Transmembrane protein 232

Overview
NameTransmembrane protein 232
Smed IDSMED30013374
Length (bp)1962
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 232 (SMED30013374) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 232 (SMED30013374) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 232 (SMED30013374) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 232 (SMED30013374) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013374

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013374SMESG000060638.1 SmedASXL_016363SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013374SMESG000060638.1 dd_Smed_v4_15138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013374SMESG000060638.1 dd_Smed_v4_15138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013374SMESG000060638.1 dd_Smed_v6_15138_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30013374SMESG000060638.1 OX_Smed_1.0.07084ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013374SMESG000060638.1 dd_Smed_v4_15138_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 232 vs. Ensembl Human
Match: TMEM232 (transmembrane protein 232 [Source:HGNC Symbol;Acc:HGNC:37270])

HSP 1 Score: 77.411 bits (189), Expect = 3.589e-14
Identity = 96/401 (23.94%), Postives = 168/401 (41.90%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFL-QTSEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDS-------LDEAETRNRNKVTDHNTSS-----LLWHCCDLWQCSFYSSQRSQIQKSVRSI--QQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINE--------EKICGYEKGTILLFSAIREFC 1259
            MPV K P+++  G IS     +L     + ++  +       K +  F IT+EF+ +FN       +  L+EL++   I ++C    KR++GL+       H++L  AWTE+  L+QC GE+ D+ L++L  SL  A          F++ E+ LY L   +   +      IK  +I  LV LR ++       E   ++L  L+ YL   +    ++ KYP +  +   I + S+ +              E + R + TD +        LLWHC   W C    +   Q+   +  +   +  +   C   W+D  L+  VL   A L  + L     ++     + + + N   + + D    + N          +IC Y   + L  +A+  FC
Sbjct:    3 MPVNKSPMINTCGGISSPYHEELWKLNFQHLSGERGH-----KSRPTFSITKEFILRFNQTQNSKEKEELLELAR--KIILRC----KRKLGLK-TLGSGRHVHLPAAWTEVIYLAQCKGEIQDESLNMLYASLDHASFDYDHLPALFFVAESVLYRLCCDASLKTYLYSVEIKLAKIGYLVFLRLFIFFLHGHLESFKQHLLRLQPYLYALSFSGASYHKYPNIFSNVQFILKASEIIGKRELRSESIFRPVEDKKRYENTDSDMGGYEINHLLWHCVAAWSC--VQNNSPQLNNVLEHLVFHKTQLQKKC---WLDSVLALLVLGEAAKLNMACLKALMDVVRDFVSSIMSVQNQEESCKVDDFSWAWNVVYIYTVILAEICLYAATSDLRKTALIGFC 386          
BLAST of Transmembrane protein 232 vs. Ensembl Human
Match: TMEM232 (transmembrane protein 232 [Source:HGNC Symbol;Acc:HGNC:37270])

HSP 1 Score: 62.7734 bits (151), Expect = 2.991e-10
Identity = 63/225 (28.00%), Postives = 107/225 (47.56%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFL-QTSEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEV 797
            MPV K P+++  G IS     +L     + ++  +       K +  F IT+EF+ +FN       +  L+EL++   I ++C    KR++GL+       H++L  AWTE+  L+QC GE+ D+ L++L  SL  A          F++ E+ LY L   +   +      IK  +I  LV LR ++       E   ++L  L+ YL   +    ++ KYP +
Sbjct:    3 MPVNKSPMINTCGGISSPYHEELWKLNFQHLSGERGH-----KSRPTFSITKEFILRFNQTQNSKEKEELLELAR--KIILRC----KRKLGLK-TLGSGRHVHLPAAWTEVIYLAQCKGEIQDESLNMLYASLDHASFDYDHLPALFFVAESVLYRLCCDASLKTYLYSVEIKLAKIGYLVFLRLFIFFLHGHLESFKQHLLRLQPYLYALSFSGASYHKYPNI 215          
BLAST of Transmembrane protein 232 vs. Ensembl Human
Match: TMEM232 (transmembrane protein 232 [Source:HGNC Symbol;Acc:HGNC:37270])

HSP 1 Score: 56.225 bits (134), Expect = 1.345e-8
Identity = 48/158 (30.38%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFL 599
            MPV K P+++  G IS     +L     + ++  +       K +  F IT+EF+ +FN       +  L+EL++   I ++C    KR++GL+       H++L  AWTE+  L+QC GE+ D+ L++L  SL  A          F++ E+ LY L
Sbjct:    3 MPVNKSPMINTCGGISSPYHEELWKLNFQHLSGERGH-----KSRPTFSITKEFILRFNQTQNSKEKEELLELAR--KIILRC----KRKLGLK-TLGSGRHVHLPAAWTEVIYLAQCKGEIQDESLNMLYASLDHASFDYDHLPALFFVAESVLYRL 148          
BLAST of Transmembrane protein 232 vs. Ensembl Human
Match: TMEM232 (transmembrane protein 232 [Source:HGNC Symbol;Acc:HGNC:37270])

HSP 1 Score: 53.1434 bits (126), Expect = 6.257e-8
Identity = 37/121 (30.58%), Postives = 62/121 (51.24%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGE 488
            MPV K P+++  G IS     +L     + ++  +       K +  F IT+EF+ +FN       +  L+EL++   I ++C    KR++GL+       H++L  AWTE+  L+QC GE
Sbjct:    3 MPVNKSPMINTCGGISSPYHEELWKLNFQHLSGERGH-----KSRPTFSITKEFILRFNQTQNSKEKEELLELAR--KIILRC----KRKLGLK-TLGSGRHVHLPAAWTEVIYLAQCKGE 111          
BLAST of Transmembrane protein 232 vs. Ensembl Zebrafish
Match: tmem232 (transmembrane protein 232 [Source:ZFIN;Acc:ZDB-GENE-070705-434])

HSP 1 Score: 91.6633 bits (226), Expect = 7.471e-19
Identity = 90/331 (27.19%), Postives = 158/331 (47.73%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVK-----KKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYP---EKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNE---CRKNFDKYPE----VAISFCVIEEVSKYLMDSLDEAETRNRNKVTDHNTSSLLWHCCDLWQC-SFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVA 1070
            MP+LK+P+ H  GI+S  Q  QL  R     +  K E   NV      K+N  E TE+F++K+N   ++G++    E  K +++A +   + KR  G      +  H++L  AWT+L +LS  NG + +  L+ L +SL  AP       V F+++E+  +FL ++   S+ P   EK  K LQ+  LV+LR ++    +++    + L N  IYL+   E   C   + ++P+    V +  CV E +    +   + A+     +  +   + +L  C   + C     +Q  Q+ K +  ++  L +     NW++C L   +L   A
Sbjct:    1 MPILKIPIKHHLGIVSQSQLEQLIKR-----HRKKKEETGNVTARKKIKRNPLETTEDFIEKYN--QVQGSK----EQEKYENLAKEFLCRWKRLAGFTAAAGKGKHVDLPRAWTQLVLLSLSNGNVRNDSLNALVVSLDHAPFNADQIPVLFHLVESVQHFLCSNTTLSEQPCSYEK--KMLQLGYLVSLRLFI---FQLTGMNEQELSN--IYLQRLKELLTCETRYQEFPDMLFAVQLMLCVWEVLCGLRLTEDNAAQVSVEAR--ELGVNQVLRQCLLSYHCVQNNGTQLPQVIKQLMLLRDKLQHD----NWVECGLGLMILGEAA 307          
BLAST of Transmembrane protein 232 vs. Ensembl Zebrafish
Match: tmem232 (transmembrane protein 232 [Source:ZFIN;Acc:ZDB-GENE-070705-434])

HSP 1 Score: 84.7297 bits (208), Expect = 1.042e-16
Identity = 90/331 (27.19%), Postives = 158/331 (47.73%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVK-----KKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYP---EKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNE---CRKNFDKYPE----VAISFCVIEEVSKYLMDSLDEAETRNRNKVTDHNTSSLLWHCCDLWQC-SFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVA 1070
            MP+LK+P+ H  GI+S  Q  QL  R     +  K E   NV      K+N  E TE+F++K+N   ++G++    E  K +++A +   + KR  G      +  H++L  AWT+L +LS  NG + +  L+ L +SL  AP       V F+++E+  +FL ++   S+ P   EK  K LQ+  LV+LR ++    +++    + L N  IYL+   E   C   + ++P+    V +  CV E +    +   + A+     +  +   + +L  C   + C     +Q  Q+ K +  ++  L +     NW++C L   +L   A
Sbjct:    1 MPILKIPIKHHLGIVSQSQLEQLIKR-----HRKKKEETGNVTARKKIKRNPLETTEDFIEKYN--QVQGSK----EQEKYENLAKEFLCRWKRLAGFTAAAGKGKHVDLPRAWTQLLLLSLSNGNVRNDSLNALVVSLDHAPFNADQIPVLFHLVESVQHFLCSNTTLSEQPCSYEK--KMLQLGYLVSLRLFI---FQLTGMNEQELSN--IYLQRLKELLTCETRYQEFPDMLFAVQLMLCVWEVLCGLRLTEDNAAQVSVEAR--ELGVNQVLRQCLLSYHCVQNNGTQLPQVIKQLMLLRDKLQHD----NWVECGLGLMILGEAA 307          
BLAST of Transmembrane protein 232 vs. Ensembl Mouse
Match: Tmem232 (transmembrane protein 232 [Source:MGI Symbol;Acc:MGI:2685786])

HSP 1 Score: 83.1889 bits (204), Expect = 4.015e-16
Identity = 104/408 (25.49%), Postives = 174/408 (42.65%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYPEK-HIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVA--ISF--------CVIEEVSKYLMDSLDEAETRNRN------KVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSI--QQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINEE----------KICGYEKGTILLFSAIREFCG 1262
            M   K PVV+KFG+IS     +L   + +  N  KS+     K K  F I++EF+ +FN         N  E  ++ + A +   + KR++GL+       H++L  AW E+  L+QC GE+ D+ L++L  SL             F++ E+ LY L    F   Y     IK ++I  L+ LR +V       E   ++L  L+ YL   +    ++ KYP +   + F        C  E  S+  ++S DE E    +          +  + LLWH    W C    + R Q+ + +  +   +  + + C   W+D  L+  VL   A L+ + L     ++    E N+ L   N  +  ++ D S   E          ++C Y   + L  +A+  FC 
Sbjct:    1 MKAYKPPVVNKFGVISSTYHEELLKSIFESSNRRKSQ-----KPKPSFSISKEFILRFNHTD------NPAEEEELLEQARRLIVRSKRKLGLK-TLGSGKHVHLPTAWAEVIYLAQCKGEIQDEALNMLHASLDHVSFDHDQLPALFFLAESVLYRLCCDAFMKGYLYSVEIKLVKIGYLIFLRLFVFFLHGHLESFKQHLLRLQPYLYALHFSEPSYYKYPNIISNVQFILKTSEIICKRELHSEPFVESPDETEDPYSDLNHLQLNKRGYEVNHLLWHSVAAWSC--VQNNRPQLTEVLEHLLFYKTQLQTKC---WLDSALALMVLGEAAKLDMACLKTLMDLVTDFLE-NI-LSAQNQEENYNIYDTSWASEIVFTYTTIIAEVCLYAATSDLRKTALIGFCA 389          
BLAST of Transmembrane protein 232 vs. Ensembl Mouse
Match: Tmem232 (transmembrane protein 232 [Source:MGI Symbol;Acc:MGI:2685786])

HSP 1 Score: 83.1889 bits (204), Expect = 4.015e-16
Identity = 104/408 (25.49%), Postives = 174/408 (42.65%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYPEK-HIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVA--ISF--------CVIEEVSKYLMDSLDEAETRNRN------KVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSI--QQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINEE----------KICGYEKGTILLFSAIREFCG 1262
            M   K PVV+KFG+IS     +L   + +  N  KS+     K K  F I++EF+ +FN         N  E  ++ + A +   + KR++GL+       H++L  AW E+  L+QC GE+ D+ L++L  SL             F++ E+ LY L    F   Y     IK ++I  L+ LR +V       E   ++L  L+ YL   +    ++ KYP +   + F        C  E  S+  ++S DE E    +          +  + LLWH    W C    + R Q+ + +  +   +  + + C   W+D  L+  VL   A L+ + L     ++    E N+ L   N  +  ++ D S   E          ++C Y   + L  +A+  FC 
Sbjct:    1 MKAYKPPVVNKFGVISSTYHEELLKSIFESSNRRKSQ-----KPKPSFSISKEFILRFNHTD------NPAEEEELLEQARRLIVRSKRKLGLK-TLGSGKHVHLPTAWAEVIYLAQCKGEIQDEALNMLHASLDHVSFDHDQLPALFFLAESVLYRLCCDAFMKGYLYSVEIKLVKIGYLIFLRLFVFFLHGHLESFKQHLLRLQPYLYALHFSEPSYYKYPNIISNVQFILKTSEIICKRELHSEPFVESPDETEDPYSDLNHLQLNKRGYEVNHLLWHSVAAWSC--VQNNRPQLTEVLEHLLFYKTQLQTKC---WLDSALALMVLGEAAKLDMACLKTLMDLVTDFLE-NI-LSAQNQEENYNIYDTSWASEIVFTYTTIIAEVCLYAATSDLRKTALIGFCA 389          
BLAST of Transmembrane protein 232 vs. Ensembl Mouse
Match: Tmem232 (transmembrane protein 232 [Source:MGI Symbol;Acc:MGI:2685786])

HSP 1 Score: 82.4185 bits (202), Expect = 7.628e-16
Identity = 102/408 (25.00%), Postives = 170/408 (41.67%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYPEK-HIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVA--ISF--------CVIEEVSKYLMDSLDEAETRNRN------KVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSI--QQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINEE----------KICGYEKGTILLFSAIREFCG 1262
            M   K PVV+KFG+IS     +L   + +  N  KS+     K K  F I++EF+ +FN         N  E  ++ + A +   + KR++GL+       H++L  AW E+  L+QC GE+ D    L      V+          F++ E+ LY L    F   Y     IK ++I  L+ LR +V       E   ++L  L+ YL   +    ++ KYP +   + F        C  E  S+  ++S DE E    +          +  + LLWH    W C    + R Q+ + +  +   +  + + C   W+D  L+  VL   A L+ + L     ++    E N+ L   N  +  ++ D S   E          ++C Y   + L  +A+  FC 
Sbjct:    1 MKAYKPPVVNKFGVISSTYHEELLKSIFESSNRRKSQ-----KPKPSFSISKEFILRFNHTD------NPAEEEELLEQARRLIVRSKRKLGLK-TLGSGKHVHLPTAWAEVIYLAQCKGEIQDALNMLHASLDHVS-FDHDQLPALFFLAESVLYRLCCDAFMKGYLYSVEIKLVKIGYLIFLRLFVFFLHGHLESFKQHLLRLQPYLYALHFSEPSYYKYPNIISNVQFILKTSEIICKRELHSEPFVESPDETEDPYSDLNHLQLNKRGYEVNHLLWHSVAAWSC--VQNNRPQLTEVLEHLLFYKTQLQTKC---WLDSALALMVLGEAAKLDMACLKTLMDLVTDFLE-NI-LSAQNQEENYNIYDTSWASEIVFTYTTIIAEVCLYAATSDLRKTALIGFCA 388          
BLAST of Transmembrane protein 232 vs. Ensembl Mouse
Match: Tmem232 (transmembrane protein 232 [Source:MGI Symbol;Acc:MGI:2685786])

HSP 1 Score: 65.0846 bits (157), Expect = 1.817e-10
Identity = 90/366 (24.59%), Postives = 154/366 (42.08%), Query Frame = 3
Query:  252 KKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYPEK-HIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVA--ISF--------CVIEEVSKYLMDSLDEAETRNRN------KVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSI--QQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINEE----------KICGYEKGTILLFSAIREFCG 1262
            KK   F I++EF+ +FN         N  E  ++ + A +   + KR++GL+       H++L  AW E+  L+QC GE+ D+ L++L  SL             F++ E+ LY L    F   Y     IK ++I  L+ LR +V       E   ++L  L+ YL   +    ++ KYP +   + F        C  E  S+  ++S DE E    +          +  + LLWH    W C    + R Q+ + +  +   +  + + C   W+D  L+  VL   A L+ + L     ++    E N+ L   N  +  ++ D S   E          ++C Y   + L  +A+  FC 
Sbjct:    4 KKWPSFSISKEFILRFNHTD------NPAEEEELLEQARRLIVRSKRKLGLK-TLGSGKHVHLPTAWAEVIYLAQCKGEIQDEALNMLHASLDHVSFDHDQLPALFFLAESVLYRLCCDAFMKGYLYSVEIKLVKIGYLIFLRLFVFFLHGHLESFKQHLLRLQPYLYALHFSEPSYYKYPNIISNVQFILKTSEIICKRELHSEPFVESPDETEDPYSDLNHLQLNKRGYEVNHLLWHSVAAWSC--VQNNRPQLTEVLEHLLFYKTQLQTKC---WLDSALALMVLGEAAKLDMACLKTLMDLVTDFLE-NI-LSAQNQEENYNIYDTSWASEIVFTYTTIIAEVCLYAATSDLRKTALIGFCA 355          
BLAST of Transmembrane protein 232 vs. UniProt/SwissProt
Match: sp|Q5K6N0|TM232_MOUSE (Transmembrane protein 232 OS=Mus musculus OX=10090 GN=Tmem232 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 2.809e-15
Identity = 104/408 (25.49%), Postives = 174/408 (42.65%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYPEK-HIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVA--ISF--------CVIEEVSKYLMDSLDEAETRNRN------KVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSI--QQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINEE----------KICGYEKGTILLFSAIREFCG 1262
            M   K PVV+KFG+IS     +L   + +  N  KS+     K K  F I++EF+ +FN         N  E  ++ + A +   + KR++GL+       H++L  AW E+  L+QC GE+ D+ L++L  SL             F++ E+ LY L    F   Y     IK ++I  L+ LR +V       E   ++L  L+ YL   +    ++ KYP +   + F        C  E  S+  ++S DE E    +          +  + LLWH    W C    + R Q+ + +  +   +  + + C   W+D  L+  VL   A L+ + L     ++    E N+ L   N  +  ++ D S   E          ++C Y   + L  +A+  FC 
Sbjct:    1 MKAYKPPVVNKFGVISSTYHEELLKSIFESSNRRKSQ-----KPKPSFSISKEFILRFNHTD------NPAEEEELLEQARRLIVRSKRKLGLK-TLGSGKHVHLPTAWAEVIYLAQCKGEIQDEALNMLHASLDHVSFDHDQLPALFFLAESVLYRLCCDAFMKGYLYSVEIKLVKIGYLIFLRLFVFFLHGHLESFKQHLLRLQPYLYALHFSEPSYYKYPNIISNVQFILKTSEIICKRELHSEPFVESPDETEDPYSDLNHLQLNKRGYEVNHLLWHSVAAWSC--VQNNRPQLTEVLEHLLFYKTQLQTKC---WLDSALALMVLGEAAKLDMACLKTLMDLVTDFLE-NI-LSAQNQEENYNIYDTSWASEIVFTYTTIIAEVCLYAATSDLRKTALIGFCA 389          
BLAST of Transmembrane protein 232 vs. UniProt/SwissProt
Match: sp|C9JQI7|TM232_HUMAN (Transmembrane protein 232 OS=Homo sapiens OX=9606 GN=TMEM232 PE=2 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 1.723e-13
Identity = 96/401 (23.94%), Postives = 168/401 (41.90%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFL-QTSEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDS-------LDEAETRNRNKVTDHNTSS-----LLWHCCDLWQCSFYSSQRSQIQKSVRSI--QQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINE--------EKICGYEKGTILLFSAIREFC 1259
            MPV K P+++  G IS     +L     + ++  +       K +  F IT+EF+ +FN       +  L+EL++   I ++C    KR++GL+       H++L  AWTE+  L+QC GE+ D+ L++L  SL  A          F++ E+ LY L   +   +      IK  +I  LV LR ++       E   ++L  L+ YL   +    ++ KYP +  +   I + S+ +              E + R + TD +        LLWHC   W C    +   Q+   +  +   +  +   C   W+D  L+  VL   A L  + L     ++     + + + N   + + D    + N          +IC Y   + L  +A+  FC
Sbjct:    3 MPVNKSPMINTCGGISSPYHEELWKLNFQHLSGERGH-----KSRPTFSITKEFILRFNQTQNSKEKEELLELAR--KIILRC----KRKLGLK-TLGSGRHVHLPAAWTEVIYLAQCKGEIQDESLNMLYASLDHASFDYDHLPALFFVAESVLYRLCCDASLKTYLYSVEIKLAKIGYLVFLRLFIFFLHGHLESFKQHLLRLQPYLYALSFSGASYHKYPNIFSNVQFILKASEIIGKRELRSESIFRPVEDKKRYENTDSDMGGYEINHLLWHCVAAWSC--VQNNSPQLNNVLEHLVFHKTQLQKKC---WLDSVLALLVLGEAAKLNMACLKALMDVVRDFVSSIMSVQNQEESCKVDDFSWAWNVVYIYTVILAEICLYAATSDLRKTALIGFC 386          
BLAST of Transmembrane protein 232 vs. UniProt/SwissProt
Match: sp|B1WBT0|TM232_RAT (Transmembrane protein 232 OS=Rattus norvegicus OX=10116 GN=Tmem232 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 6.124e-12
Identity = 84/311 (27.01%), Postives = 136/311 (43.73%), Query Frame = 3
Query:  252 KKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYPEK-HIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVI---------EEVSKYLMDSLDEAET--RNRNKVT----DHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSI--QQCLVNSPCFGNWIDCYLSFRVLANVASLE----KSGLDLFSSIILG 1118
            KK   F +T+EF+ +FN+   R  E  L+E  + +   ++C    KR++GL+       H++L  AW E+  L+QC GE+ D+ L++L  SL             F++ E+ LY L    F  +Y     IK ++I  L+ LR +V       E   ++L  L+ YL        ++ KYP +  S   I          E+   + +SL E E    + N V      +  + LLWH    W C      R Q+   +  I   +  + + C   W+D  L+  VL   A L     K+ +DL +  +L 
Sbjct:    4 KKWPSFSVTKEFILRFNNTDNRVKEEELLE--QARKFTVRC----KRKLGLK-TLGSGKHVHLPTAWAEVIYLAQCKGEIQDEALNMLYASLDHVSFDCDQLPTLFFLAESVLYRLCCDAFKKEYLYSVEIKLVKIGYLIFLRLFVFFLHGHLENFKQHLLRLQPYLYALYYSEPSYYKYPNILSSLQFILKTAEIICKRELHFEVFESLREVEDPFSDTNHVQLNKRGYEVNHLLWHSVAAWSC--VQDNRPQLNAVLDHILFHKAQLQTKC---WLDSALALLVLGEAAKLNMACLKTLMDLMTHFLLS 302          
BLAST of Transmembrane protein 232 vs. TrEMBL
Match: R7TJS3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_201911 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 7.612e-37
Identity = 112/364 (30.77%), Postives = 183/364 (50.27%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDIN-SSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKY-PEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMD---SLD----------------------EAETRNRNKVTD--HNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEA 1130
            MP+ ++P+VHKFGIISH QRL+LQ RL+K     S + +  ++  KN  E+TEEF+++FN     GTE N  E  KM+D+A K   +IKRR GL+   +   H+++ +AWTEL+ L+QC G++ + CLDLL  SL   PL+       F++ ET+LY+L+T      Y     +K L++ +LV  R +            +    L  YL  F + ++ ++ YP   +S   I +V K ++    S+D                      ++ET +   V+   H+ S  LWH  D+W+C  +    + +  ++ S+  C +      +W+D   +  VLA+ A ++   L     +  G   A
Sbjct:    1 MPIERIPIVHKFGIISHSQRLELQERLLKQSYLQSSAASRKSIASKNPLEVTEEFIQQFN-----GTE-NYEEKEKMEDVASKMLHRIKRRAGLKDGGKGS-HVDIPIAWTELSQLAQCKGKIQEDCLDLLITSLDQGPLEAVHIPALFFLAETALYWLRTDAIHQPYLRTGELKLLRMGQLVFTRLFFHHMTGHLHGHDDFKRRLHTYLDGFADSQEAYNPYPNALLSMRYIADVGKMIIGDCYSVDGDMKEGVGYEEPQELNETASDQQSETLHTGTVSSSVHDLSPTLWHALDVWRCVRHLG--NGLNNALSSLANCGMGL-ASESWVDGLCALLVLADAAKVDVKALRTLQQLAQGTPPA 354          
BLAST of Transmembrane protein 232 vs. TrEMBL
Match: A0A1I8J837 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 8.577e-37
Identity = 110/340 (32.35%), Postives = 159/340 (46.76%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQT-SEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYL----------MDSLDEA--------------ETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVA 1070
            MP+L +PVVHKFGIISH +RL+LQ RL++       E      KKN FE+T+ F+KK+NS +   TE    E    + +A    +   R  G+        H+NL  AWTEL  LS C G +    LD L +SL  AP+        FY+ ET LY+LQ+ S          +K L++ +   LR +            E+   L +YLKDF++    +  YP+VA     I  V K +          +D  DEA              E R+      H  S LLWH  D+W+C+ +      ++ ++  + +C V     GNWID YL+  ++ N A
Sbjct:    1 MPLLHLPVVHKFGIISHSRRLELQERLLQAALHDGKEKEGFQSKKNPFEVTDAFIKKYNS-AQSATEKAACEAEAQRLLARVRRRAGLRDGGVGQ------HVNLPFAWTELVFLSHCRGRVHQDALDTLVISLEQAPVGYYQIPALFYIAETVLYWLQSESPASDALRSAEVKSLRVGQATFLRLFYHHMTGQLRRHTESRSRLALYLKDFSQLAHLYAAYPDVAFCHSFIVAVGKVIAGQVSDDDKKVDETDEAAEAEPGAGGPAASSELRSLVTAEVHELSPLLWHALDVWRCARHLG--GDLEGALDGLLECSVGMAQQGNWIDTYLALLIVGNAA 331          
BLAST of Transmembrane protein 232 vs. TrEMBL
Match: V3ZU21 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_232123 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 2.961e-36
Identity = 112/353 (31.73%), Postives = 173/353 (49.01%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKD--INSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKY-PEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEV---------------------------------SKYLMDSLDEAETRNRNKVTD--HNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVA 1070
            MPV ++PVVHKFGIISH QRL+LQ RL+K   I    S+  A V  +N  E+ +EFV+ FN+        NL E  K +D+A K  ++ KRR G++     + H+NL +AWTEL  L+QC G+  ++CLD+L  SL ++PL++      F++ ET LY+L+T      Y     IK L++ +LV  R +        +   E  + L  YL   +EC++ ++ YP   +S   I EV                                 +K L D   EA T +   ++   H+ S  LWH  D+W+C+   S       ++ ++  C +      NW+D  ++  VL + A
Sbjct:    1 MPVTRLPVVHKFGIISHAQRLELQDRLLKQSTIQGIHSKKGAIVASRNPLEVCDEFVQHFNNAK------NLNEKEKFEDVARKMLERSKRRAGVRDGGTGK-HVNLPMAWTELAQLAQCKGKQQEECLDVLITSLEISPLERYHIPALFFLAETMLYWLRTESIHQPYLRTTEIKLLKMGQLVFTRLFYNHMAGQLQGHSEFKNRLFTYLDGLSECQEAYNPYPNALLSLRFIIEVGKIILADATINEAEFGKGGRLPPGRKVEELTHATKQLYDKRSEASTAHSAAISSSVHDLSPTLWHSLDVWRCTNQLS--GGTADALVALAHCGLGL-ATENWVDGTIALHVLGDAA 343          
BLAST of Transmembrane protein 232 vs. TrEMBL
Match: A0A267E638 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020786g1 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 8.741e-36
Identity = 110/340 (32.35%), Postives = 159/340 (46.76%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQT-SEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYL----------MDSLDEA--------------ETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVA 1070
            MP+L +PVVHKFGIISH +RL+LQ RL++       E      KKN FE+T+ F+KK+NS +   TE    E    + +A    +   R  G+        H+NL  AWTEL  LS C G +    LD L +SL  AP+        FY+ ET LY+LQ+ S          +K L++ +   LR +            E+   L +YLKDF++    +  YP+VA     I  V K +          +D  DEA              E R+      H  S LLWH  D+W+C+ +      ++ ++  + +C V     GNWID YL+  ++ N A
Sbjct:    1 MPLLHLPVVHKFGIISHSRRLELQERLLQAALHDGKEKEGFQSKKNPFEVTDAFIKKYNS-AQSATEKAACEAEAQRLLARVRRRAGLRDGGVGQ------HVNLPFAWTELVFLSHCRGRVHQDALDTLVISLEQAPVGYYQIPALFYIAETVLYWLQSESPASDALRSAEVKSLRVGQATFLRLFYHHMTGQLRRHTESRSRLALYLKDFSQLAHLYAAYPDVAFCHSFIVAVGKVIAGQVSDDDKKVDETDEAAEAEPGAGGPAASSELRSLVTAEVHELSPLLWHALDVWRCARHLG--GDLEGALDGLLECSVGMAQQGNWIDTYLALLIVGNAA 331          
BLAST of Transmembrane protein 232 vs. TrEMBL
Match: A0A267GDJ2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020786g2 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 3.292e-35
Identity = 109/340 (32.06%), Postives = 159/340 (46.76%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQT-SEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYL----------MDSLDEA--------------ETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVA 1070
            MP+L +PVVHKFGIISH +RL+LQ RL++       E      KKN FE+T+ F+KK+NS +   TE    E    + +A    +   R  G+        H+NL  AWTEL  L+ C G +    LD L +SL  AP+        FY+ ET LY+LQ+ S          +K L++ +   LR +            E+   L +YLKDF++    +  YP+VA     I  V K +          +D+ DEA              E R       H  S LLWH  D+W+C+ +      ++ ++  + +C V     GNWID YL+  ++ N A
Sbjct:    1 MPLLHLPVVHKFGIISHSRRLELQERLLQAALLDGKEKEGFQSKKNPFEVTDAFIKKYNS-AQSATEKTACEAEAQRLLARVRRRAGLRDGGVGQ------HVNLPFAWTELVFLAHCRGRVHQDALDTLVISLEQAPVGYYQIPALFYIAETVLYWLQSESPASDALRSAEVKSLRVGQATFLRLFYHHMTGQLRRHAESRSRLALYLKDFSQLAHLYAAYPDVAFCHSFIVAVGKVIAGQVSDDDKNVDATDEAAEAEPGAGGPAASSELRLLVTAEVHELSPLLWHALDVWRCARHLG--GDLEGALDGLLECSVGMAQQGNWIDTYLALLIVGNAA 331          
BLAST of Transmembrane protein 232 vs. Ensembl Nematostella
Match: EDO26989 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAI2])

HSP 1 Score: 64.6994 bits (156), Expect = 1.447e-11
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKM 353
            MP+ KVPVVHKFGIISH QR+ L+ RL +        N     K+ L E++++FV KFN  +    +T L   SKM
Sbjct:    1 MPIDKVPVVHKFGIISHSQRVSLEQRLEQKATVGNVPNTYARTKRLLSEVSDDFVAKFNDSNYDDQQTLLPTASKM 76          
BLAST of Transmembrane protein 232 vs. Ensembl Nematostella
Match: EDO42050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2I5])

HSP 1 Score: 63.929 bits (154), Expect = 7.678e-11
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 3
Query:  126 MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEITEEFVKKFNSLSIRGTETNLVELSKM 353
            MP+ KVPVVHKFGIISH QR+ L+ RL +        N     K+ L E++++FV KFN  +    +T L   SKM
Sbjct:    1 MPIDKVPVVHKFGIISHSQRVSLEQRLEQKATVGNVPNTYARTKRLLSEVSDDFVAKFNDSNYDDQQTLLPTASKM 76          
BLAST of Transmembrane protein 232 vs. Ensembl Nematostella
Match: EDO42049 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2I4])

HSP 1 Score: 57.7658 bits (138), Expect = 1.111e-8
Identity = 67/310 (21.61%), Postives = 125/310 (40.32%), Query Frame = 3
Query:  366 MKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXV-APLQQSTFLVQFYMLETSLYFLQTSEFDSKY-PEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEV-------------------------------------------SKYLMDSLDEAETRNRNKVTDHNTSSLL----------WHCCDLWQCSFYSSQRSQIQKSVRSIQQC---LVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGL 1121
            MK F    RR+GL    E   H+N+  AW ELT+L+Q N     +    + ++    APL  S     FY+ ++ L++L+ S  +  +     +K L++  LV +R Y   +    +   E+  +LK YL+  +E +  +  +P   ++   I EV                                           S ++   L+E      N  +    SS+L          WH  D+W+    + + + + +++R +  C   L N     +W+D   +F +LA+ +S + + L  F ++  G+
Sbjct:    1 MKPFLAKWRRVGLSGRGEGN-HVNIPKAWAELTLLAQINNRGIQEESLEVLIASVTQAPLSTSHIPSLFYLAKSVLHWLRKSGLNQPFLRTGELKLLKMGHLVFIRLYHAHQTNNLQGHEEDRVSLKQYLEGVSEQQYIYKSFPGALLALRFITEVGYLICKGVKLPPDYPTRQETNQGGTSTGAASPAQSLGAKTNPHSLHMEKILEEEFNEYSNPPSQQRGSSVLECPREMSVTLWHVLDVWRS--LTHRGTGLNQAIRGLSICATGLANE----SWLDVSCAFLILAHASSNDLTILQTFQALASGV 303          
BLAST of Transmembrane protein 232 vs. Planmine SMEST
Match: SMESG000060638.1 (SMESG000060638.1)

HSP 1 Score: 976.082 bits (2522), Expect = 0.000e+0
Identity = 505/511 (98.83%), Postives = 508/511 (99.41%), Query Frame = 3
Query:  351 MKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDSLDEAETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINEEKICGYEKGTILLFSAIREFCGLPLLSKTSSAKEQSLSTIAEWVVHGQQDEPSVFSAREIAIIISRLKAILELLETDLVDSRILVIKNAIWSLLESVQRKKILSKEREIYLQYGKIISPTLFSRDLPCNPIFINERISAVLLDYIFPRRNNSAISQTITKPLRVNHLYLKTNIQPEITYPXXXXXXXXXXXXIYIRHCDSKLNKILQNCWAADLPDVERSIDEKIMETQ 1883
            MKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGELTDQCLDLLCLSLSVAPLQQSTFLVQFY+LETSLYFLQTSEFDSK PEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDSLDEAETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELV+LNNTDEADVLDPSINEEKICGYEKGTILLFSAIREFCGLPLLSKTSSAKEQSLSTIAEWVVHGQQDEPSVFSAREIAIIISRLKAILELLETDLVDSRILVIKNAIWSLLESVQRKKILSKEREIYLQYGKIISPTLFSRDLPCNPIFINERISAVLLDYIFPRRNNSAISQ ITKPLRVNHLYLKTNIQPEITYPEK VKESNNKKSIYIRHCDSKLNKILQ+CWAADLPDVERSIDEKIMETQ
Sbjct:    1 MKDIAMKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGELTDQCLDLLCLSLSVAPLQQSTFLVQFYLLETSLYFLQTSEFDSKSPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDSLDEAETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVHLNNTDEADVLDPSINEEKICGYEKGTILLFSAIREFCGLPLLSKTSSAKEQSLSTIAEWVVHGQQDEPSVFSAREIAIIISRLKAILELLETDLVDSRILVIKNAIWSLLESVQRKKILSKEREIYLQYGKIISPTLFSRDLPCNPIFINERISAVLLDYIFPRRNNSAISQIITKPLRVNHLYLKTNIQPEITYPEKKVKESNNKKSIYIRHCDSKLNKILQHCWAADLPDVERSIDEKIMETQ 511          
BLAST of Transmembrane protein 232 vs. Planmine SMEST
Match: SMESG000060638.1 (SMESG000060638.1)

HSP 1 Score: 965.681 bits (2495), Expect = 0.000e+0
Identity = 500/506 (98.81%), Postives = 503/506 (99.41%), Query Frame = 3
Query:  366 MKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGEXXXXXXXXXXXXXXVAPLQQSTFLVQFYMLETSLYFLQTSEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDSLDEAETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADVLDPSINEEKICGYEKGTILLFSAIREFCGLPLLSKTSSAKEQSLSTIAEWVVHGQQDEPSVFSAREIAIIISRLKAILELLETDLVDSRILVIKNAIWSLLESVQRKKILSKEREIYLQYGKIISPTLFSRDLPCNPIFINERISAVLLDYIFPRRNNSAISQTITKPLRVNHLYLKTNIQPEITYPXXXXXXXXXXXXIYIRHCDSKLNKILQNCWAADLPDVERSIDEKIMETQ 1883
            MKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGELTDQCLDLLCLSLSVAPLQQSTFLVQFY+LETSLYFLQTSEFDSK PEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDSLDEAETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELV+LNNTDEADVLDPSINEEKICGYEKGTILLFSAIREFCGLPLLSKTSSAKEQSLSTIAEWVVHGQQDEPSVFSAREIAIIISRLKAILELLETDLVDSRILVIKNAIWSLLESVQRKKILSKEREIYLQYGKIISPTLFSRDLPCNPIFINERISAVLLDYIFPRRNNSAISQ ITKPLRVNHLYLKTNIQPEITYPEK VKESNNKKSIYIRHCDSKLNKILQ+CWAADLPDVERSIDEKIMETQ
Sbjct:    1 MKCFQKIKRRIGLQHNCEEEPHINLALAWTELTILSQCNGELTDQCLDLLCLSLSVAPLQQSTFLVQFYLLETSLYFLQTSEFDSKSPEKHIKWLQISELVALRTYVQCRLRMSECKHENLHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDSLDEAETRNRNKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGNWIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVHLNNTDEADVLDPSINEEKICGYEKGTILLFSAIREFCGLPLLSKTSSAKEQSLSTIAEWVVHGQQDEPSVFSAREIAIIISRLKAILELLETDLVDSRILVIKNAIWSLLESVQRKKILSKEREIYLQYGKIISPTLFSRDLPCNPIFINERISAVLLDYIFPRRNNSAISQIITKPLRVNHLYLKTNIQPEITYPEKKVKESNNKKSIYIRHCDSKLNKILQHCWAADLPDVERSIDEKIMETQ 506          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 232 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TMEM2323.589e-1423.94transmembrane protein 232 [Source:HGNC Symbol;Acc:... [more]
TMEM2322.991e-1028.00transmembrane protein 232 [Source:HGNC Symbol;Acc:... [more]
TMEM2321.345e-830.38transmembrane protein 232 [Source:HGNC Symbol;Acc:... [more]
TMEM2326.257e-830.58transmembrane protein 232 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2327.471e-1927.19transmembrane protein 232 [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem2321.042e-1627.19transmembrane protein 232 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tmem2324.015e-1625.49transmembrane protein 232 [Source:MGI Symbol;Acc:M... [more]
Tmem2324.015e-1625.49transmembrane protein 232 [Source:MGI Symbol;Acc:M... [more]
Tmem2327.628e-1625.00transmembrane protein 232 [Source:MGI Symbol;Acc:M... [more]
Tmem2321.817e-1024.59transmembrane protein 232 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 232 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q5K6N0|TM232_MOUSE2.809e-1525.49Transmembrane protein 232 OS=Mus musculus OX=10090... [more]
sp|C9JQI7|TM232_HUMAN1.723e-1323.94Transmembrane protein 232 OS=Homo sapiens OX=9606 ... [more]
sp|B1WBT0|TM232_RAT6.124e-1227.01Transmembrane protein 232 OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Transmembrane protein 232 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TJS37.612e-3730.77Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8J8378.577e-3732.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V3ZU212.961e-3631.73Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A267E6388.741e-3632.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GDJ23.292e-3532.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO269891.447e-1144.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420507.678e-1144.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420491.111e-821.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 232 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 232 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000060638.10.000e+098.83SMESG000060638.1[more]
SMESG000060638.10.000e+098.81SMESG000060638.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013374 ID=SMED30013374|Name=Transmembrane protein 232|organism=Schmidtea mediterranea sexual|type=transcript|length=1962bp
AAAGTTATTTAATTAGTTGTTTTTATATATTAATATTAAATAATAATTTC
TGAAATCAGTTTTTTATCTTTTTACTATTATTAATTATTTATAAAGAATT
CATCATAAGATATAATATTTGTGAAATGCCAGTTCTCAAAGTACCAGTTG
TTCATAAATTCGGAATTATTTCTCACTGTCAAAGACTTCAATTACAATCA
CGGCTGATAAAAGATATTAATTCCTCGAAATCAGAAAATAACGCAAATGT
TAAGAAAAAAAATCTTTTTGAAATTACAGAGGAATTTGTGAAGAAATTCA
ATTCTCTTTCTATAAGGGGAACTGAAACGAATCTTGTCGAACTGAGTAAA
ATGAAAGATATTGCTATGAAATGCTTCCAAAAGATTAAGAGGCGCATTGG
ATTACAGCATAATTGTGAGGAGGAACCCCATATAAATCTCGCACTTGCTT
GGACAGAACTAACTATTCTCTCTCAGTGCAATGGAGAGTTGACTGATCAG
TGCTTAGATTTGCTATGTTTGAGTCTTTCCGTTGCTCCCCTGCAACAGTC
AACGTTTCTTGTCCAGTTTTACATGTTAGAAACTTCTCTCTATTTTCTCC
AAACTTCTGAATTCGATTCAAAATATCCAGAAAAACATATAAAATGGCTC
CAAATTAGTGAATTGGTCGCCCTCAGGACATATGTTCAATGCCGGCTGAG
AATGTCTGAATGCAAACATGAAAATTTGCACAATTTAAAAATATATTTAA
AAGACTTTAATGAATGCAGGAAAAACTTTGACAAATATCCTGAAGTTGCA
ATTTCATTTTGTGTGATTGAAGAAGTATCAAAATATTTGATGGACTCGTT
AGATGAAGCTGAAACCAGAAATCGAAACAAAGTAACAGACCATAACACGA
GCTCACTGTTGTGGCATTGTTGTGATTTGTGGCAATGCTCTTTTTATTCT
TCCCAGCGCTCACAAATACAGAAATCTGTTAGAAGCATTCAACAATGTCT
TGTTAATAGTCCTTGTTTTGGGAATTGGATAGATTGCTATTTATCCTTTC
GGGTCCTGGCAAATGTAGCTTCTCTGGAGAAATCAGGGCTCGATTTATTT
TCATCGATAATCTTGGGGCTTTCAGAAGCAAATTTAGAGTTGGTTAATTT
AAACAATACTGACGAAGCAGATGTTCTGGACCCTTCAATAAACGAGGAGA
AAATCTGTGGTTATGAAAAAGGAACTATATTACTGTTTTCAGCCATCCGG
GAATTCTGTGGGTTGCCTCTGTTGTCGAAAACATCCAGTGCAAAGGAGCA
GTCATTGTCTACTATTGCAGAATGGGTTGTGCATGGACAGCAAGATGAGC
CTAGTGTATTTTCCGCACGGGAAATTGCTATCATCATATCCAGGTTGAAG
GCAATTCTGGAATTGCTCGAAACTGATCTTGTCGATTCGAGGATCTTGGT
TATTAAAAATGCTATTTGGTCACTACTTGAATCAGTTCAACGAAAGAAAA
TTCTGAGTAAAGAAAGAGAAATTTATTTACAATATGGAAAAATTATATCT
CCGACTCTCTTTAGTAGAGATTTACCTTGCAATCCGATTTTCATTAATGA
ACGGATATCCGCAGTTTTATTGGATTACATATTTCCCCGCCGTAATAACT
CGGCAATTTCACAAACTATCACAAAACCACTCAGGGTCAATCATTTATAT
TTAAAAACTAATATACAGCCAGAAATAACTTATCCCGAAAAAAATGTCAA
GGAAAGCAACAATAAGAAGTCTATTTATATTCGGCATTGTGATTCGAAGT
TGAATAAAATTTTACAGAACTGCTGGGCTGCCGATTTACCAGATGTTGAA
AGGTCAATTGATGAAAAGATCATGGAGACTCAATAACTCCATAATTTTTG
TGAAAATGGAGGTCGGTTTGACAAACGTATAAATACAATTTTTGTCTTTG
TTTAAAAAAAAA
back to top

protein sequence of SMED30013374-orf-1

>SMED30013374-orf-1 ID=SMED30013374-orf-1|Name=SMED30013374-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=587bp
MPVLKVPVVHKFGIISHCQRLQLQSRLIKDINSSKSENNANVKKKNLFEI
TEEFVKKFNSLSIRGTETNLVELSKMKDIAMKCFQKIKRRIGLQHNCEEE
PHINLALAWTELTILSQCNGELTDQCLDLLCLSLSVAPLQQSTFLVQFYM
LETSLYFLQTSEFDSKYPEKHIKWLQISELVALRTYVQCRLRMSECKHEN
LHNLKIYLKDFNECRKNFDKYPEVAISFCVIEEVSKYLMDSLDEAETRNR
NKVTDHNTSSLLWHCCDLWQCSFYSSQRSQIQKSVRSIQQCLVNSPCFGN
WIDCYLSFRVLANVASLEKSGLDLFSSIILGLSEANLELVNLNNTDEADV
LDPSINEEKICGYEKGTILLFSAIREFCGLPLLSKTSSAKEQSLSTIAEW
VVHGQQDEPSVFSAREIAIIISRLKAILELLETDLVDSRILVIKNAIWSL
LESVQRKKILSKEREIYLQYGKIISPTLFSRDLPCNPIFINERISAVLLD
YIFPRRNNSAISQTITKPLRVNHLYLKTNIQPEITYPEKNVKESNNKKSI
YIRHCDSKLNKILQNCWAADLPDVERSIDEKIMETQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR031747TMEM232
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031747Transmembrane protein 232PFAMPF15877TMEM232coord: 2..253
e-value: 7.9E-26
score: 91.1
IPR031747Transmembrane protein 232PANTHERPTHR28651FAMILY NOT NAMEDcoord: 2..259