IQ motif containing G

Overview
NameIQ motif containing G
Smed IDSMED30013379
Length (bp)1282
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IQ motif containing G (SMED30013379) t-SNE clustered cells

Violin plots show distribution of expression levels for IQ motif containing G (SMED30013379) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IQ motif containing G (SMED30013379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IQ motif containing G (SMED30013379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013379

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013379h1SMcG0014806 dd_Smed_v4_7221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013379h1SMcG0014806 dd_Smed_v4_7221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013379h1SMcG0014806 dd_Smed_v4_7221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013379h1SMcG0014806 dd_Smed_v4_7221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013379h1SMcG0014806 dd_Smed_v4_7221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013379h1SMcG0014806 dd_Smed_v6_7221_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013379h1SMcG0014806 dd_Smed_v4_7221_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IQ motif containing G vs. Ensembl Human
Match: IQCG (IQ motif containing G [Source:HGNC Symbol;Acc:HGNC:25251])

HSP 1 Score: 137.887 bits (346), Expect = 1.083e-35
Identity = 115/361 (31.86%), Postives = 201/361 (55.68%), Query Frame = 1
Query:   64 SEAVALATALEDNVRQLNILGKIMPYSYVEQPDV-LDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
             + + ++  LED   QL+IL  IMP  Y  +  + +      +E   ++ + + +    + +     +G    E  H  +   + +   K    VF +      +T++ +KK+Q DR F  DV++ T +EL  + ++N+L + +  E   K    D+I  EE  RK+I  +++++  VK++   E+Q++NE IA+LKDQLQE KAK+++E +Y +   E Q+AQT K C +TE+ L  ++  L    + E R H E E +LR    K+E + ++W +KY+ DTE  +  L+ L ++K  DL  L +L +  +EYE V+++DRIEKE   +K +++ LE+ S +K+Q WWR    R+ +G +
Sbjct:   59 PDVLRISAVLEDTTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFN---KMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFYDIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQTQKKCNRTEELLVEEIEKLRMKTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKATKASDLAHLQDLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGF 416          
BLAST of IQ motif containing G vs. Ensembl Human
Match: IQCG (IQ motif containing G [Source:HGNC Symbol;Acc:HGNC:25251])

HSP 1 Score: 137.887 bits (346), Expect = 1.083e-35
Identity = 115/361 (31.86%), Postives = 201/361 (55.68%), Query Frame = 1
Query:   64 SEAVALATALEDNVRQLNILGKIMPYSYVEQPDV-LDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
             + + ++  LED   QL+IL  IMP  Y  +  + +      +E   ++ + + +    + +     +G    E  H  +   + +   K    VF +      +T++ +KK+Q DR F  DV++ T +EL  + ++N+L + +  E   K    D+I  EE  RK+I  +++++  VK++   E+Q++NE IA+LKDQLQE KAK+++E +Y +   E Q+AQT K C +TE+ L  ++  L    + E R H E E +LR    K+E + ++W +KY+ DTE  +  L+ L ++K  DL  L +L +  +EYE V+++DRIEKE   +K +++ LE+ S +K+Q WWR    R+ +G +
Sbjct:   59 PDVLRISAVLEDTTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFN---KMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFYDIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQTQKKCNRTEELLVEEIEKLRMKTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKATKASDLAHLQDLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGF 416          
BLAST of IQ motif containing G vs. Ensembl Human
Match: IQCG (IQ motif containing G [Source:HGNC Symbol;Acc:HGNC:25251])

HSP 1 Score: 82.4185 bits (202), Expect = 6.886e-17
Identity = 70/232 (30.17%), Postives = 123/232 (53.02%), Query Frame = 1
Query:   64 SEAVALATALEDNVRQLNILGKIMPYSY-VEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQT 756
             + + ++  LED   QL+IL  IMP  Y   Q   +      +E   ++ + + +    + +     +G    E  H  +   + +   K    VF +      +T++ +KK+Q DR F  DV++ T +EL  + ++N+L + +  E   K    D+I  EE  RK+I  +++++  VK++   E+Q++NE IA+LKDQLQE KAK+++E +Y +   E Q+AQT K C +T
Sbjct:   59 PDVLRISAVLEDTTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFN---KMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFYDIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQTQKKCNRT 287          
BLAST of IQ motif containing G vs. Ensembl Zebrafish
Match: iqcg (IQ motif containing G [Source:NCBI gene;Acc:100322600])

HSP 1 Score: 109.383 bits (272), Expect = 3.183e-26
Identity = 111/363 (30.58%), Postives = 192/363 (52.89%), Query Frame = 1
Query:   46 MTVIYDSEAVALATALEDNVRQLNILGKIM-PYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQG 1131
            MT + +  A AL   L+D   QL++LG I+ P +  +Q   L +   ++                  +  SN  G L S+ +H+K                    +    L SDN+ KVQ+DR F+ DV++A  EEL +  +F +L   V  E   K +LLD+I  EE  R++IK++++++ ++++++ EE +   E +A LKDQ+Q+ + +T+ + K+ ++  E  V Q +K     E  L  ++  L   I+ E+ VH ETE++L+     ++ K +YW  +YE D E  ++ ++ L + ++    R+ +L++  K+ E VV++DRIEKE L  + EKE  E  ++ KIQ WWR    R+G
Sbjct:    1 MTSVEELRACAL---LQDCADQLSVLGNIIRPGAETQQRTELHLKTAQL---------------MAGSSLSNFSGELKSQ-KHFK--------------------IQQTLLASDNLAKVQKDRQFVSDVINALLEELQKKNNFQSLFSAVAEERKKKAELLDIINREEEGRRQIKKLQKQLLDIRKEKTEECERLEEEVAILKDQVQDMRVRTNQQGKFVKSCAEQLVYQESKHNSYKENELEDEVKMLQEKIEEEKNVHFETEAFLKQQHANLKQKLQYWIHRYEKDMEEKEQEITALQNKRNSSQTRIQDLSKKCKDMENVVIEDRIEKEHLRAQMEKEQREKNAATKIQAWWRGTLVRKG 324          
BLAST of IQ motif containing G vs. Ensembl Zebrafish
Match: iqcg (IQ motif containing G [Source:NCBI gene;Acc:100322600])

HSP 1 Score: 105.916 bits (263), Expect = 1.459e-25
Identity = 89/253 (35.18%), Postives = 154/253 (60.87%), Query Frame = 1
Query:  373 LTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQG 1131
            L SDN+ KVQ+DR F+ DV++A  EEL +  +F +L   V  E   K +LLD+I  EE  R++IK++++++ ++++++ EE +   E +A LKDQ+Q+ + +T+ + K+ ++  E  V Q +K     E  L  ++  L   I+ E+ VH ETE++L+     ++ K +YW  +YE D E  ++ ++ L + ++    R+ +L++  K+ E VV++DRIEKE L  + EKE  E  ++ KIQ WWR    R+G
Sbjct:    4 LASDNLAKVQKDRQFVSDVINALLEELQKKNNFQSLFSAVAEERKKKAELLDIINREEEGRRQIKKLQKQLLDIRKEKTEECERLEEEVAILKDQVQDMRVRTNQQGKFVKSCAEQLVYQESKHNSYKENELEDEVKMLQEKIEEEKNVHFETEAFLKQQHANLKQKLQYWIHRYEKDMEEKEQEITALQNKRNSSQTRIQDLSKKCKDMENVVIEDRIEKEHLRAQMEKEQREKNAATKIQAWWRGTLVRKG 256          
BLAST of IQ motif containing G vs. Ensembl Xenopus
Match: IQCG (IQ motif containing G [Source:NCBI gene;Acc:100379856])

HSP 1 Score: 140.198 bits (352), Expect = 6.373e-38
Identity = 98/265 (36.98%), Postives = 160/265 (60.38%), Query Frame = 1
Query:   67 EAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGL---LPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDY 852
            +A+   T LED++ QL++LG IMP SY  + D   I+  E+ +IL     +E +F+ ++ K +  +     L S+     KQ+++ S +LK +   F R +  +PLT+DN++KVQ DR F  DV++    EL  +GSF++L + V      K    + I  EE  RK+IK ++++++EVK+++  E+Q+R+E+IAHLKDQLQE KAKTS+E +Y +   +  ++QT + C   E  L  +L  +   +D E RVH E E++LR +
Sbjct:    7 DALRACTVLEDSLDQLSVLGNIMPVSYHGRSD---IVGNEIGKILKTQRQLEGKFEDLMGKRAEVRTTSFPLSSKMLDLTKQVEETSGNLKLTNEQFIRVVKQSPLTADNLRKVQADRQFAADVIAEMSMELESSGSFHSLQQAVALVKEEKANFYNAITREEDGRKKIKSLQKQIQEVKQEKELEMQSRSELIAHLKDQLQEMKAKTSIEGRYVKKDTDLLISQTQRKCGIAESELQTELQSVKEKMDEEIRVHMEIENFLRQH 268          
BLAST of IQ motif containing G vs. Ensembl Xenopus
Match: IQCG (IQ motif containing G [Source:NCBI gene;Acc:100379856])

HSP 1 Score: 135.576 bits (340), Expect = 2.053e-35
Identity = 102/282 (36.17%), Postives = 163/282 (57.80%), Query Frame = 1
Query:   67 EAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTE 912
            +A+   T LED++ QL++LG IMP SY          +G    ++    ++ T      T +  S  +L        KQ+++ S +LK +   F R +  +PLT+DN++KVQ DR F  DV++    EL  +GSF++L + V      K    + I  EE  RK+IK ++++++EVK+++  E+Q+R+E+IAHLKDQLQE KAKTS+E +Y +   +  ++QT + C   E  L  +   L   +D E RVH E E++LR +  ++E K +YW +KY+ DTE
Sbjct:   50 DALRACTVLEDSLDQLSVLGNIMPVSY----------HG--RNLMGKRAEVRT------TSFPLSSKML-----DLTKQVEETSGNLKLTNEQFIRVVKQSPLTADNLRKVQADRQFAADVIAEMSMELESSGSFHSLQQAVALVKEEKANFYNAITREEDGRKKIKSLQKQIQEVKQEKELEMQSRSELIAHLKDQLQEMKAKTSIEGRYVKKDTDLLISQTQRKCGIAESELQTE---LQEKMDEEIRVHMEIENFLRQHQQEMEQKLEYWMEKYDKDTE 305          
BLAST of IQ motif containing G vs. Ensembl Mouse
Match: Iqcg (IQ motif containing G [Source:MGI Symbol;Acc:MGI:1916957])

HSP 1 Score: 129.798 bits (325), Expect = 5.161e-33
Identity = 121/359 (33.70%), Postives = 204/359 (56.82%), Query Frame = 1
Query:   67 EAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            + + ++  +ED + QL+ILG I+P  Y  +  +    + E   ++       T    +LTK    K ++   AE+ K++ +D +         F +      +T + +KK+Q DR +  DV++    E+  +GSF +L K +  E + K    DVI  EE  RK+IK +++++ +VKR+   ++QN NE IAHL+DQLQE KAKT++E  Y +   E Q++QT K C + E+ L  ++  L    + E RVH E E +L+    K+E K ++W +K++ DTE  +  L+ L ++K  DL  L +L +  +EYE V+++DRIEKE+  +K E++ LE+ S +K+Q WWR    R+ +G +
Sbjct:   56 DVLRVSAVMEDVIDQLSILGYIIPVQYERRQSLTQKASHEGASMITTTPKKST---SLLTK---EKSMM---AEN-KQRGQDFT---------FKKPTKQTMMTLETLKKIQNDRQYFSDVIANAMMEMQDSGSFTSLLKALGKERDSKMNFHDVITREEKGRKQIKTLQKQLLDVKRERQMQVQNGNEYIAHLRDQLQEMKAKTNLENLYMKRNAELQISQTQKKCNRAEELLLEEIEKLRMKTEEENRVHTEIEMFLKKQQQKLEEKLEFWMEKFDKDTEAKQNELNALKAAKASDLVHLQDLAKMIREYEQVIIEDRIEKEKTRKKLEQDDLELRSIVKLQAWWRGSVVRKEIGNF 395          
BLAST of IQ motif containing G vs. UniProt/SwissProt
Match: sp|Q2T9V2|DRC9_BOVIN (Dynein regulatory complex protein 9 OS=Bos taurus OX=9913 GN=IQCG PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 8.519e-38
Identity = 134/370 (36.22%), Postives = 209/370 (56.49%), Query Frame = 1
Query:   43 IMTVIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLK-NSVH--VFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            IM  +   + + ++  LED   QL+IL  IMP  Y ++  +    N E        M +E R    +   SN   +        + ++ +I    + N V   +F +      + ++ +KK+Q DR FL DV++ T EEL + G+F NL K +  E   K    D I  EE  RK+IK +++++  VK++   E+QNRNE IAHLKDQLQE KAKT+ME +Y +   E Q++QT K C +TE+ L  ++  L    + E R+H E E +LR    K+E K ++W +K++ DTE  +  L+ L S+K  DL  L EL +T +EYE V+++DRIEKE+  +K+E++ LE+ S +K+Q WWR    R+ +G +
Sbjct:   50 IMKPLSILDVLRISAVLEDTTDQLSILNYIMPVQYEKRQSISMKDNKE--------MHLEGRSSEKVPLASNPSKISSPLVHKEEPKLPEIRQGGQFNKVQDLIFKKPTRQTIMNTETLKKIQIDRQFLSDVITETLEELQEEGTFTNLLKALGKERESKMHFYDTIAREENGRKKIKSLQKQLLNVKKERQAEVQNRNEYIAHLKDQLQEMKAKTNMENRYMKRNTELQISQTQKKCSKTEELLLEEIEKLRLKTEEENRIHAEIELFLRKEQQKLEEKLEFWMEKFDKDTEMKQNELNALKSAKASDLAHLQELAKTIREYEQVIIEDRIEKEKTRKKREQDDLEMRSIIKLQAWWRGTVVRREIGGF 411          
BLAST of IQ motif containing G vs. UniProt/SwissProt
Match: sp|Q9H095|DRC9_HUMAN (Dynein regulatory complex protein 9 OS=Homo sapiens OX=9606 GN=IQCG PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.199e-35
Identity = 115/361 (31.86%), Postives = 201/361 (55.68%), Query Frame = 1
Query:   64 SEAVALATALEDNVRQLNILGKIMPYSYVEQPDV-LDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
             + + ++  LED   QL+IL  IMP  Y  +  + +      +E   ++ + + +    + +     +G    E  H  +   + +   K    VF +      +T++ +KK+Q DR F  DV++ T +EL  + ++N+L + +  E   K    D+I  EE  RK+I  +++++  VK++   E+Q++NE IA+LKDQLQE KAK+++E +Y +   E Q+AQT K C +TE+ L  ++  L    + E R H E E +LR    K+E + ++W +KY+ DTE  +  L+ L ++K  DL  L +L +  +EYE V+++DRIEKE   +K +++ LE+ S +K+Q WWR    R+ +G +
Sbjct:   59 PDVLRISAVLEDTTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFN---KMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFYDIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQTQKKCNRTEELLVEEIEKLRMKTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKATKASDLAHLQDLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGF 416          
BLAST of IQ motif containing G vs. UniProt/SwissProt
Match: sp|Q9GKR7|DRC9_MACFA (Dynein regulatory complex protein 9 OS=Macaca fascicularis OX=9541 GN=IQCG PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 6.357e-35
Identity = 127/385 (32.99%), Postives = 217/385 (56.36%), Query Frame = 1
Query:   10 IIRILETR*YKIMTVIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDV------LDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDIST-DLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            I  ILETR       +   + + ++  LED   QL+IL  IMP  Y  +  V      +++    ++++ + +   +T    ++TK   S   LP   +  +  ++   T DL     +F +      +T++ +KK+Q DR F  DV++ T EEL  +G++N+L + +  E   K    DVI  EE  RK+I  +++++  VK++   E+Q++NE IA+LKDQLQE KAK+++E +Y +   E Q+AQT + C +TE+ L  ++  L    + E R+H + E +LR    K+E + ++W +KY+ DTE  +  L+ L ++K  DL  L +L +T +E E V+++DRIEKE+   K E++ LE+ S +K+Q WWR    R+ +G +
Sbjct:   46 IPEILETR-----EPLSLPDVLRISAVLEDTTDQLSILNYIMPIQYEGRQSVCVKSREMNLEGKNLDKLPVASTVTKTP-SPLITKERPS---LPEIRQGGQFAVEFCKTQDL-----LFKKPARQTIMTTETLKKIQIDRQFFSDVIADTIEELQDSGTYNSLLQALSKERENKMHFYDVIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQTQRKCNRTEEVLLEEIEKLRMKTEEEARIHMDIEMFLRKQQQKLEERLEFWMEKYDKDTEMKQNELNALKATKASDLAHLQDLAKTIRECEQVIIEDRIEKEKSKNKIEQDLLELKSVIKLQAWWRGTMIRREIGGF 416          
BLAST of IQ motif containing G vs. UniProt/SwissProt
Match: sp|Q80W32|DRC9_MOUSE (Dynein regulatory complex protein 9 OS=Mus musculus OX=10090 GN=Iqcg PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 3.610e-32
Identity = 121/359 (33.70%), Postives = 204/359 (56.82%), Query Frame = 1
Query:   67 EAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            + + ++  +ED + QL+ILG I+P  Y  +  +    + E   ++       T    +LTK    K ++   AE+ K++ +D +         F +      +T + +KK+Q DR +  DV++    E+  +GSF +L K +  E + K    DVI  EE  RK+IK +++++ +VKR+   ++QN NE IAHL+DQLQE KAKT++E  Y +   E Q++QT K C + E+ L  ++  L    + E RVH E E +L+    K+E K ++W +K++ DTE  +  L+ L ++K  DL  L +L +  +EYE V+++DRIEKE+  +K E++ LE+ S +K+Q WWR    R+ +G +
Sbjct:   56 DVLRVSAVMEDVIDQLSILGYIIPVQYERRQSLTQKASHEGASMITTTPKKST---SLLTK---EKSMM---AEN-KQRGQDFT---------FKKPTKQTMMTLETLKKIQNDRQYFSDVIANAMMEMQDSGSFTSLLKALGKERDSKMNFHDVITREEKGRKQIKTLQKQLLDVKRERQMQVQNGNEYIAHLRDQLQEMKAKTNLENLYMKRNAELQISQTQKKCNRAEELLLEEIEKLRMKTEEENRVHTEIEMFLKKQQQKLEEKLEFWMEKFDKDTEAKQNELNALKAAKASDLVHLQDLAKMIREYEQVIIEDRIEKEKTRKKLEQDDLELRSIVKLQAWWRGSVVRKEIGNF 395          
BLAST of IQ motif containing G vs. UniProt/SwissProt
Match: sp|Q5PQQ6|DRC9_RAT (Dynein regulatory complex protein 9 OS=Rattus norvegicus OX=10116 GN=Iqcg PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.879e-31
Identity = 119/361 (32.96%), Postives = 196/361 (54.29%), Query Frame = 1
Query:   79 LATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKG-LLPSEAEHYKKQI---KDISTDLKNSVH--VFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            ++  +ED + QL+ILG I+P  Y                          R Q +  K S+    ++PS  +     I   K + +D K       F +      +T + ++K+Q DR +  DV++    E+   GSF++L + +  E + K    DVI  E   RK+IK +++++ +VKR+   ++QN NE IAHL+DQLQE KAKT++E  Y +   E QV+QT K C + E+ L  ++  L    + E RVH E E +LR+   K+E K ++W +K++ DTE  +  L+ L ++K  DL  L +L +  +EYE V+++DR+EKE+  +K E++ LE+ S +K+Q WWR    R+ +G +
Sbjct:   59 VSAIMEDIIDQLSILGYIIPVQY-------------------------ERRQSLSQKTSHEGAPMVPSTPKISASLIAKDKPVVSDSKQRGQDFFFKKATKQTTMTLETMRKIQNDRQYFSDVIANAMMEMQACGSFSSLLEALGKERDAKMNFHDVITREGKGRKQIKSLQKQLVDVKRERQMQVQNGNEYIAHLRDQLQEVKAKTNLENLYMKRNTELQVSQTQKKCNRAEELLLEEIEKLRLKTEEENRVHMEIEMFLRNQQQKLEEKLEFWMEKFDKDTEAKQNELNALKAAKASDLAHLQDLAKMIREYEQVIIEDRLEKEKTRKKLEQDDLELRSIVKLQAWWRGTVVRREIGSF 394          
BLAST of IQ motif containing G vs. TrEMBL
Match: A0A267GPL7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016755g2 PE=4 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 6.458e-74
Identity = 164/364 (45.05%), Postives = 242/364 (66.48%), Query Frame = 1
Query:   52 VIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            ++  S+AV  AT LED V +LNILG IMPYSY  + + + +++ E+++++    DIE R+   +   +   G LP +    +++I   STDLK   ++ ++ M  NPLT DN++KVQEDR FL+ V+   Y+EL+++GSF +L + V +E + KQ+L  +I  EE SR RIKE++R++E++ +++  E+Q R EMIAHLKD  QETKAKT ME+KY    C   V QTA  C  +E  L  ++  L +  D E RV+ ETESWLR + D++E K   W  K + D E L+  L +L  SK KDL++L  LT+TYKEYE VV++DRIEKE+  R+KE+EA+E+ S+LKIQ W+RT+  ++ LGP+
Sbjct:    1 MLRGSQAVYAATVLEDCVDELNILGSIMPYSYESKHNAIQMVSDEIQDVIETQRDIEERYNQAMLARTGVLGCLPGDILEAQQEIMAASTDLKGGNNLMSKAMRQNPLTPDNLEKVQEDRNFLEQVMRIAYKELLESGSFESLQQAVASEEDKKQELQQIIVREENSRLRIKELRRQIEDIVKEKEAEVQARTEMIAHLKDVYQETKAKTGMEMKYVSKTCTVNVEQTANKCNLSEGQLREEIEQLKKFTDQETRVNAETESWLRTHCDQLEKKMDGWNSKLKQDVEDLQHRLDVLKQSKLKDLQKLETLTKTYKEYEAVVIEDRIEKEKERRRKEQEAIELGSALKIQSWFRTIMVQKSLGPF 364          
BLAST of IQ motif containing G vs. TrEMBL
Match: A0A267EGA3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016755g1 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 1.270e-73
Identity = 164/364 (45.05%), Postives = 241/364 (66.21%), Query Frame = 1
Query:   52 VIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            ++  S+AV  AT LED V +LNILG IMPYSY  + + + +++ E+++++    DIE R+   +   +   G LP +    +++I   STDLK   ++ ++ M  NPLT DN++KVQEDR FL+ V+   Y+EL+++GSF +L + V +E   KQ+L  +I  EE SR RIKE++R++E++ +++  E+Q R EMIAHLKD  QETKAKT ME+KY    C   V QTA  C  +E  L  ++  L +  D E RV+ ETESWLR + D++E K   W  K + D E L+  L +L  SK KDL++L  LT+TYKEYE VV++DRIEKE+  R+KE+EA+E+ S+LKIQ W+RT+  ++ LGP+
Sbjct:    1 MLRGSQAVYAATVLEDCVDELNILGSIMPYSYESKHNAIQMVSDEIQDVIETQRDIEERYNQAMLARTGVLGCLPGDILEAQQEIMAASTDLKGGNNLMSKAMRQNPLTPDNLEKVQEDRNFLEQVMRIAYKELLESGSFESLQQAVASEEEKKQELQQIIVREENSRLRIKELRRQIEDIVKEKEAEVQARTEMIAHLKDVYQETKAKTGMEMKYVSKTCTVNVEQTANKCNLSEGQLREEIEQLKKFTDQETRVNAETESWLRTHCDQLEKKMDGWNSKLKQDVEDLQHRLDVLKQSKLKDLQKLETLTKTYKEYEAVVIEDRIEKEKERRRKEQEAIELGSALKIQSWFRTIMVQKSLGPF 364          
BLAST of IQ motif containing G vs. TrEMBL
Match: V3ZC26 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_125731 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 1.756e-69
Identity = 158/361 (43.77%), Postives = 238/361 (65.93%), Query Frame = 1
Query:   67 EAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLL--PSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            +A+ +AT LED   QL+ILG+IMP+S+  +PD  +I++ +V ++  +   +E+R+Q VL +  + K     P +    +K +     DLKNS HVF R +  NPLT DNI K+Q+DR FL+ V+S +  EL+ N +F +L + V+ E   K  L + I+ EE  RKR++++++++ +VK+++  E+QNR EMIAHLKDQLQE KAKT+ME KY +   E  V QT K C  +E+ +  ++  L   ID E R + E ES+LR++   +E K  +W +KYE D E+ +  L +L +SK KDL+RL ELT+ YKEYE VV++DRIEKE++ RK E EA+E+  ++K+Q WWR +  R+G GPY
Sbjct:    6 DAIHVATVLEDCCDQLSILGRIMPHSFDMRPDAFEIVDNDVNQLADSQRQLESRYQSVLARKLDVKQFTQNPDKLAQIEKDVLHTGRDLKNSTHVFGRTLRQNPLTQDNIAKIQQDRSFLEVVMSESMSELIHNRTFQSLIEAVKLEKAKKAALQNTIQKEEDGRKRVRQLQKQLLDVKKEKESELQNREEMIAHLKDQLQEMKAKTNMEGKYIKKCAEVGVTQTQKRCYLSEKEMKDEIDNLQNQIDKETRANAEIESFLRNHHANLEKKLDFWQEKYEKDVESKQHELDVLKASKAKDLERLQELTKLYKEYEQVVVEDRIEKEKVRRKDELEAIELRGAIKVQAWWRGLMVRKGFGPY 366          
BLAST of IQ motif containing G vs. TrEMBL
Match: A0A210PTN5 (IQ domain-containing protein G OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20133 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 2.159e-69
Identity = 155/368 (42.12%), Postives = 241/368 (65.49%), Query Frame = 1
Query:   46 MTVIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAE--HYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            +T++  + A+ +AT LED V QL++LG+IMP +Y  + D ++++  E+ ++++   ++E ++Q +L+K  + +    + A+    ++++ D   DL+NS HVF R++  NPLTSDN  K+Q DR FL+ V S T  EL+QN SF  L + V  +   K +L D I  EE  RKR+K + ++++++K+++  E+Q RN MIAH KDQLQE KAKT+ME KYT+   E  VAQT K C  +E+ L  ++  L   ID E R + E ES+L+ + +++E K  YW  KY+ D E  +  L +L +SK KDL RL ELT+ YKEYE VV++DRIEKE+  RK ++E +E+ +++++Q WWR V  R+G GPY
Sbjct:    8 VTMLEGTSAIHVATILEDCVDQLSVLGRIMPAAYEGRFDAVELVQNELNQLVMGQKELELKYQTILSKKLDLRNTTKNAAKLSEVEQEVMDAGRDLRNSTHVFGRSLRQNPLTSDNTAKIQADRGFLEGVTSDTLSELIQNCSFQALMEAVRLQKERKARLQDTILKEENGRKRVKLLNKQLQDIKKEKEVELQQRNNMIAHYKDQLQEMKAKTNMEGKYTKKSAEVAVAQTQKRCHLSERELQTEIEQLKHKIDEENRCNIEIESYLKTHQEELEKKVDYWLTKYDKDVEAKQHELDVLKASKAKDLDRLQELTKQYKEYEQVVVEDRIEKEKARRKADQEGIELKAAIRVQAWWRGVMVRKGFGPY 375          
BLAST of IQ motif containing G vs. TrEMBL
Match: K1RDI3 (IQ domain-containing protein G OS=Crassostrea gigas OX=29159 GN=CGI_10028503 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.305e-67
Identity = 150/368 (40.76%), Postives = 237/368 (64.40%), Query Frame = 1
Query:   52 VIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTK----YSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            ++  ++A+ +AT LED V QL +LG+IMP S+  + D +++++ E+ +++    ++E R+Q +L K     S++K          +K++ +   DLKNS HVF R++  NPLT DN+ KVQEDR+F++  +S T  E +QN SF  L +TV  +   K +L + I  EE  RK +K + +++ ++++++  E+Q RN MIAH KDQLQE KAKT ME KY +   E  VAQT K C  +E+ +  ++  L   I+ E R + E E++LR + +++E K  +W +KYE D E  +  L +L +SK KDL +L ELT+ YKEYE VV++DRIEKE+  RK ++EA+E+ +++++Q WWR V  R+G GPY
Sbjct:    1 MLSGTDAIHIATVLEDCVDQLAVLGRIMPASFEARSDAVEMVSNELNQLVSGQKELELRYQTILAKKLDLMSSTKN--QDRLTEVEKEVIEAGADLKNSTHVFGRSLRQNPLTGDNMVKVQEDRMFVERCMSDTLSECIQNCSFQALAETVRTQKERKARLQETILKEENGRKHVKMLHKKLIDIQKEKEIELQQRNNMIAHFKDQLQEMKAKTDMEGKYLKKSAEVTVAQTQKKCTLSEKAMQDEIESLKHQIEEENRCNQEIENYLRAHQEELEKKVDFWMEKYEKDVEAKQHELDVLKASKAKDLDKLQELTKLYKEYEQVVVEDRIEKEKARRKADQEAIELRAAIRVQSWWRGVMVRKGFGPY 366          
BLAST of IQ motif containing G vs. Ensembl Cavefish
Match: iqcg (IQ domain-containing protein G-like [Source:NCBI gene;Acc:103036248])

HSP 1 Score: 92.0485 bits (227), Expect = 4.064e-20
Identity = 101/356 (28.37%), Postives = 165/356 (46.35%), Query Frame = 1
Query:   79 LATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENEL---NMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMI-AHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGL 1134
            +   LE    QL+ILG IMP +   +P   +     +  I+  +   E+  + V     N   L  SEA            +L  S +   R +  +  + +N+ KV+ DR F+  V+S    E+ ++G+F++L +  E E    + +  L D +  EEL      +  R+     ++E      R E I   L+ QLQ+   K ++E  Y  +  E  + Q  K+  Q EQ L  +   L   I+ E RV+ E ES+L+ Y   +E K  YW ++YE   E   + L+ L S +     +L  L +  +E E V+  D +EKE   ++ E++ LE  ++ KIQ WWR    R+GL
Sbjct:   13 VCAVLERCADQLDILGHIMPKNRRSRPGAEEAEAAHISVIIKQHQAAESHLKTVRKSRVNDSEL--SEA----------VEELHLSQNQLRRTLEESSSSHNNLAKVERDRQFVAKVISDLLAEIQESGTFHSLVQATEEERKKSDGEDHLHDTVIREEL----RIKALRKQLVDVQEEKTSELERLEGIKVELEQQLQQITLKKNIEKNYATSSAELLIYQGQKLANQKEQGLEEEKKMLQAKIEEEIRVYIENESFLKTYQTGLEEKLDYWMERYEKHIEAKDQELTSLKSQRANTRAQLHSLAKKCREMERVITDDHLEKENRRQQLERQQLEREAATKIQAWWRGTLVRRGL 352          
BLAST of IQ motif containing G vs. Ensembl Cavefish
Match: iqcg (IQ domain-containing protein G-like [Source:NCBI gene;Acc:103036248])

HSP 1 Score: 60.077 bits (144), Expect = 1.262e-9
Identity = 91/356 (25.56%), Postives = 152/356 (42.70%), Query Frame = 1
Query:   79 LATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENEL---NMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMI-AHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGL 1134
            +   LE    QL+ILG IMP +   +P   +     +  I+  +   E+  + V     N   L  SEA            +L  S +   R +  +  + +N+ KV+ DR F+  V+S    E+ ++G+F++L +  E E    + +  L D +  EEL      +  R+     ++E      R E I   L+ QLQ+   K ++E  Y  +  E  + Q  K+  Q EQ L  +   L+  +D                         YW ++YE   E   + L+ L S +     +L  L +  +E E V+  D +EKE   ++ E++ LE  ++ KIQ WWR    R+GL
Sbjct:   13 VCAVLERCADQLDILGHIMPKNRRSRPGAEEAEAAHISVIIKQHQAAESHLKTVRKSRVNDSEL--SEA----------VEELHLSQNQLRRTLEESSSSHNNLAKVERDRQFVAKVISDLLAEIQESGTFHSLVQATEEERKKSDGEDHLHDTVIREEL----RIKALRKQLVDVQEEKTSELERLEGIKVELEQQLQQITLKKNIEKNYATSSAELLIYQGQKLANQKEQGLEEEKKGLEEKLD-------------------------YWMERYEKHIEAKDQELTSLKSQRANTRAQLHSLAKKCREMERVITDDHLEKENRRQQLERQQLEREAATKIQAWWRGTLVRRGL 327          
BLAST of IQ motif containing G vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008638.1 (pep scaffold:Pmarinus_7.0:GL483451:6935:12453:1 gene:ENSPMAG00000007826.1 transcript:ENSPMAT00000008638.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 2.518e-13
Identity = 45/119 (37.82%), Postives = 76/119 (63.87%), Query Frame = 1
Query:  787 LDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            L   +DNE RVH + +++LR +   +  + ++W +KY+ D E  ++ L+ L ++   DL  L +L + Y E+E VV++DR+E+E   ++ E+E LE+  ++KIQ WWR V  R+GLG Y
Sbjct:    4 LGSELDNENRVHMDIDTFLRRHYADLSEQLEFWMEKYDHDLEAKQQELNNLKATHASDLAHLQDLARQYSEFEAVVIEDRLEREAERKRLEQEELELRCTVKIQAWWRGVMVRRGLGQY 122          
BLAST of IQ motif containing G vs. Ensembl Nematostella
Match: EDO39999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8J6])

HSP 1 Score: 213.001 bits (541), Expect = 5.599e-65
Identity = 154/367 (41.96%), Postives = 227/367 (61.85%), Query Frame = 1
Query:   67 EAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKY--------SNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            +AV ++  LED   QL ILG IMP +   + D   I++ E+ +IL +  D+E+R++ +L++         +NS  ++ S+A      +   +  L++      R+   NPLTSDN+ K+Q DR FLQ V+     E++ + SFN+L   V  E   K  L   I  EE SR+ +K ++R++ EVK+++  EIQ RNEMIAHLKDQLQE KAKTSME KY +   E +V+ T K CQQTE ++  +L  L   ID E+RV+NE E++L+ +   +E K +YW +KY+ D E  +  L +L +SK  DL RL ELTQ Y EYE VV++DR+EKE+  R+ E+EA E+ + +++Q WWR V  R+ LGPY
Sbjct:    6 DAVHISAILEDCADQLAILGHIMPSTLEGRTDAPQIVDDELGQILQDQRDLESRYESLLSQREDIKMRFTNNSSKVMESDA-----MVTSTARTLRDGAQALNRSFKQNPLTSDNLAKIQSDRKFLQGVVETALGEIVDHRSFNSLMNAVNTEKEKKAALQQTILKEEESRRLVKSLQRQLVEVKKEKESEIQQRNEMIAHLKDQLQEMKAKTSMEGKYIKKDAEVRVSCTQKKCQQTENSMKEELERLKFKIDEEERVNNEIEAYLKQHHQILEEKVEYWMEKYDRDVEQKQHELDVLKASKANDLARLQELTQKYTEYEKVVIEDRVEKEKARRQAEQEAEELKAIIRLQSWWRGVMVRRQLGPY 367          
BLAST of IQ motif containing G vs. Planmine SMEST
Match: SMESG000075453.1 (SMESG000075453.1)

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 363/366 (99.18%), Postives = 363/366 (99.18%), Query Frame = 1
Query:   46 MTVIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGPY 1143
            MTVIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDIS DLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSRKRIKEMKREVEEVKRQEMEEIQNRNEMIAHLKDQLQE KAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADL CLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETLKKNLSILSSSKDKDLKRLLELTQTYKEYELVVLKDRIEKEELLRKKEKEALEVASSLKIQCWWRTVCARQGLGPY
Sbjct:    1 MTVIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEEILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISNDLKNSVHVFTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSRKRIKEMKREVEEVKRQEMEEIQNRNEMIAHLKDQLQEAKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLACLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETLKKNLSILSSSKDKDLKRLLELTQTYKEYELVVLKDRIEKEELLRKKEKEALEVASSLKIQCWWRTVCARQGLGPY 366          
BLAST of IQ motif containing G vs. Planmine SMEST
Match: SMESG000055124.1 (SMESG000055124.1)

HSP 1 Score: 62.003 bits (149), Expect = 3.072e-10
Identity = 66/250 (26.40%), Postives = 117/250 (46.80%), Query Frame = 1
Query:  391 KKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVENELNMKQQLLDVIKNEELSXXXXXXXXXXXXXXXXXXXXXXXNRNEMIAHLKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDRTIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETXXXXXXXXXXXXXXXXXXXXXXTQTYKEYELVVLKDRIXXXXXXXXXXXXXXXVASSLKIQCWWRTVCARQGLGP 1140
            +KV+ED   +   +  T  E+ + G+F  L K V ++    +++  + K+++ S K I  +K E+   K    E+     ++I HLK Q QE   K  ME K+  A+ ++ V Q         + +  ++  ++ +I+ E+ V+ E   +LR+ +  +E   +YWT K+  + +  +  L  L     +    L  L   Y  YE V ++DR  K E  +    EA     +  IQ WWR +C    +GP
Sbjct:  133 RKVKEDLQVISSCIEQTLIEMEEKGNFEVLEKYVNDQKEALEKMKSLSKSDKESEKIIHSIKEEIANSKIDFDEKETEFLKLIRHLKHQKQELVQKNVMESKFMLAKTKSDVQQLKLQLDSMAEEVKDEIIQINNSIEREELVNTEISMYLRNNIQNMEQNIEYWTNKHAVENQKFQLRLRTLMKESQQLTHELESLVSKYVRYEKVCIEDRQMKAEKAKLDAIEAAHNDKAFMIQKWWRFICVMLSIGP 382          
The following BLAST results are available for this feature:
BLAST of IQ motif containing G vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
IQCG1.083e-3531.86IQ motif containing G [Source:HGNC Symbol;Acc:HGNC... [more]
IQCG1.083e-3531.86IQ motif containing G [Source:HGNC Symbol;Acc:HGNC... [more]
IQCG6.886e-1730.17IQ motif containing G [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of IQ motif containing G vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ motif containing G vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ motif containing G vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
iqcg3.183e-2630.58IQ motif containing G [Source:NCBI gene;Acc:100322... [more]
iqcg1.459e-2535.18IQ motif containing G [Source:NCBI gene;Acc:100322... [more]
back to top
BLAST of IQ motif containing G vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
IQCG6.373e-3836.98IQ motif containing G [Source:NCBI gene;Acc:100379... [more]
IQCG2.053e-3536.17IQ motif containing G [Source:NCBI gene;Acc:100379... [more]
back to top
BLAST of IQ motif containing G vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Iqcg5.161e-3333.70IQ motif containing G [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of IQ motif containing G vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2T9V2|DRC9_BOVIN8.519e-3836.22Dynein regulatory complex protein 9 OS=Bos taurus ... [more]
sp|Q9H095|DRC9_HUMAN5.199e-3531.86Dynein regulatory complex protein 9 OS=Homo sapien... [more]
sp|Q9GKR7|DRC9_MACFA6.357e-3532.99Dynein regulatory complex protein 9 OS=Macaca fasc... [more]
sp|Q80W32|DRC9_MOUSE3.610e-3233.70Dynein regulatory complex protein 9 OS=Mus musculu... [more]
sp|Q5PQQ6|DRC9_RAT2.879e-3132.96Dynein regulatory complex protein 9 OS=Rattus norv... [more]
back to top
BLAST of IQ motif containing G vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GPL76.458e-7445.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EGA31.270e-7345.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V3ZC261.756e-6943.77Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A210PTN52.159e-6942.12IQ domain-containing protein G OS=Mizuhopecten yes... [more]
K1RDI31.305e-6740.76IQ domain-containing protein G OS=Crassostrea giga... [more]
back to top
BLAST of IQ motif containing G vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
iqcg4.064e-2028.37IQ domain-containing protein G-like [Source:NCBI g... [more]
iqcg1.262e-925.56IQ domain-containing protein G-like [Source:NCBI g... [more]
back to top
BLAST of IQ motif containing G vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008638.12.518e-1337.82pep scaffold:Pmarinus_7.0:GL483451:6935:12453:1 ge... [more]
back to top
BLAST of IQ motif containing G vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ motif containing G vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO399995.599e-6541.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of IQ motif containing G vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ motif containing G vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000075453.10.000e+099.18SMESG000075453.1[more]
SMESG000055124.13.072e-1026.40SMESG000055124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013379 ID=SMED30013379|Name=IQ motif containing G|organism=Schmidtea mediterranea sexual|type=transcript|length=1282bp
TTTGTTTAAATAATACGTATCTTAGAAACTCGATAATACAAGATTATGAC
TGTAATATACGATTCTGAAGCTGTTGCTTTAGCTACAGCTTTAGAAGACA
ATGTTCGACAGCTTAATATTCTTGGTAAAATAATGCCTTATAGTTATGTT
GAGCAACCAGATGTGCTAGATATCTTAAATGGAGAGGTTGAAGAAATTCT
TATCAATAATATGGATATTGAAACAAGATTTCAGCATGTTTTAACGAAAT
ACAGCAATTCCAAAGGATTACTACCAAGTGAAGCTGAACATTATAAGAAG
CAAATTAAAGATATTTCAACTGATTTAAAGAATTCAGTTCATGTGTTTAC
TCGAAATATGAATCATAATCCTTTGACATCGGATAATATTAAGAAAGTTC
AAGAAGATAGATTATTTTTACAAGATGTGTTGTCAGCCACATATGAAGAA
CTAATGCAAAATGGTTCTTTTAATAATCTCACGAAAACTGTGGAGAATGA
ATTAAATATGAAGCAGCAATTGCTAGATGTTATCAAAAACGAAGAATTGA
GCCGCAAACGAATAAAAGAGATGAAAAGAGAAGTTGAAGAAGTCAAACGA
CAAGAAATGGAAGAGATCCAAAATCGAAATGAGATGATTGCTCATTTGAA
GGATCAATTGCAAGAGACAAAAGCTAAAACAAGCATGGAGTTGAAATACA
CACGAGCCAGATGTGAGACACAAGTGGCACAGACAGCCAAGATTTGTCAG
CAAACTGAACAAAATCTTCATGCCGATCTAACATGTCTAGATCGAACGAT
TGACAATGAACAGCGTGTGCACAATGAAACTGAAAGTTGGCTTCGAGATT
ATCTTGATAAAATTGAAGTTAAAACGAAATATTGGACGAAAAAATATGAA
ACCGATACCGAAACTCTGAAAAAGAATTTAAGCATTCTCAGCAGTAGCAA
AGACAAAGATTTGAAACGTCTGCTGGAATTAACACAAACTTATAAAGAAT
ACGAGCTTGTTGTCCTTAAAGATAGAATCGAAAAAGAAGAATTGCTACGA
AAGAAAGAAAAAGAAGCCCTAGAAGTGGCCTCGTCGTTGAAAATCCAATG
TTGGTGGAGAACAGTTTGTGCCCGTCAAGGCTTGGGTCCATATGGAAAGA
AAAAGAGAAAGGGTAAGAAAGGTAAAAAAGGAAAGAAAGGGAAGAAAGGA
AANANGAAANAANANNANNTNATTNNATNAANNNNNNCNTNNCGTGATAA
TTTTTTACTAATTAATAAATGATTTATTGTTG
back to top

protein sequence of SMED30013379-orf-1

>SMED30013379-orf-1 ID=SMED30013379-orf-1|Name=SMED30013379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MTVIYDSEAVALATALEDNVRQLNILGKIMPYSYVEQPDVLDILNGEVEE
ILINNMDIETRFQHVLTKYSNSKGLLPSEAEHYKKQIKDISTDLKNSVHV
FTRNMNHNPLTSDNIKKVQEDRLFLQDVLSATYEELMQNGSFNNLTKTVE
NELNMKQQLLDVIKNEELSRKRIKEMKREVEEVKRQEMEEIQNRNEMIAH
LKDQLQETKAKTSMELKYTRARCETQVAQTAKICQQTEQNLHADLTCLDR
TIDNEQRVHNETESWLRDYLDKIEVKTKYWTKKYETDTETLKKNLSILSS
SKDKDLKRLLELTQTYKEYELVVLKDRIEKEELLRKKEKEALEVASSLKI
QCWWRTVCARQGLGPYGKKKRKGKKGKKGKKGKKGXXKXXXXIXXXXXXR
DNFLLINK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0002177manchette
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0031514motile cilium
GO:0036126sperm flagellum
GO:0042995cell projection
Vocabulary: molecular function
TermDefinition
GO:0030544Hsp70 protein binding
GO:0005516calmodulin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042618IQCG
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
GO:0007286spermatid development
GO:0007288sperm axoneme assembly
GO:0030154cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 163..211
NoneNo IPR availableCOILSCoilCoilcoord: 321..341
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..385
IPR042618Dynein regulatory complex protein 9PANTHERPTHR14871FAMILY NOT NAMEDcoord: 9..383