVHFLVGKGLGSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 154          
BLAST of SMED30013385 vs. Ensembl Xenopus
Match: klhdc7a (kelch domain containing 7A [Source:Xenbase;Acc:XB-GENE-6031023])

HSP 1 Score: 50.447 bits (119), Expect = 7.306e-11
Identity = 49/181 (27.07%), Postives = 79/181 (43.65%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSD----DHFVDFEVNAK---KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N  +    N+    +  ++ D  ++   C   I  N    L   + F  +D+D L  +LE  ++ + +E  ++     W  ++     H V  E   K   K L LIRF +MT      IEE   F+  P    +L
Sbjct:  191 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRAD---NAFMLLTQARLFDEPQLASLCLENIDKNTSDALNA-EGFTDIDLDTLVAVLERDTLGI-REIRLFNAVVRWSEAECQRQQHPVTSENKRKSLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 357          

HSP 2 Score: 36.965 bits (84), Expect = 7.306e-11
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++   LF NE LSD+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  125 ERFTFLFNNEVLSDVHFLVGKGLGSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 180          
BLAST of SMED30013385 vs. Ensembl Xenopus
Match: klhdc7a (kelch domain containing 7A [Source:Xenbase;Acc:XB-GENE-6031023])

HSP 1 Score: 50.447 bits (119), Expect = 7.378e-11
Identity = 49/181 (27.07%), Postives = 79/181 (43.65%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSD----DHFVDFEVNAK---KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N  +    N+    +  ++ D  ++   C   I  N    L   + F  +D+D L  +LE  ++ + +E  ++     W  ++     H V  E   K   K L LIRF +MT      IEE   F+  P    +L
Sbjct:  191 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRAD---NAFMLLTQARLFDEPQLASLCLENIDKNTSDALNA-EGFTDIDLDTLVAVLERDTLGI-REIRLFNAVVRWSEAECQRQQHPVTSENKRKSLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 357          

HSP 2 Score: 36.5798 bits (83), Expect = 7.378e-11
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++   LF NE LSD+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  125 ERFTFLFNNEVLSDVHFLVGKGLGSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 180          
BLAST of SMED30013385 vs. Ensembl Xenopus
Match: klhdc7a (kelch domain containing 7A [Source:Xenbase;Acc:XB-GENE-6031023])

HSP 1 Score: 49.6766 bits (117), Expect = 1.041e-10
Identity = 49/181 (27.07%), Postives = 79/181 (43.65%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSD----DHFVDFEVNAK---KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N  +    N+    +  ++ D  ++   C   I  N    L   + F  +D+D L  +LE  ++ + +E  ++     W  ++     H V  E   K   K L LIRF +MT      IEE   F+  P    +L
Sbjct:  118 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRAD---NAFMLLTQARLFDEPQLASLCLENIDKNTSDALNA-EGFTDIDLDTLVAVLERDTLGI-REIRLFNAVVRWSEAECQRQQHPVTSENKRKSLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 284          

HSP 2 Score: 36.965 bits (84), Expect = 1.041e-10
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++   LF NE LSD+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:   52 ERFTFLFNNEVLSDVHFLVGKGLGSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 107          
BLAST of SMED30013385 vs. Ensembl Mouse
Match: Btbd17 (BTB (POZ) domain containing 17 [Source:MGI Symbol;Acc:MGI:1919264])

HSP 1 Score: 65.4698 bits (158), Expect = 6.155e-11
Identity = 61/294 (20.75%), Postives = 127/294 (43.20%), Query Frame = -3
Query:  431 DNRK*LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQND--FSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDR---FNNKIANRFSNSLDKKAIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVV--DAAGFYL 1291
             N+  + L+  ++    F  F+++LY GE+     + + L  LA KY V SL+    +YM R  ++  +  ++ WY +      + + ++C   +  N   +    + + A+  + L ++L+ S +V+  E  ++   + WL            A++ L  IR+ M+ P  LF+++ ++       P +      L+ +A+++ +    + +     + + + PRNYL          NN   +  S S   +   + + +     W + +      L V+ R V  DAAG  L
Sbjct:   99 SNQSEVMLRESRDCAAVFDKFIRYLYCGELTVLLAQAIPLHRLATKYRVASLQRGVADYM-RAHLAGGVGPAVGWYHYAVSTGDEALRESCLQFLAWNLSAVAGSAE-WGAVSPELLAQLLQRSDLVLQDELELFHALEAWL---GRARPPPTVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVAD----LLLQAYQFHAASPLHYAKFFHVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRITWNVLFSP--RWLPVSLRPVYADAAGTAL 381          
BLAST of SMED30013385 vs. Ensembl Mouse
Match: Btbd2 (BTB (POZ) domain containing 2 [Source:MGI Symbol;Acc:MGI:1933831])

HSP 1 Score: 50.447 bits (119), Expect = 6.459e-11
Identity = 46/183 (25.14%), Postives = 79/183 (43.17%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLM--NSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+     HL   N+    +  ++ D  ++   C  +I  N    +   + F  +D+D L  +LE  ++ + +E  ++     W  ++      +V  +       K L LIRF +MT      IEE   F+  P    +L
Sbjct:  169 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKK-----HLRADNAFMLLTQARLFDEPQLASLCLESIDKNTADAIAA-EGFTDIDLDTLVAVLERDTLGI-REVRLFNAVVRWSEAECQRQQLQVTPENKRKVLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 335          

HSP 2 Score: 36.5798 bits (83), Expect = 6.459e-11
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++ A LF NE L D+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  103 ERFAFLFNNEVLCDVHFLVGKGLSSQRVPAHRFVLAVGSAVFDAMFNGGMATTSTE 158          
BLAST of SMED30013385 vs. Ensembl Mouse
Match: Btbd2 (BTB (POZ) domain containing 2 [Source:MGI Symbol;Acc:MGI:1933831])

HSP 1 Score: 50.0618 bits (118), Expect = 7.858e-11
Identity = 46/183 (25.14%), Postives = 79/183 (43.17%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLM--NSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+     HL   N+    +  ++ D  ++   C  +I  N    +   + F  +D+D L  +LE  ++ + +E  ++     W  ++      +V  +       K L LIRF +MT      IEE   F+  P    +L
Sbjct:  154 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKK-----HLRADNAFMLLTQARLFDEPQLASLCLESIDKNTADAIAA-EGFTDIDLDTLVAVLERDTLGI-REVRLFNAVVRWSEAECQRQQLQVTPENKRKVLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 320          

HSP 2 Score: 36.5798 bits (83), Expect = 7.858e-11
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++ A LF NE L D+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:   88 ERFAFLFNNEVLCDVHFLVGKGLSSQRVPAHRFVLAVGSAVFDAMFNGGMATTSTE 143          
BLAST of SMED30013385 vs. Ensembl Mouse
Match: Btbd1 (BTB (POZ) domain containing 1 [Source:MGI Symbol;Acc:MGI:1933765])

HSP 1 Score: 47.3654 bits (111), Expect = 5.853e-8
Identity = 46/183 (25.14%), Postives = 77/183 (42.08%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLM--NSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVN-------AKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   L+FLY+ E+    + V+  L  A KY V +L     E++ +     HL   N+    +  ++ D  ++   C  TI  +    +   + F  +DID LC +LE  ++ + +E  ++     W  ++       V          K L LIRF +MT      IEE   F+  P    +L
Sbjct:  135 FLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTK-----HLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTVDAISA-EGFTDIDIDTLCAVLERDTLSI-RESRLFGAIVRWAEAECQRQQLAVTFGNKQKVLGKALSLIRFPLMT------IEE---FAAGPAQSGIL 301          

HSP 2 Score: 29.261 bits (64), Expect = 5.853e-8
Identity = 18/62 (29.03%), Postives = 30/62 (48.39%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVG----------ETKYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++ A LF +E LSD++  +G            +  AH+F+L+A S V   MF+      S +
Sbjct:   63 ERFAFLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAE 124          
BLAST of SMED30013385 vs. Ensembl Mouse
Match: Klhl7 (kelch-like 7 [Source:MGI Symbol;Acc:MGI:1196453])

HSP 1 Score: 45.4394 bits (106), Expect = 8.269e-8
Identity = 53/230 (23.04%), Postives = 98/230 (42.61%), Query Frame = -3
Query:  617 FLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWL-YSDDHFVDFEVN--AKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPK-IKKVLRAL-------------------ITKAHRYRSLCLFNGSISETFDSAC--YQPRNY 1231
             ++F Y   I   ++ V  LL  A++Y +E ++ +  +++K    +    N L      + LDC E+       I  +F ++ Y  D F  LD+  +  +L   ++ V  E  +Y+    WL Y + +   F V+  AK   PLI  + ++      ++ +    DNP+ +K V+  +                     K H YR + LF GS  ++    C  + P++Y
Sbjct:   98 LVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQVDA---SNCLGISVLAECLDCPELKATADDFIHQHFTEV-YKTDEFLQLDVKRVTHLLSQDTLTVRAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKT----VQAEPLIQDNPECLKMVISGMRYHLLSPEDREELAGGTRPRRKKHDYR-IALFGGSQPQS----CRYFNPKDY 314          

HSP 2 Score: 30.8018 bits (68), Expect = 8.269e-8
Identity = 15/45 (33.33%), Postives = 26/45 (57.78%), Query Frame = -2
Query: 1329 GFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMF 1463
            GF+  +  + +  +L D+ L V E K  AH+ +L+A+S   + MF
Sbjct:   29 GFMGVMNNMRKQRTLCDVILTVQERKIPAHRVVLAAASHFFNLMF 73          
BLAST of SMED30013385 vs. UniProt/SwissProt
Match: sp|A6NE02|BTBDH_HUMAN (BTB/POZ domain-containing protein 17 OS=Homo sapiens OX=9606 GN=BTBD17 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.974e-10
Identity = 63/289 (21.80%), Postives = 125/289 (43.25%), Query Frame = -3
Query:  431 LKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQND--FSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFD--SACYQPRNYLNLVVDR---FNNKIANRFSNSLDKKAIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVV--DAAGFYL 1270
            L+  Q+    F  F+++LY GE+     + + L  LA KY V SL+    +YM R  ++     ++ WY +      + + ++C   +  N   +    + + A+  + L ++L+ S +V+  E  ++   + WL            A++ L  IR+ M+ P  LF+++ ++       P +      L+ +A+++ +    +   ++ FD   + + PRNYL          NN   +  S S   +   + + +     W + +      L V+ R V  DAAG  L
Sbjct:  106 LQEPQDCAAVFDKFIRYLYCGELTVLLTQAIPLHRLATKYGVSSLQRGVADYM-RAHLAGGAGPAVGWYHYAVGTGDEALRESCLQFLAWNLSAVAASTE-WGAVSPELLWQLLQRSDLVLQDELELFHALEAWL---GRARPPPAVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVAD----LLLQAYQFHAASPLH--YAKFFDVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLFSP--RWLPVSLRPVYADAAGTAL 381          
BLAST of SMED30013385 vs. UniProt/SwissProt
Match: sp|Q9DB72|BTBDH_MOUSE (BTB/POZ domain-containing protein 17 OS=Mus musculus OX=10090 GN=Btbd17 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.306e-10
Identity = 61/294 (20.75%), Postives = 127/294 (43.20%), Query Frame = -3
Query:  431 DNRK*LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQND--FSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDR---FNNKIANRFSNSLDKKAIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVV--DAAGFYL 1291
             N+  + L+  ++    F  F+++LY GE+     + + L  LA KY V SL+    +YM R  ++  +  ++ WY +      + + ++C   +  N   +    + + A+  + L ++L+ S +V+  E  ++   + WL            A++ L  IR+ M+ P  LF+++ ++       P +      L+ +A+++ +    + +     + + + PRNYL          NN   +  S S   +   + + +     W + +      L V+ R V  DAAG  L
Sbjct:   99 SNQSEVMLRESRDCAAVFDKFIRYLYCGELTVLLAQAIPLHRLATKYRVASLQRGVADYM-RAHLAGGVGPAVGWYHYAVSTGDEALRESCLQFLAWNLSAVAGSAE-WGAVSPELLAQLLQRSDLVLQDELELFHALEAWL---GRARPPPTVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVAD----LLLQAYQFHAASPLHYAKFFHVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRITWNVLFSP--RWLPVSLRPVYADAAGTAL 381          
BLAST of SMED30013385 vs. UniProt/SwissProt
Match: sp|Q9BX70|BTBD2_HUMAN (BTB/POZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BTBD2 PE=1 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 8.711e-10
Identity = 45/181 (24.86%), Postives = 78/181 (43.09%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N  +    N+    +  ++ D  ++   C   I  N    +   + F  +D+D L  +LE  ++ + +E  ++     W  ++      +V  +       K L LIRF +MT      IEE   F+  P    +L
Sbjct:  171 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRAD---NAFMLLTQARLFDEPQLASLCLENIDKNTADAI-TAEGFTDIDLDTLVAVLERDTLGI-REVRLFNAVVRWSEAECQRQQLQVTPENRRKVLGKALGLIRFPLMT------IEE---FAAGPAQSGIL 337          

HSP 2 Score: 36.5798 bits (83), Expect = 8.711e-10
Identity = 19/56 (33.93%), Postives = 29/56 (51.79%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++ A LF NE L D+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  105 ERFAFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 160          
BLAST of SMED30013385 vs. UniProt/SwissProt
Match: sp|Q66KD0|BTBDH_XENTR (BTB/POZ domain-containing protein 17 OS=Xenopus tropicalis OX=8364 GN=btbd17 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.985e-8
Identity = 51/216 (23.61%), Postives = 107/216 (49.54%), Query Frame = -3
Query:  611 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN----SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLN 1240
            F  F+++ Y GEI    ++ + L  LA+KY++ +L+   TEYMK +    S   H+++   WY +   +    + ++C   +  N   ++   +     D   +  +L+ S +V+  E  ++   + W+  +    D  V  +K+L  IR+ M++P  LF+I++++    +      ++ L+ +A ++ S    +   ++ FD  C  + PRNYL+
Sbjct:  104 FEKFIRYFYCGEISVNLNQAIPLHRLANKYHMTALQRGVTEYMKTHFSSESAQGHVVS---WYHYALRMGDINLQESCLKFLAWNLSTIMSSNEWVTVSD-KLMVSLLQRSDLVLQSELELFSAVEEWISKNK--PDAPV-IEKVLRSIRYPMISPSQLFQIQKESAVLAS--YHNSVQDLMFQAFQFHSASPLH--FAKYFDVNCSMFVPRNYLS 308          
BLAST of SMED30013385 vs. UniProt/SwissProt
Match: sp|Q6GLJ1|BTBDH_XENLA (BTB/POZ domain-containing protein 17 OS=Xenopus laevis OX=8355 GN=btbd17 PE=2 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 2.616e-8
Identity = 50/213 (23.47%), Postives = 103/213 (48.36%), Query Frame = -3
Query:  611 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNS-LKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLN 1240
            F  F+++ Y GEI    ++ + L  LA KY+V +L+   TEYMK +  S       + WY +   +    + ++C   +  N   ++   +     D + +  +L+ S +V+  E  ++   + W+   +  V      +K+L  IR+ M+TP  LF+I++++    +      ++ L+ +A ++ S    +   ++ F+  C  + PRNYL+
Sbjct:  106 FEKFIRYFYCGEISVNLNQAIPLHRLASKYHVTALQRGITEYMKTHFASESSQGHVVSWYHYALRMGDITLQESCLKFLAWNLSTVMSSNEWVTVSD-NLMVSLLQRSDLVLQSELELFNAVEEWVSKKNPDVPV---IEKVLRAIRYPMITPSQLFQIQKKSVVLAS--YHNSVQDLMFQAFQFHSASPLH--FAKYFEVNCSMFVPRNYLS 310          
BLAST of SMED30013385 vs. TrEMBL
Match: A0A0B6ZNM1 (BTB domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF72195 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.391e-59
Identity = 110/295 (37.29%), Postives = 170/295 (57.63%), Query Frame = -3
Query:  362 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKK--AIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDEVLNVAQT 1240
            F  FL+FLY  E+  + +  VG+LCLADKY+V SL+NL T+YM  ++ SP + N+L WYSW K L   E+V  C  TI  N + +L  P+ ++ +DIDF+ ++L++  +V+ +E+T++E    WL  ++H  ++  NAKKLLPLIRF  M    L+ I EQ +   +  +  +L  LI KA+R+RSLC     ++ +F    Y PRNYL+L VD    + A R+   +D +  A   P  S D  +WK+ YRK  +   +     ++A      + Q  LI  N  D+V+ V ++
Sbjct:  189 FDTFLRFLYTAEVNISVESAVGILCLADKYSVTSLKNLCTQYMVEHTRSPLVKNALSWYSWSKALHMNELVFQCSKTIAWNVENILKSPE-WSHMDIDFVSDMLKNGDLVIQREYTLFEALIEWLEFEEHLENYLDNAKKLLPLIRFPQMQVHELYAI-EQCEMYKHEDLSVILDRLINKAYRFRSLCSHKAEVNVSFTDDFYLPRNYLDLSVDNVRMQNALRYGIQVDVRTYAGPVPSVSRD-GEWKIAYRKSNDTWTLQIYCHESALVGGEARVQAALIIANHEDQVVQVEES 480          

HSP 2 Score: 69.3218 bits (168), Expect = 1.391e-59
Identity = 37/88 (42.05%), Postives = 49/88 (55.68%), Query Frame = -2
Query: 1224 ETLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRM-FDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFK 1484
              L DE  FI+ +   +  + +SDI LK+G+TKY+ HKF+L+ SSDV   M +D  W        G  E IVLEE  ECQ  F  F +
Sbjct:  113 RVLRDESNFIQNVGQFYNQKDISDIILKIGKTKYYGHKFVLAKSSDVFRTMLYDKNWTQA-----GLPE-IVLEETDECQAYFDTFLR 194          
BLAST of SMED30013385 vs. TrEMBL
Match: A0A0B6ZN58 (BTB domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF72200 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.127e-59
Identity = 110/295 (37.29%), Postives = 170/295 (57.63%), Query Frame = -3
Query:  362 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKK--AIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDEVLNVAQT 1240
            F  FL+FLY  E+  + +  VG+LCLADKY+V SL+NL T+YM  ++ SP + N+L WYSW K L   E+V  C  TI  N + +L  P+ ++ +DIDF+ ++L++  +V+ +E+T++E    WL  ++H  ++  NAKKLLPLIRF  M    L+ I EQ +   +  +  +L  LI KA+R+RSLC     ++ +F    Y PRNYL+L VD    + A R+   +D +  A   P  S D  +WK+ YRK  +   +     ++A      + Q  LI  N  D+V+ V ++
Sbjct:  117 FDTFLRFLYTAEVNISVESAVGILCLADKYSVTSLKNLCTQYMVEHTRSPLVKNALSWYSWSKALHMNELVFQCSKTIAWNVENILKSPE-WSHMDIDFVSDMLKNGDLVIQREYTLFEALIEWLEFEEHLENYLDNAKKLLPLIRFPQMQVHELYAI-EQCEMYKHEDLSVILDRLINKAYRFRSLCSHKAEVNVSFTDDFYLPRNYLDLSVDNVRMQNALRYGIQVDVRTYAGPVPSVSRD-GEWKIAYRKSNDTWTLQIYCHESALVGGEARVQAALIIANHEDQVVQVEES 408          

HSP 2 Score: 68.9366 bits (167), Expect = 2.127e-59
Identity = 39/87 (44.83%), Postives = 51/87 (58.62%), Query Frame = -2
Query: 1224 TLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRM-FDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFK 1481
             L DE  FI+ +   +  + +SDI LK+G+TKY+ HKF+L+ SSDV   M +D  W    TQ  G  E IVLEE  ECQ  F  F +
Sbjct:   42 VLRDESNFIQNVGQFYNQKDISDIILKIGKTKYYGHKFVLAKSSDVFRTMLYDKNW----TQ-AGLPE-IVLEETDECQAYFDTFLR 122          
BLAST of SMED30013385 vs. TrEMBL
Match: A0A0L8GU20 (BTB domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22027949mg PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.938e-58
Identity = 105/298 (35.23%), Postives = 166/298 (55.70%), Query Frame = -3
Query:  356 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFV--DFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKKAIKTPYFSN-DYSDWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDEVLNVAQTAP 1240
            F  FL++LY  EI    +  VG+LCLADKYNV SL++L T+YM  N+ SP + N+L WYSW K L  +++++ C  TI  N   ++  P+    +D DF+ ++L+SSS+VV  E+T+Y     WL   +      +  N +KL+  IRF  M    L++I E ++ S  P+ + ++  LI+KA+R+RSLC     +  +F+   Y PR+Y  L+VD       +RF   +D +    P  S     DWK+TYRK A++ ++     ++A      +    LI  N ++EV+ V Q+ P
Sbjct:  251 FNRFLRYLYTAEIKINPESAVGVLCLADKYNVASLKHLCTKYMVENTKSPKVQNALNWYSWAKALHLEDLIEQCAKTIAWNADNIIKSPEWL-TMDNDFVTDLLQSSSLVVTNEYTLYLALTHWLEHQETLKPNSYGENVQKLMSFIRFPQMLVSQLYDI-ENSEISKMPEYRTLMHHLISKAYRFRSLCPAQKELKVSFNEPFYIPRDYKELMVDSVRMHNTHRFGIQVDVRTYVGPVPSEIKEGDWKITYRKNADQWILQIFCHESALVQGEARVMSSLIVYNDDEEVIQVEQSTP 546          

HSP 2 Score: 69.707 bits (169), Expect = 2.938e-58
Identity = 38/86 (44.19%), Postives = 51/86 (59.30%), Query Frame = -2
Query: 1224 LSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRM-FDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFK 1478
            L DE  FI  ++  +  ESLSDI+L VG   YF HKF+L+ SSDV   M ++++WK  ST +      I L E+AECQ  F  F +
Sbjct:  177 LKDEGTFISNVSRFYNQESLSDIKLNVGNKVYFGHKFVLAKSSDVFRTMLYESRWKEKSTAS------IDLNESAECQAVFNRFLR 256          
BLAST of SMED30013385 vs. TrEMBL
Match: V3ZQJ0 (BTB domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_228487 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 7.784e-57
Identity = 113/304 (37.17%), Postives = 169/304 (55.59%), Query Frame = -3
Query:  341 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDN-PKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKKAIKTPYFS-NDYSDWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDEVLNV--AQTAPLSYNN 1240
            F  FLKFLY  EI    D  VG+LCLADKYNV SL+ L T+YM +N+ SP + N+L WYSW K L+  +++  C  TI  N   +L +P+  + +D DFL ++L +S +VV +E  ++     WL+ D H  + E ++K+LLPLIR+  M    L+EIE+     +N    +++L  LI+KA+R+RSLC     +  +F+   Y PRNY++L VD    +   RF   +D +    P  S N   +WK+TYRK  +   +     ++A      + Q  ++  N  D V+ V  A T   S NN
Sbjct:  128 FDRFLKFLYTAEININVDSAVGILCLADKYNVTSLKLLCTKYMVKNTRSPKVKNALNWYSWAKALNLGDLIDQCSKTIAWNTDLILKMPEWLD-MDFDFLKDLLSNSQLVVQEENCLFLALTSWLFCDQHKTNMEDHSKQLLPLIRYPQMQVSQLYEIEKLAKEDENYATFRELLLELISKAYRFRSLCPSQAELEVSFNQPFYLPRNYMSLTVDNVRMQNTLRFGIQVDVRTYVGPVPSENKEGEWKITYRKNQDSWTLQIYGHESAMINGEAEIQSSVVIYNEYDHVIQVDAAPTQICSRNN 430          

HSP 2 Score: 63.5438 bits (153), Expect = 7.784e-57
Identity = 36/86 (41.86%), Postives = 49/86 (56.98%), Query Frame = -2
Query: 1224 LSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRM-FDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFK 1478
            L DE  FI  ++  F  E+LSDI LK+ +  YFAHKF+L+ SS+V   M +D ++   S      S  I L E+ ECQ+ F  F K
Sbjct:   54 LRDEDNFILNVSQFFNQEALSDILLKIADNTYFAHKFVLAKSSEVFRTMLYDQRYTQAS------SPEIELNESIECQQYFDRFLK 133          
BLAST of SMED30013385 vs. TrEMBL
Match: A0A433U6L2 (BTB domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_002769 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.526e-56
Identity = 110/295 (37.29%), Postives = 169/295 (57.29%), Query Frame = -3
Query:  362 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKKAI--KTPYFSNDYSDWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDEVLNVAQT 1240
            F  FLKFLY  E+  + +  VG+LCLADKY+V SL++L T+YM  ++ SP + N+L+WYSW K L   E+++ C  TI  N + LL  P+ ++ +D DF+ ++L +  +VV +E T+++    WL S+DH  D+  +AK+LLPLIRF  M    L+ + EQ +   N +I+ +L+ LI KA+R+RSLC     I  +F    Y PRNYL+L VD    +   RF   +D +      P  S D  +WK+TYRK  +   +     ++A      + Q  LI  +    V+ V ++
Sbjct:  229 FDTFLKFLYTAEVSISMESAVGILCLADKYSVTSLKSLCTQYMVEHTRSPLVQNALQWYSWSKALHMDELIEQCSRTIAWNAEHLLASPE-WHHMDADFVNDLLRNGDLVVPRENTLFQGLLQWLDSEDHAEDYLQHAKQLLPLIRFPQMQVHELYAV-EQCELYQNEEIRPLLQQLINKAYRFRSLCPQQSEIDVSFTDDFYLPRNYLDLTVDTVRMQNTLRFGIQVDVRTYVGPVPSMSRD-GEWKITYRKSNDTWTLQIYCHESALVGGEARVQAALIVTSQEGSVVQVEES 520          

HSP 2 Score: 52.7582 bits (125), Expect = 8.526e-56
Identity = 35/94 (37.23%), Postives = 47/94 (50.00%), Query Frame = -2
Query: 1224 LSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRM-FDNKWKLGSTQNPGQS--------EMIVLEENAECQKSFFLFFK 1478
            L DE  FI+ +   +  + +SD+ LK+GE KYF HKF+L+ SS+V   M +   W        G S          I LEE  EC+K F  F K
Sbjct:  141 LKDESNFIQNVGQFYNMQDMSDVILKIGEEKYFGHKFVLAKSSEVFRTMLYSQSWTQRVASGGGDSTSGDHLGLPEIELEETEECRKHFDTFLK 234          
BLAST of SMED30013385 vs. Ensembl Cavefish
Match: btbd2b (BTB domain containing 2 [Source:NCBI gene;Acc:103031444])

HSP 1 Score: 54.299 bits (129), Expect = 6.341e-13
Identity = 47/181 (25.97%), Postives = 77/181 (42.54%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N       N+    +  ++ D  ++   C   I  N    L   + F  +D+D L  +LE  ++ V +E  ++     W  ++ H    +   +       K L LIRF +MT      IEE   F+  P    +L
Sbjct:  242 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNL---RADNAFMLLTQARLFDEPQLASLCLENIDKNTGDALAA-EGFTDIDLDTLVAVLERDTLGV-REVRLFGAAVRWAEAEAHRQQLQPTPENKRRVLGKALTLIRFPLMT------IEE---FAAGPAQSGIL 408          

HSP 2 Score: 39.2762 bits (90), Expect = 6.341e-13
Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = -2
Query: 1299 NYEETLSDEKGFIKKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1493
            N++ T S  K   ++ A LF NE LSD+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  166 NWQATKSTVK---ERFAFLFNNEVLSDVHFLVGKGLGVQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 231          
BLAST of SMED30013385 vs. Ensembl Cavefish
Match: btbd17b (BTB (POZ) domain containing 17b [Source:ZFIN;Acc:ZDB-GENE-091204-214])

HSP 1 Score: 67.781 bits (164), Expect = 1.221e-11
Identity = 56/234 (23.93%), Postives = 115/234 (49.15%), Query Frame = -3
Query:  611 KTRDNRK*LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN--SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLN 1300
            +TR N   L LK   +  + F  F+++LY G+I    D+ + L  LA KY++ +L+   T YM ++  S SP   + + WY +        +  +C + +  N   +L   + + ++  + L  +L+ S +V+  E  +Y+  + W+  +      ++ A+  L  +R+ M+ P +LF +++Q+      K  + +R L+    ++ +       +++ FD  C  + PRNYL+
Sbjct:  158 QTR-NSTNLVLKESADCASVFDKFIRYLYCGDISVRPDQAIPLHRLASKYHIWALQQGLTRYMTQHLSSDSP-TGHVVSWYQYAVQTGDITLRDSCLLYLSWNLSSVLQSAE-WRSISDELLLSLLQRSDLVLQSELELYDALEAWISQNQ---PADMTAESALRAVRYGMIPPQHLFRLQKQSAV--MLKYYESVRDLLFLTFQFHAASPVQ--LAKYFDVNCSLFMPRNYLS 381          
BLAST of SMED30013385 vs. Ensembl Cavefish
Match: btbd17a (BTB/POZ domain-containing protein 17 [Source:NCBI gene;Acc:103031243])

HSP 1 Score: 64.3142 bits (155), Expect = 1.401e-10
Identity = 54/219 (24.66%), Postives = 106/219 (48.40%), Query Frame = -3
Query:  614 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN----SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICS-NFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKK---VLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYL 1240
            F  F+++LY GE+    D+   L  LA KY V +L+    EYM +N    S S H++    WY +        + ++ ++   S N   +L     + A+  + L  +L  S +V+  E  +++  ++WL  +D      + A+  L  +R++M+ P  LF+++      ++P +++    +R L+  + ++ S       +++ FD  C  + PRNYL
Sbjct:  115 FEKFIRYLYCGELSVNLDQATALHKLAAKYGVANLQQGLAEYMSQNLAGASASGHVVG---WYEYAAAAGDAGL-RDTYLQFLSWNLSAVLQSAR-WPAIGAELLMALLRRSDLVLQSELELFQGLEVWLIRND---PDSLTAENALRAVRYAMIPPRELFQLQR-----NSPVLRRYHESVRDLLYLSFQFHSASPVQ--LAKFFDVNCSLFVPRNYL 318          
BLAST of SMED30013385 vs. Ensembl Cavefish
Match: btbd6a (BTB/POZ domain-containing protein 6-B-like [Source:NCBI gene;Acc:103036261])

HSP 1 Score: 41.9726 bits (97), Expect = 1.175e-7
Identity = 50/186 (26.88%), Postives = 76/186 (40.86%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESL-----RNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LK+LY+ EI    D V+  L  A KY V  L     R L T    RN+        L W S  ++ D  E+ + CW  I +  +  L   + F  +D   L  +L   ++ + KE ++      W  S+         A+       K L L+RF  M+      +EE   F+D P   ++L
Sbjct:  182 FLILLKYLYSDEIELEADTVLATLYAAKKYLVSPLAEACVRFLETGLEARNAC------ILLWQS--QLFDEPELTRRCWEVIDAQAEVALR-SEGFCQIDASTLESVLRRDTLNI-KEASVLRAVLKWTESECRRRGLNPTAQNKRAVLGKALYLLRFPAMS------LEE---FADGPAQSEIL 348          

HSP 2 Score: 33.4982 bits (75), Expect = 1.175e-7
Identity = 17/53 (32.08%), Postives = 26/53 (49.06%), Query Frame = -2
Query: 1299 AMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1445
            A +F NE ++D+   VG      +  AHK++L+  S V   MF      G T+
Sbjct:  119 AQMFNNEHMADVHFIVGPPGSSERVPAHKYVLAVGSSVFCAMFYGDLAEGDTE 171          
BLAST of SMED30013385 vs. Ensembl Cavefish
Match: ENSAMXT00000018852.2 (kelch-like protein 10 [Source:NCBI gene;Acc:103032605])

HSP 1 Score: 51.6026 bits (122), Expect = 1.311e-6
Identity = 41/182 (22.53%), Postives = 89/182 (48.90%), Query Frame = -3
Query:  707 FLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLP-DIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVN-AKKLLPLIRFSMMTPVNLFEIEEQNDF-----SDNPKIKKVLRALI 1231
             +++ Y  +   T+  VV LL  ADK +++ ++NL   ++++  + P   N +  + + ++  C ++ +  +  +  +F++++  P + F  L +  L +IL++S + V +E T++E   MW+   DH           LL  +R  +M P  + E   ++          P I +VL +L+
Sbjct:   74 IIEYAYCHKTDITSKNVVDLLIAADKLDIQGIKNLCCGFLQKQ-LCPE--NCISIWRFTELYSCHDLYQKAYSYMLQHFEEVILEPVENFLELTLSQLSDILDNSKLSVKQEETVFEAVMMWI---DHAPQLRSKYIPVLLQKVRVGLMNPDYVLEFVMKDPLVCSNQECQPIITRVLGSLL 249          
BLAST of SMED30013385 vs. Ensembl Sea Lamprey
Match: btbd2a (BTB (POZ) domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030829-3])

HSP 1 Score: 41.5874 bits (96), Expect = 1.794e-9
Identity = 44/181 (24.31%), Postives = 75/181 (41.44%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N  +    N+    +  ++ D  ++   C   I  N    +   + F  +D D L  +LE  ++ + +E  ++     W  ++          +       K L LIRF +MT      IEE   F+  P    +L
Sbjct:  112 FLSLLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRAD---NAFMLLTQARLFDEPQLASLCLENIDKNTTDAINA-EGFTDIDQDTLVAVLERDTLGL-RESRLFSAVVRWSEAECQRQQLPSTPENKRQALGKALNLIRFPIMT------IEE---FAAGPAQSGIL 278          

HSP 2 Score: 37.7354 bits (86), Expect = 1.794e-9
Identity = 20/56 (35.71%), Postives = 30/56 (53.57%), Query Frame = -2
Query: 1299 KKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1454
            ++ A +F NE LSD+   VG+     +  AHKF+LS  S V   MF+      S++
Sbjct:   46 ERFAFMFNNEVLSDVHFLVGKGLGSQRIPAHKFVLSVGSAVFDAMFNGGMATTSSE 101          
BLAST of SMED30013385 vs. Ensembl Nematostella
Match: EDO45550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE5])

HSP 1 Score: 38.5058 bits (88), Expect = 1.150e-7
Identity = 37/158 (23.42%), Postives = 69/158 (43.67%), Query Frame = -3
Query:  788 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMT 1240
            F   L+FLY  E+    + V+  L  A KY + +L     +++K+N ++P   N+    S  ++ D  ++   C   I  N  + +   + F  +D D L  +L+  ++ + +E  ++     W   +        NA+       K L  IRF +MT
Sbjct:   83 FMALLRFLYTDEVQIGPETVMTTLYTAKKYAIPTLEKACVDFLKKN-LAPD--NAFMLLSQARLFDEPQLAALCLECIDKNTVEAVNA-EGFPDIDYDTLYVVLQRDTLAI-RESQLFTAVARWAEHECLRRRIPSNAENKRTALAKALYQIRFPLMT 235          

HSP 2 Score: 35.4242 bits (80), Expect = 1.150e-7
Identity = 19/47 (40.43%), Postives = 27/47 (57.45%), Query Frame = -2
Query: 1323 KIAMLFQNESLSDIQLKVGE----TKYFAHKFILSASSDVLSRMFDN 1451
            +I+ L+ NE LSD+   VG+     +  AHKF+LS  S V   MF+ 
Sbjct:   18 RISFLYNNEILSDVYFLVGKGPQRRRIPAHKFVLSIGSAVFDAMFNG 64          
BLAST of SMED30013385 vs. Ensembl Nematostella
Match: EDO39373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC2])

HSP 1 Score: 35.039 bits (79), Expect = 6.538e-6
Identity = 39/170 (22.94%), Postives = 73/170 (42.94%), Query Frame = -3
Query:  755 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYS--------DDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQN 1240
            F   L++LY  ++VFT   V+ +L L+ KY +  L     +Y++R      + + L     + M + + +   CW  +  +  K L   D F  +  + LC++L+  S+ +  E  ++     W            +     EV  + L+ LIR  +MT +   E+   N
Sbjct:   82 FQELLRYLYCDQVVFTGKNVLDVLYLSKKYIISHLIEKCWDYIERVIGYDDVFHVLP--KAITMGE-ERVQGICWELVDIDTAKCLA-SDAFLEVSKELLCDLLKRESLSI-PEVKLFRAVNRWAEKKVEEKGMLGNPKAKREVLGEDLIYLIRVPLMTAMEFVEVLSNN 246          

HSP 2 Score: 32.7278 bits (73), Expect = 6.538e-6
Identity = 20/53 (37.74%), Postives = 29/53 (54.72%), Query Frame = -2
Query: 1329 EKGFIK-KIAMLFQNESLSDIQLKVG-----ETKYFAHKFILSASSDVLSRMF 1469
            EK  IK ++  ++ N   SDI+  +      E ++ AHKF+LS SS V   MF
Sbjct:    9 EKTSIKERVHYMYSNSLFSDIEFLITKADGTEVRFPAHKFVLSVSSPVFEAMF 61          
BLAST of SMED30013385 vs. Ensembl Nematostella
Match: EDO34935 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMX0])

HSP 1 Score: 47.7506 bits (112), Expect = 8.770e-6
Identity = 46/165 (27.88%), Postives = 72/165 (43.64%), Query Frame = -3
Query:  749 FLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPL----IRFSMMTPVNLFEIEEQNDF 1231
             L F+YAG I  T   V  L+  ++   + SL++    +MK + ++P   N L   +     DC+ + K     I  NF  +    D F +L  D L E L S    VD+E  I+E  + W+  +      E   K L P     +RF +M+P  L +  E  + 
Sbjct:   69 LLNFIYAGTIKITPFNVKDLVSASNYLLMNSLKDACVSFMK-SMINPS--NCLGIETAANQFDCEALRKTANQYILDNFATVSQT-DEFKSLPADKLEEFLSSDETKVDREEQIFEALETWVSHN------EDERKPLFPRLIQHVRFPLMSPYYLADFVETKEL 223          
BLAST of SMED30013385 vs. Ensembl Medaka
Match: BTBD1 (BTB domain containing 1 [Source:NCBI gene;Acc:101157198])

HSP 1 Score: 53.5286 bits (127), Expect = 9.950e-13
Identity = 44/184 (23.91%), Postives = 84/184 (45.65%), Query Frame = -3
Query:  716 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLM--NSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLR 1240
            F   L+FLY+ E+    + V+  L  A KY V +L +   E++ +     HL   N+    +  ++ D  ++   C  TI  +    +   + F  +D+D LC +LE  ++ + +E  ++E    W  ++ +     + ++       K LPLIRF +MT      +EE    +  P++  + R
Sbjct:  133 FLALLRFLYSDEVHIGPETVMTTLYTAKKYAVPALESRCVEFLTK-----HLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTGDAINA-EGFTDIDLDTLCAVLERDTLSI-RENRLFEAVVRWAEAECYRQQLPLTSENKQRVLGKALPLIRFPLMT------VEEFAAVNPKPRVDYIDR 303          

HSP 2 Score: 39.2762 bits (90), Expect = 9.950e-13
Identity = 25/69 (36.23%), Postives = 37/69 (53.62%), Query Frame = -2
Query: 1299 NYEETLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYF----AHKFILSASSDVLSRMFDNKWKLGSTQ 1493
            N++ T S  K   ++ A LF NE LSD++  VG+ +      AHKF+L+A S V   MF+      S +
Sbjct:   57 NWQATKSSLK---ERFAFLFNNELLSDVRFIVGKGRQAQRIPAHKFVLAAGSAVFDAMFNGGMATTSAE 122          
BLAST of SMED30013385 vs. Ensembl Medaka
Match: BTBD1 (BTB domain containing 1 [Source:NCBI gene;Acc:101157198])

HSP 1 Score: 53.1434 bits (126), Expect = 1.170e-12
Identity = 44/184 (23.91%), Postives = 84/184 (45.65%), Query Frame = -3
Query:  716 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLM--NSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLR 1240
            F   L+FLY+ E+    + V+  L  A KY V +L +   E++ +     HL   N+    +  ++ D  ++   C  TI  +    +   + F  +D+D LC +LE  ++ + +E  ++E    W  ++ +     + ++       K LPLIRF +MT      +EE    +  P++  + R
Sbjct:  133 FLALLRFLYSDEVHIGPETVMTTLYTAKKYAVPALESRCVEFLTK-----HLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTGDAINA-EGFTDIDLDTLCAVLERDTLSI-RENRLFEAVVRWAEAECYRQQLPLTSENKQRVLGKALPLIRFPLMT------VEEFAAVNPKPRVDYIDR 303          

HSP 2 Score: 39.2762 bits (90), Expect = 1.170e-12
Identity = 25/69 (36.23%), Postives = 37/69 (53.62%), Query Frame = -2
Query: 1299 NYEETLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYF----AHKFILSASSDVLSRMFDNKWKLGSTQ 1493
            N++ T S  K   ++ A LF NE LSD++  VG+ +      AHKF+L+A S V   MF+      S +
Sbjct:   57 NWQATKSSLK---ERFAFLFNNELLSDVRFIVGKGRQAQRIPAHKFVLAAGSAVFDAMFNGGMATTSAE 122          
BLAST of SMED30013385 vs. Ensembl Medaka
Match: btbd2b (BTB domain containing 2 [Source:NCBI gene;Acc:101162869])

HSP 1 Score: 53.5286 bits (127), Expect = 1.325e-12
Identity = 47/181 (25.97%), Postives = 78/181 (43.09%), Query Frame = -3
Query:  719 FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK-------KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL 1240
            F   LKFLY+ E+    + V+  L  A KY V +L     E++K+N  +    N+    +  ++ D  ++   C   I  N    L   + F  +D+D L  +LE  ++ V +E  ++     W  ++ H    +   +       K L LIRF +MT      IEE   F+  P    +L
Sbjct:  244 FLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRAD---NAFMLLTQARLFDEPQLASLCLENIDKNTGDALAA-EGFTDIDLDTLVAVLERDTLGV-REVRLFGAAVRWAEAEAHRQQLQSTPENKRKVLGKALTLIRFPLMT------IEE---FAAGPAQSNIL 410          

HSP 2 Score: 38.891 bits (89), Expect = 1.325e-12
Identity = 24/69 (34.78%), Postives = 36/69 (52.17%), Query Frame = -2
Query: 1299 NYEETLSDEKGFIKKIAMLFQNESLSDIQLKVGET----KYFAHKFILSASSDVLSRMFDNKWKLGSTQ 1493
            N++ T S  K   ++ A LF NE LSD+   VG+     +  AH+F+L+  S V   MF+      ST+
Sbjct:  168 NWQATKSTVK---ERFAFLFNNEVLSDVHFLVGKGMGVQRIPAHRFVLAVGSAVFDAMFNGGMATTSTE 233          
BLAST of SMED30013385 vs. Ensembl Medaka
Match: btbd17a (BTB domain containing 17 [Source:NCBI gene;Acc:101163694])

HSP 1 Score: 69.707 bits (169), Expect = 2.698e-12
Identity = 63/270 (23.33%), Postives = 119/270 (44.07%), Query Frame = -3
Query:  506 NRK*LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN----SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLNLVVD---RFNNKIANRFSNSLDKKAIKTPYFSNDYSDW 1288
            N   L L+   +    F  F+++LY GEI    D+   L  LA KY V SL+   T YM +N    S S H+ +   WY +    +   +  +C   +  N   +L   +    +    L  +L+ S +++  E  ++   + W+  ++      + A+  L  +R++MM P  LF ++ Q+      + ++ +R L+  ++++ S       +++ FD  C  + PRNYL+ V       NN   +  S S   +   + + +N    W
Sbjct:  102 NSSTLVLREGSDCAAVFDKFIRYLYCGEISLHPDQATALHKLATKYQVLSLQQGVTHYMTQNLARESRSGHVAS---WYEYALKAEDVTLRDSCLQYLAWNLSSVLQSGEWLT-ISSQLLMTLLQRSDLILQSEMELFAGLEAWILQNE---PDGLMAENALRAVRYAMMPPRELFRLQTQSTVL--ARYQESVRDLLYMSYQFHSASPLQ--MAKYFDVNCSLFVPRNYLSPVWGAPWAINNPTRDDRSTSFQTQLGPSSHDANKRVTW 360          
BLAST of SMED30013385 vs. Ensembl Medaka
Match: btbd17b (BTB/POZ domain-containing protein 17 [Source:NCBI gene;Acc:101170589])

HSP 1 Score: 66.6254 bits (161), Expect = 2.444e-11
Identity = 51/211 (24.17%), Postives = 105/211 (49.76%), Query Frame = -3
Query:  611 FLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRN--SVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSAC--YQPRNYLN 1231
            F+++LY G+I    D+ + L  LA KY+V  L+   T YM ++  S SP   + + WY++   +    +  +C + +  N   +L   + + ++  D L  +L+ S +++  E  ++E  ++W+  +          +  L  +R+ M+ P +LF +++Q+      K  + +R L+  A ++ S       +++ FD  C  + PRNYL+
Sbjct:  124 FIRYLYCGDISVRLDQAIFLHTLATKYHVWGLQQGLTHYMTQHLSSDSP-TGHVVSWYNYALKIGDTTLRDSCLLYLSWNLSSVLQSKE-WGSISEDLLLSLLQRSDLILQSELELFEALEVWVNLNQ---PVSATVETALRAVRYGMIPPYHLFRLQKQSLLLI--KYYESIRDLLYLAFQFHSASPIQ--LAKYFDVNCSIFTPRNYLS 325          
BLAST of SMED30013385 vs. Planmine SMEST
Match: SMESG000032700.1 (SMESG000032700.1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 300/328 (91.46%), Postives = 303/328 (92.38%), Query Frame = -3
Query:  293 LYLKRMQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKKAIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDEVLNVAQTAPLSYNNVVQESLELDFLGNENS 1276
            + L+     +  FFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKKAIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDE                 ESLELDFLGNENS
Sbjct:   56 IVLEENAECQKSFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGSISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKKAIKTPYFSNDYSDWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDE-----------------ESLELDFLGNENS 366          

HSP 2 Score: 146.362 bits (368), Expect = 4.546e-39
Identity = 71/73 (97.26%), Postives = 71/73 (97.26%), Query Frame = -2
Query: 1224 MLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFK 1442
            MLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENAECQKSFF F K
Sbjct:    1 MLFQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENAECQKSFFYFLK 73          
BLAST of SMED30013385 vs. Planmine SMEST
Match: SMESG000078467.1 (SMESG000078467.1)

HSP 1 Score: 37.3502 bits (85), Expect = 9.049e-7
Identity = 46/186 (24.73%), Postives = 81/186 (43.55%), Query Frame = -3
Query:  686 LKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYMKRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFNALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAK---KLLPLIRFSMMTPVNLFEIEEQNDFSDNPKIKKVL--RALITKAHRYR 1228
            L+++Y G IV TN+ V  LL  A+   +  L+     Y+ R  + P   N L    + ++ DC  + K        N + +L   + F  L    L ++++ + + +  E ++Y     W+Y        E  AK    LL  +R S ++   L +I      S+ P I++ L  R L+ +A  Y 
Sbjct:   96 LEYVYTGNIVVTNENVQELLPAANLTQLIGLKQACCIYLMRQ-IDPS--NVLGIRRFAEIHDCHLLEKFARKFAAHNMEAVLQQSEEFVQLSRSELRQLIKMTDLNIYTEESVYNAVIRWIYYSK-----ETRAKWLPHLLAKVRLSQLSIRFLTDI-----ISNEPLIRESLPCRDLVDEAKLYH 268          

HSP 2 Score: 34.6538 bits (78), Expect = 9.049e-7
Identity = 17/36 (47.22%), Postives = 24/36 (66.67%), Query Frame = -2
Query: 1329 FQNESLSDIQLKVGETKYFAHKFILSASSDVLSRMF 1436
             QN  L D+ LKV + ++ AHK +L+A+SD  S MF
Sbjct:   36 LQNR-LCDVVLKVQDKEFPAHKIVLAAASDFFSAMF 70          
The following BLAST results are available for this feature:
BLAST of SMED30013385 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTBD176.193e-1121.80BTB domain containing 17 [Source:HGNC Symbol;Acc:H... [more]
BTBD21.983e-1024.86BTB domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
BTBD14.173e-825.14BTB domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
BTBD17.666e-825.14BTB domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
KLHL71.762e-722.81kelch like family member 7 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30013385 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
W07A12.43.173e-1228.18pep chromosome:WBcel235:II:9146280:9152311:1 gene:... [more]
W07A12.43.239e-1228.18pep chromosome:WBcel235:II:9147952:9152311:1 gene:... [more]
W07A12.43.346e-1228.18pep chromosome:WBcel235:II:9148356:9152311:1 gene:... [more]
W07A12.44.575e-1228.65pep chromosome:WBcel235:II:9146261:9152311:1 gene:... [more]
tag-308.823e-1224.84pep chromosome:WBcel235:IV:11850950:11854946:-1 ge... [more]
back to top
BLAST of SMED30013385 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tango101.598e-1425.45gene:FBgn0030330 transcript:FBtr0332955[more]
Tango101.598e-1425.45gene:FBgn0030330 transcript:FBtr0073552[more]
Tango101.598e-1425.45gene:FBgn0030330 transcript:FBtr0073553[more]
KLHL184.294e-722.01gene:FBgn0037978 transcript:FBtr0082556[more]
KLHL184.294e-722.01gene:FBgn0037978 transcript:FBtr0335434[more]
back to top
BLAST of SMED30013385 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btbd17a2.184e-1524.79BTB (POZ) domain containing 17a [Source:ZFIN;Acc:Z... [more]
btbd2b9.483e-1325.97BTB (POZ) domain containing 2b [Source:ZFIN;Acc:ZD... [more]
btbd17b2.438e-1224.26BTB (POZ) domain containing 17b [Source:ZFIN;Acc:Z... [more]
btbd17b2.570e-1224.68BTB (POZ) domain containing 17b [Source:ZFIN;Acc:Z... [more]
btbd17b2.570e-1224.68BTB (POZ) domain containing 17b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30013385 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhdc7a5.284e-1127.07kelch domain containing 7A [Source:Xenbase;Acc:XB-... [more]
klhdc7a5.459e-1127.07kelch domain containing 7A [Source:Xenbase;Acc:XB-... [more]
klhdc7a7.306e-1127.07kelch domain containing 7A [Source:Xenbase;Acc:XB-... [more]
klhdc7a7.378e-1127.07kelch domain containing 7A [Source:Xenbase;Acc:XB-... [more]
klhdc7a1.041e-1027.07kelch domain containing 7A [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of SMED30013385 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Btbd176.155e-1120.75BTB (POZ) domain containing 17 [Source:MGI Symbol;... [more]
Btbd26.459e-1125.14BTB (POZ) domain containing 2 [Source:MGI Symbol;A... [more]
Btbd27.858e-1125.14BTB (POZ) domain containing 2 [Source:MGI Symbol;A... [more]
Btbd15.853e-825.14BTB (POZ) domain containing 1 [Source:MGI Symbol;A... [more]
Klhl78.269e-823.04kelch-like 7 [Source:MGI Symbol;Acc:MGI:1196453][more]
back to top
BLAST of SMED30013385 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6NE02|BTBDH_HUMAN2.974e-1021.80BTB/POZ domain-containing protein 17 OS=Homo sapie... [more]
sp|Q9DB72|BTBDH_MOUSE4.306e-1020.75BTB/POZ domain-containing protein 17 OS=Mus muscul... [more]
sp|Q9BX70|BTBD2_HUMAN8.711e-1024.86BTB/POZ domain-containing protein 2 OS=Homo sapien... [more]
sp|Q66KD0|BTBDH_XENTR1.985e-823.61BTB/POZ domain-containing protein 17 OS=Xenopus tr... [more]
sp|Q6GLJ1|BTBDH_XENLA2.616e-823.47BTB/POZ domain-containing protein 17 OS=Xenopus la... [more]
back to top
BLAST of SMED30013385 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6ZNM11.391e-5937.29BTB domain-containing protein OS=Arion vulgaris OX... [more]
A0A0B6ZN582.127e-5937.29BTB domain-containing protein OS=Arion vulgaris OX... [more]
A0A0L8GU202.938e-5835.23BTB domain-containing protein OS=Octopus bimaculoi... [more]
V3ZQJ07.784e-5737.17BTB domain-containing protein OS=Lottia gigantea O... [more]
A0A433U6L28.526e-5637.29BTB domain-containing protein OS=Elysia chlorotica... [more]
back to top
BLAST of SMED30013385 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btbd2b6.341e-1325.97BTB domain containing 2 [Source:NCBI gene;Acc:1030... [more]
btbd17b1.221e-1123.93BTB (POZ) domain containing 17b [Source:ZFIN;Acc:Z... [more]
btbd17a1.401e-1024.66BTB/POZ domain-containing protein 17 [Source:NCBI ... [more]
btbd6a1.175e-726.88BTB/POZ domain-containing protein 6-B-like [Source... [more]
ENSAMXT00000018852.21.311e-622.53kelch-like protein 10 [Source:NCBI gene;Acc:103032... [more]
back to top
BLAST of SMED30013385 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
btbd2a1.794e-924.31BTB (POZ) domain containing 2a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30013385 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013385 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO455501.150e-723.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393736.538e-622.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349358.770e-627.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30013385 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTBD19.950e-1323.91BTB domain containing 1 [Source:NCBI gene;Acc:1011... [more]
BTBD11.170e-1223.91BTB domain containing 1 [Source:NCBI gene;Acc:1011... [more]
btbd2b1.325e-1225.97BTB domain containing 2 [Source:NCBI gene;Acc:1011... [more]
btbd17a2.698e-1223.33BTB domain containing 17 [Source:NCBI gene;Acc:101... [more]
btbd17b2.444e-1124.17BTB/POZ domain-containing protein 17 [Source:NCBI ... [more]
back to top
BLAST of SMED30013385 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000032700.14.546e-3991.46SMESG000032700.1[more]
SMESG000078467.19.049e-724.73SMESG000078467.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013385 ID=SMED30013385|Name=SMED30013385|organism=Schmidtea mediterranea sexual|type=transcript|length=1506bp
GTAGGTCATATATTTAAAACTATATAGATTATTTTAATAAAATTTACTGT
ATAGATTCATCGGGAAAACTTGCTACCGCTAGTGAGTGGAATTAGTAGCT
TATTGACTTTACCGCTATCTCGACAGTTTGCCCAGATAGCAAGCCGAATT
ATTTATTTCAATTTCACGGAATTTCATGACACAAGACGCCCTACAGCATA
CGATGATCACTGAGAGATAAATTAGTAATCAATTTTAATTTTTCAATTAA
TCAATTAATTAAAACTTTAATTAAAACTAAAATATGGTTAATGGAATTTT
CGTTGCCGAGAAAATCGAGCTCCAGCGATTCCTGAACAACATTATTATAC
GATAATGGAGCGGTTTGAGCCACATTTAGAACTTCATCGTTGCCATTTAT
TGCAATGAGCACAAACTGAAATTTCAATCCCAAATAAAATCCCGCCGCGT
CCACAACACGAAAAGTTACGACTAATTTCTCAGCCATTTTTCTATATGTT
AGCTTCCAATCTGAATAATCATTGCTGAAATATGGAGTTTTTATTGCTTT
TTTGTCTAATGAATTAGAAAATCGATTTGCTATTTTATTATTGAACCTAT
CAACAACGAGATTGAGGTAGTTTCTTGGTTGATAGCAAGCACTATCAAAT
GTCTCACTGATCGATCCATTAAACAAACATAATGAGCGATATCTATGAGC
TTTTGTTATTAACGCTCGAAGAACTTTTTTGATTTTCGGATTGTCTGAAA
AATCGTTTTGTTCTTCAATTTCAAATAAATTCACGGGTGTCATCATAGAA
AACCGAATCAACGGCAGCAATTTCTTTGCATTTACCTCAAAATCAACGAA
ATGATCGTCTGAATATAACCACATTTTGCACAGCTCATAAATAGTGAATT
CCTTATCCACGACAATGGAAGATGATTCAAGGATTTCGCATAAAAAATCT
ATGTCTAACGCATTGAAAATGTCGGGCAAATACAATAATTTTTGAAAATT
TGAGCAAATTGTTATCCAACAATTTTTTACGATTTCTTTGCAATCGAGCA
TTTTCACCCAGGAATACCATTTCAAAGAATTCATCAAATGCGGGCTAACC
GAGTTTCTTTTCATATATTCTGTTGCTAAATTACGTAATGACTCGACATT
GTATTTGTCGGCTAAACACAATAGACCAACAACTCTGTCGTTTGTGAATA
CAATTTCTCCAGCATATAAAAATTTTAAAAAATAAAAAAAAGGATTTTTG
ACATTCTGCATTCTCTTCAAGTACAATCATTTCCGATTGTCCCGGGTTTT
GTGTGCTACCTAATTTCCATTTATTGTCAAACATCCTTGATAAGACATCA
CTTGATGCAGATAATATAAATTTATGGGCAAAATATTTTGTCTCTCCAAC
TTTCAACTGAATATCACTCAATGATTCATTTTGAAAGAGCATTGCTATCT
TTTTTATAAATCCTTTTTCATCAGACAACGTTTCTTCATAATTATTTTCT
ATCATA
back to top

protein sequence of SMED30013385-orf-1

>SMED30013385-orf-1 ID=SMED30013385-orf-1|Name=SMED30013385-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MIENNYEETLSDEKGFIKKIAMLFQNESLSDIQLKVGETKYFAHKFILSA
SSDVLSRMFDNKWKLGSTQNPGQSEMIVLEENAECQKSFFLFFKIFICWR
NCIHKRQSCWSIVFSRQIQCRVIT*
back to top

protein sequence of SMED30013385-orf-2

>SMED30013385-orf-2 ID=SMED30013385-orf-2|Name=SMED30013385-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
MQNVKNPFFYFLKFLYAGEIVFTNDRVVGLLCLADKYNVESLRNLATEYM
KRNSVSPHLMNSLKWYSWVKMLDCKEIVKNCWITICSNFQKLLYLPDIFN
ALDIDFLCEILESSSIVVDKEFTIYELCKMWLYSDDHFVDFEVNAKKLLP
LIRFSMMTPVNLFEIEEQNDFSDNPKIKKVLRALITKAHRYRSLCLFNGS
ISETFDSACYQPRNYLNLVVDRFNNKIANRFSNSLDKKAIKTPYFSNDYS
DWKLTYRKMAEKLVVTFRVVDAAGFYLGLKFQFVLIAINGNDEVLNVAQT
APLSYNNVVQESLELDFLGNENSINHILVLIKVLIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000210BTB/POZ_dom
IPR011333SKP1/BTB/POZ_sf
IPR011705BACK
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 26..119
e-value: 3.4E-7
score: 39.9
IPR000210BTB/POZ domainPFAMPF00651BTBcoord: 19..119
e-value: 1.0E-17
score: 64.4
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 26..101
score: 14.915
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 2..120
e-value: 4.4E-22
score: 80.5
NoneNo IPR availablePANTHERPTHR24410FAMILY NOT NAMEDcoord: 7..120
NoneNo IPR availablePANTHERPTHR24410:SF23HL07962Pcoord: 7..120
NoneNo IPR availableCDDcd18292BTB_POZ_BTBD17coord: 9..120
e-value: 9.03387E-38
score: 121.624
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 12..119