40S ribosomal protein S26

Overview
Name40S ribosomal protein S26
Smed IDSMED30013371
Length (bp)565
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein S26 (SMED30013371) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein S26 (SMED30013371) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein S26 (SMED30013371) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein S26 (SMED30013371) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013371

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013371SMESG000049997.1 SMESG000005227.1 SmedASXL_043738SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v4_222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013371SMESG000049997.1 SMESG000005227.1 OX_Smed_1.0.23537ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30013371SMESG000049997.1 SMESG000005227.1 dd_Smed_v6_222_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein S26 vs. Ensembl Human
Match: RPS26 (ribosomal protein S26 [Source:HGNC Symbol;Acc:HGNC:10414])

HSP 1 Score: 88.9669 bits (219), Expect = 1.334e-22
Identity = 61/84 (72.62%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ +Y LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Human
Match: RPS26 (ribosomal protein S26 [Source:HGNC Symbol;Acc:HGNC:10414])

HSP 1 Score: 88.9669 bits (219), Expect = 1.334e-22
Identity = 61/84 (72.62%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ +Y LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Human
Match: RPS26 (ribosomal protein S26 [Source:HGNC Symbol;Acc:HGNC:10414])

HSP 1 Score: 88.9669 bits (219), Expect = 1.334e-22
Identity = 61/84 (72.62%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ +Y LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Celegans
Match: rps-26 (40S ribosomal protein S26 [Source:UniProtKB/Swiss-Prot;Acc:O45499])

HSP 1 Score: 99.7525 bits (247), Expect = 3.319e-27
Identity = 68/84 (80.95%), Postives = 78/84 (92.86%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V FIRCTNCG+CCPKDK+IKKFVVRN+VEAAAVRD+ DAS Y+ Y LPKLY+K+HYCI+CAIH+KVVRNRSRE+RRDRNPP RF
Sbjct:   18 VAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHSKVVRNRSREARRDRNPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Celegans
Match: rps-26 (40S ribosomal protein S26 [Source:UniProtKB/Swiss-Prot;Acc:O45499])

HSP 1 Score: 99.7525 bits (247), Expect = 3.319e-27
Identity = 68/84 (80.95%), Postives = 78/84 (92.86%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V FIRCTNCG+CCPKDK+IKKFVVRN+VEAAAVRD+ DAS Y+ Y LPKLY+K+HYCI+CAIH+KVVRNRSRE+RRDRNPP RF
Sbjct:   18 VAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHSKVVRNRSREARRDRNPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Celegans
Match: rps-26 (40S ribosomal protein S26 [Source:UniProtKB/Swiss-Prot;Acc:O45499])

HSP 1 Score: 99.7525 bits (247), Expect = 3.319e-27
Identity = 68/84 (80.95%), Postives = 78/84 (92.86%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V FIRCTNCG+CCPKDK+IKKFVVRN+VEAAAVRD+ DAS Y+ Y LPKLY+K+HYCI+CAIH+KVVRNRSRE+RRDRNPP RF
Sbjct:   18 VAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHSKVVRNRSREARRDRNPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Fly
Match: RpS26 (gene:FBgn0261597 transcript:FBtr0331455)

HSP 1 Score: 89.7373 bits (221), Expect = 2.835e-23
Identity = 61/83 (73.49%), Postives = 74/83 (89.16%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPAR 403
            VK +RCTNC +C PKDK+IKKFV+RN+VEAAAVRD+T+AS++ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+RR R PP R
Sbjct:   18 VKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR 100          
BLAST of 40S ribosomal protein S26 vs. Ensembl Fly
Match: RpS26 (gene:FBgn0261597 transcript:FBtr0081091)

HSP 1 Score: 89.7373 bits (221), Expect = 2.835e-23
Identity = 61/83 (73.49%), Postives = 74/83 (89.16%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPAR 403
            VK +RCTNC +C PKDK+IKKFV+RN+VEAAAVRD+T+AS++ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+RR R PP R
Sbjct:   18 VKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR 100          
BLAST of 40S ribosomal protein S26 vs. Ensembl Fly
Match: RpS26 (gene:FBgn0261597 transcript:FBtr0346591)

HSP 1 Score: 89.7373 bits (221), Expect = 2.835e-23
Identity = 61/83 (73.49%), Postives = 74/83 (89.16%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPAR 403
            VK +RCTNC +C PKDK+IKKFV+RN+VEAAAVRD+T+AS++ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+RR R PP R
Sbjct:   18 VKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR 100          
BLAST of 40S ribosomal protein S26 vs. Ensembl Fly
Match: RpS26 (gene:FBgn0261597 transcript:FBtr0081089)

HSP 1 Score: 89.7373 bits (221), Expect = 2.835e-23
Identity = 61/83 (73.49%), Postives = 74/83 (89.16%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPAR 403
            VK +RCTNC +C PKDK+IKKFV+RN+VEAAAVRD+T+AS++ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+RR R PP R
Sbjct:   18 VKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR 100          
BLAST of 40S ribosomal protein S26 vs. Ensembl Fly
Match: RpS26 (gene:FBgn0261597 transcript:FBtr0081090)

HSP 1 Score: 89.7373 bits (221), Expect = 2.835e-23
Identity = 61/83 (73.49%), Postives = 74/83 (89.16%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPAR 403
            VK +RCTNC +C PKDK+IKKFV+RN+VEAAAVRD+T+AS++ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+RR R PP R
Sbjct:   18 VKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR 100          
BLAST of 40S ribosomal protein S26 vs. Ensembl Zebrafish
Match: rps26 (ribosomal protein S26 [Source:ZFIN;Acc:ZDB-GENE-030131-8606])

HSP 1 Score: 90.1225 bits (222), Expect = 3.292e-23
Identity = 63/87 (72.41%), Postives = 77/87 (88.51%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTRT 415
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF  T
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPT 104          
BLAST of 40S ribosomal protein S26 vs. Ensembl Zebrafish
Match: rps26l (ribosomal protein S26, like [Source:ZFIN;Acc:ZDB-GENE-040426-1706])

HSP 1 Score: 89.3521 bits (220), Expect = 5.229e-23
Identity = 62/84 (73.81%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Xenopus
Match: rps26 (ribosomal protein S26 [Source:NCBI gene;Acc:448703])

HSP 1 Score: 90.5077 bits (223), Expect = 2.919e-23
Identity = 62/84 (73.81%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYALPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Xenopus
Match: rps26 (ribosomal protein S26 [Source:NCBI gene;Acc:448703])

HSP 1 Score: 90.5077 bits (223), Expect = 3.748e-23
Identity = 62/84 (73.81%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   22 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYALPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 105          
BLAST of 40S ribosomal protein S26 vs. Ensembl Xenopus
Match: rps26 (ribosomal protein S26 [Source:NCBI gene;Acc:448703])

HSP 1 Score: 90.1225 bits (222), Expect = 3.910e-23
Identity = 62/84 (73.81%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYALPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Xenopus
Match: rps26 (ribosomal protein S26 [Source:NCBI gene;Acc:448703])

HSP 1 Score: 90.1225 bits (222), Expect = 6.119e-23
Identity = 62/84 (73.81%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   33 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYALPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 116          
BLAST of 40S ribosomal protein S26 vs. Ensembl Mouse
Match: Rps26 (ribosomal protein S26 [Source:MGI Symbol;Acc:MGI:1351628])

HSP 1 Score: 88.9669 bits (219), Expect = 9.158e-23
Identity = 61/84 (72.62%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ +Y LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. UniProt/SwissProt
Match: sp|O45499|RS26_CAEEL (40S ribosomal protein S26 OS=Caenorhabditis elegans OX=6239 GN=rps-26 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.222e-26
Identity = 68/84 (80.95%), Postives = 78/84 (92.86%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V FIRCTNCG+CCPKDK+IKKFVVRN+VEAAAVRD+ DAS Y+ Y LPKLY+K+HYCI+CAIH+KVVRNRSRE+RRDRNPP RF
Sbjct:   18 VAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHSKVVRNRSREARRDRNPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. UniProt/SwissProt
Match: sp|Q9GT45|RS26_ANOGA (40S ribosomal protein S26 OS=Anopheles gambiae OX=7165 GN=RpS26 PE=3 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.292e-24
Identity = 63/83 (75.90%), Postives = 75/83 (90.36%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPAR 403
            VK +RCTNC +C PKDK+IKKFV+RN+VEAAAVRD++DASVYSSY LPKLY K+HYC+SCAIH+KVVRNRS+E+RR R PP R
Sbjct:   18 VKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSCAIHSKVVRNRSKETRRIRTPPQR 100          
BLAST of 40S ribosomal protein S26 vs. UniProt/SwissProt
Match: sp|P49206|RS261_ARATH (40S ribosomal protein S26-1 OS=Arabidopsis thaliana OX=3702 GN=RPS26A PE=2 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 7.723e-24
Identity = 61/96 (63.54%), Postives = 75/96 (78.12%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTRTQKNVKPFGQ 442
            V  IRC+NCGKCCPKDK+IK+F+VRN+VE AA+RD+ +ASVY  Y LPKLY K  YC+SCAIH+ VVR RSR +RR R PP RFTR +++    GQ
Sbjct:   18 VNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPKPGQ 113          
BLAST of 40S ribosomal protein S26 vs. UniProt/SwissProt
Match: sp|Q9LYK9|RS263_ARATH (40S ribosomal protein S26-3 OS=Arabidopsis thaliana OX=3702 GN=RPS26C PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.111e-23
Identity = 59/91 (64.84%), Postives = 73/91 (80.22%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTRTQKNV 427
            VK IRC+NCGKCCPKDK+IK+F+VRN+VE AA+RD+ +ASVY  Y LPKLY K  YC+SCAIH+ VVR RSR +RR R PP RF R +++ 
Sbjct:   18 VKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDT 108          
BLAST of 40S ribosomal protein S26 vs. UniProt/SwissProt
Match: sp|Q8LPJ7|RS262_ARATH (40S ribosomal protein S26-2 OS=Arabidopsis thaliana OX=3702 GN=RPS26B PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 3.716e-23
Identity = 60/96 (62.50%), Postives = 74/96 (77.08%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTRTQKNVKPFGQ 442
            V  IRC+NCGKCCPKDK+IK+F+VRN+VE AA+RD+ +ASVY  Y LPKLY K  YC+SCAIH+ VVR RSR +RR R PP RF R +++    GQ
Sbjct:   18 VNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPGQ 113          
BLAST of 40S ribosomal protein S26 vs. TrEMBL
Match: A0A090LCX6 (40S ribosomal protein S26 OS=Strongyloides ratti OX=34506 GN=SRAE_2000229200 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 8.552e-26
Identity = 75/101 (74.26%), Postives = 88/101 (87.13%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF---TRTQKNVKPFGQTK 448
            VKF+RCTNCG+CCPKDK+IKK+VVRN+VEAAA+RD+ DASVY  Y LPKLY+K+HYC+SCAIH+KVVRNRSRE+RRDRNPP RF   T  QK V P GQT+
Sbjct:   18 VKFVRCTNCGRCCPKDKAIKKYVVRNIVEAAAIRDIVDASVYDQYALPKLYHKLHYCVSCAIHSKVVRNRSREARRDRNPPPRFGQRTTFQKPVAP-GQTR 117          
BLAST of 40S ribosomal protein S26 vs. TrEMBL
Match: A0A0K0EER7 (40S ribosomal protein S26 OS=Strongyloides stercoralis OX=6248 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 8.552e-26
Identity = 75/101 (74.26%), Postives = 88/101 (87.13%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF---TRTQKNVKPFGQTK 448
            VKF+RCTNCG+CCPKDK+IKK+VVRN+VEAAA+RD+ DASVY  Y LPKLY+K+HYC+SCAIH+KVVRNRSRE+RRDRNPP RF   T  QK V P GQT+
Sbjct:   18 VKFVRCTNCGRCCPKDKAIKKYVVRNIVEAAAIRDIVDASVYDQYALPKLYHKLHYCVSCAIHSKVVRNRSREARRDRNPPPRFGQRTTFQKPVAP-GQTR 117          
BLAST of 40S ribosomal protein S26 vs. TrEMBL
Match: A0A1I8D161 (40S ribosomal protein S26 OS=Rhabditophanes sp. KR3021 OX=114890 PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.805e-25
Identity = 69/93 (74.19%), Postives = 82/93 (88.17%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTRTQKNVKP 433
            VKF+RCTNCG+CCPKDK+IKK+VVRN+VEAAA+RD+TDASVY  Y LPKLY+K+HYC+SCAIH+KVVRNRSRE+RRDR PP RF +     KP
Sbjct:   18 VKFVRCTNCGRCCPKDKAIKKYVVRNIVEAAAIRDITDASVYDQYALPKLYHKLHYCVSCAIHSKVVRNRSREARRDRAPPPRFGQRTPFAKP 110          
BLAST of 40S ribosomal protein S26 vs. TrEMBL
Match: A0A2H2HUL1 (40S ribosomal protein S26 OS=Caenorhabditis japonica OX=281687 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.315e-25
Identity = 70/93 (75.27%), Postives = 82/93 (88.17%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTRTQKNVKP 433
            V FIRCTNCG+CCPKDK+IKKFVVRN+VEAAAVRD+ DAS Y+ Y LPKLY+K+HYCI+CAIH+KVVRNRSRE+RRDRNPP RF +   N +P
Sbjct:   18 VAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHSKVVRNRSREARRDRNPPPRFGQRTANARP 110          
BLAST of 40S ribosomal protein S26 vs. TrEMBL
Match: A0A0K0F8Y4 (40S ribosomal protein S26 OS=Strongyloides venezuelensis OX=75913 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.552e-25
Identity = 74/101 (73.27%), Postives = 88/101 (87.13%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF---TRTQKNVKPFGQTK 448
            VKF+RCTNCG+CCPKDK+IKK+VVRN+VEAAA+RD+ DASVY  Y LPKLY+K+HYC+SCAIH+KVVRNRSRE+RRDRNPP RF   T  QK V P GQ++
Sbjct:   18 VKFVRCTNCGRCCPKDKAIKKYVVRNIVEAAAIRDIVDASVYDQYALPKLYHKLHYCVSCAIHSKVVRNRSREARRDRNPPPRFGQRTTFQKPVAP-GQSR 117          
BLAST of 40S ribosomal protein S26 vs. Ensembl Cavefish
Match: rps26l (40S ribosomal protein S26 [Source:NCBI gene;Acc:103029414])

HSP 1 Score: 89.3521 bits (220), Expect = 4.432e-23
Identity = 62/84 (73.81%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Cavefish
Match: rps26 (40S ribosomal protein S26-like [Source:NCBI gene;Acc:103039794])

HSP 1 Score: 88.5817 bits (218), Expect = 1.015e-22
Identity = 61/84 (72.62%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ +Y LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Sea Lamprey
Match: rps26 (ribosomal protein S26 [Source:ZFIN;Acc:ZDB-GENE-030131-8606])

HSP 1 Score: 90.5077 bits (223), Expect = 3.586e-24
Identity = 61/84 (72.62%), Postives = 76/84 (90.48%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ +RCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+ SY LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFESYVLPKLYAKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 101          
BLAST of 40S ribosomal protein S26 vs. Ensembl Yeast
Match: RPS26B (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S26, no bacterial homolog; RPS26B has a paralog, RPS26A, that arose from the whole genome duplication; human homolog can partially complement an RPS26A, RPS26B double null mutant; mutations in the human gene are associated with Diamond-Blackfan anemia [Source:SGD;Acc:S000000933])

HSP 1 Score: 83.9593 bits (206), Expect = 8.394e-22
Identity = 59/100 (59.00%), Postives = 73/100 (73.00%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPA--RFTRTQKNVKPFGQTK 448
            VK +RC NC K  PKDK+IK+  +RN+VEAAAVRD+++ASVY  Y LPK YNK+HYC+SCAIH ++VR RSRE R++R PP   RF R  K V P    K
Sbjct:   18 VKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVRDLSEASVYPEYALPKTYNKLHYCVSCAIHARIVRVRSREDRKNRAPPQRPRFNRDNK-VSPAAAAK 116          
BLAST of 40S ribosomal protein S26 vs. Ensembl Yeast
Match: RPS26A (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S26, no bacterial homolog; RPS26A has a paralog, RPS26B, that arose from the whole genome duplication; human homolog can partially complement an RPS26A, RPS26B double null mutant; mutations in the human gene are associated with Diamond-Blackfan anemia [Source:SGD;Acc:S000003157])

HSP 1 Score: 83.1889 bits (204), Expect = 1.855e-21
Identity = 56/91 (61.54%), Postives = 70/91 (76.92%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPA--RFTRTQK 421
            VK +RC NC K  PKDK+IK+  +RN+VEAAAVRD+++ASVY  Y LPK YNK+HYC+SCAIH ++VR RSRE R++R PP   RF R  K
Sbjct:   18 VKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVRDLSEASVYPEYALPKTYNKLHYCVSCAIHARIVRVRSREDRKNRAPPQRPRFNRENK 108          
BLAST of 40S ribosomal protein S26 vs. Ensembl Nematostella
Match: EDO49378 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG86])

HSP 1 Score: 97.8265 bits (242), Expect = 1.020e-26
Identity = 64/86 (74.42%), Postives = 74/86 (86.05%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTR 412
            VKF+RCTNC +C PKDKSIKKFV+RN+VEAAAVRD+ DASVY  Y LPKLY K+HYC+SCAIH+KVVRNRS+E R+ R PP RF R
Sbjct:   18 VKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYEVYALPKLYVKLHYCVSCAIHSKVVRNRSKEDRKIRTPPPRFQR 103          
BLAST of 40S ribosomal protein S26 vs. Ensembl Medaka
Match: rps26 (ribosomal protein S26 [Source:NCBI gene;Acc:101158098])

HSP 1 Score: 83.1889 bits (204), Expect = 1.005e-20
Identity = 61/84 (72.62%), Postives = 75/84 (89.29%), Query Frame = 2
Query:  155 VKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARF 406
            V+ IRCTNC +C PKDK+IKKFV+RN+VEAAAVRD+++ASV+  Y LPKLY K+HYC+SCAIH+KVVRNRSRE+R+DR PP RF
Sbjct:   18 VQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFD-YVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF 100          
BLAST of 40S ribosomal protein S26 vs. Planmine SMEST
Match: SMESG000049997.1 (SMESG000049997.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.179e-50
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 2
Query:  104 MTCXXXXXXXXXXXXXXVKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTRTQKNVKPFGQTKPVKA 460
            MTCKRRNHGRNKKGRGHVKFIRCTNCGKCCPKDKSIKKFVVRNVVEAAAVRDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVRNRSRESRRDRNPPARFTRTQKNVKPFGQTKPVKA
Sbjct:    1 MTCKRRNHGRNKKGRGHVKFIRCTNCGKCCPKDKSIKKFVVRNVVEAAAVRDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVRNRSRESRRDRNPPARFTRTQKNVKPFGQTKPVKA 119          
BLAST of 40S ribosomal protein S26 vs. Planmine SMEST
Match: SMESG000005227.1 (SMESG000005227.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.179e-50
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 2
Query:  104 MTCXXXXXXXXXXXXXXVKFIRCTNCGKCCPKDKSIKKFXXXXXXXXXXXXDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVXXXXXXXXXXXXPPARFTRTQKNVKPFGQTKPVKA 460
            MTCKRRNHGRNKKGRGHVKFIRCTNCGKCCPKDKSIKKFVVRNVVEAAAVRDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVRNRSRESRRDRNPPARFTRTQKNVKPFGQTKPVKA
Sbjct:    1 MTCKRRNHGRNKKGRGHVKFIRCTNCGKCCPKDKSIKKFVVRNVVEAAAVRDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVRNRSRESRRDRNPPARFTRTQKNVKPFGQTKPVKA 119          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein S26 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RPS261.334e-2272.62ribosomal protein S26 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS261.334e-2272.62ribosomal protein S26 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS261.334e-2272.62ribosomal protein S26 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rps-263.319e-2780.9540S ribosomal protein S26 [Source:UniProtKB/Swiss... [more]
rps-263.319e-2780.9540S ribosomal protein S26 [Source:UniProtKB/Swiss... [more]
rps-263.319e-2780.9540S ribosomal protein S26 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpS262.835e-2373.49gene:FBgn0261597 transcript:FBtr0331455[more]
RpS262.835e-2373.49gene:FBgn0261597 transcript:FBtr0081091[more]
RpS262.835e-2373.49gene:FBgn0261597 transcript:FBtr0346591[more]
RpS262.835e-2373.49gene:FBgn0261597 transcript:FBtr0081089[more]
RpS262.835e-2373.49gene:FBgn0261597 transcript:FBtr0081090[more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps263.292e-2372.41ribosomal protein S26 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rps26l5.229e-2373.81ribosomal protein S26, like [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rps262.919e-2373.81ribosomal protein S26 [Source:NCBI gene;Acc:448703... [more]
rps263.748e-2373.81ribosomal protein S26 [Source:NCBI gene;Acc:448703... [more]
rps263.910e-2373.81ribosomal protein S26 [Source:NCBI gene;Acc:448703... [more]
rps266.119e-2373.81ribosomal protein S26 [Source:NCBI gene;Acc:448703... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rps269.158e-2372.62ribosomal protein S26 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O45499|RS26_CAEEL4.222e-2680.9540S ribosomal protein S26 OS=Caenorhabditis elegan... [more]
sp|Q9GT45|RS26_ANOGA1.292e-2475.9040S ribosomal protein S26 OS=Anopheles gambiae OX=... [more]
sp|P49206|RS261_ARATH7.723e-2463.5440S ribosomal protein S26-1 OS=Arabidopsis thalian... [more]
sp|Q9LYK9|RS263_ARATH3.111e-2364.8440S ribosomal protein S26-3 OS=Arabidopsis thalian... [more]
sp|Q8LPJ7|RS262_ARATH3.716e-2362.5040S ribosomal protein S26-2 OS=Arabidopsis thalian... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A090LCX68.552e-2674.2640S ribosomal protein S26 OS=Strongyloides ratti O... [more]
A0A0K0EER78.552e-2674.2640S ribosomal protein S26 OS=Strongyloides stercor... [more]
A0A1I8D1611.805e-2574.1940S ribosomal protein S26 OS=Rhabditophanes sp. KR... [more]
A0A2H2HUL12.315e-2575.2740S ribosomal protein S26 OS=Caenorhabditis japoni... [more]
A0A0K0F8Y42.552e-2573.2740S ribosomal protein S26 OS=Strongyloides venezue... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps26l4.432e-2373.8140S ribosomal protein S26 [Source:NCBI gene;Acc:10... [more]
rps261.015e-2272.6240S ribosomal protein S26-like [Source:NCBI gene;A... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps263.586e-2472.62ribosomal protein S26 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPS26B8.394e-2259.00Protein component of the small (40S) ribosomal sub... [more]
RPS26A1.855e-2161.54Protein component of the small (40S) ribosomal sub... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO493781.020e-2674.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps261.005e-2072.62ribosomal protein S26 [Source:NCBI gene;Acc:101158... [more]
back to top
BLAST of 40S ribosomal protein S26 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000049997.11.179e-50100.00SMESG000049997.1[more]
SMESG000005227.11.179e-50100.00SMESG000005227.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013371 ID=SMED30013371|Name=40S ribosomal protein S26|organism=Schmidtea mediterranea sexual|type=transcript|length=565bp
ATAAAATTGAGTTGTATAAAAATTTAAATTTCAAATAATCTTGGATAAAT
ATTGTTTAAATTATTGACATTTATTTAGAATAAAATATTTGAATCTAATA
AAAATGACTTGTAAACGAAGAAATCACGGACGTAACAAAAAGGGACGTGG
ACACGTCAAATTTATTCGATGCACAAACTGTGGTAAATGTTGCCCAAAAG
ATAAGTCTATCAAGAAATTTGTTGTTAGAAATGTTGTTGAAGCAGCAGCT
GTCAGAGATATGACTGACGCCAGTGTCTATTCAAGCTACCCATTACCAAA
ATTGTACAACAAAATGCACTACTGTATTTCATGTGCTATTCATAACAAAG
TAGTTAGAAATAGAAGCAGAGAATCAAGACGTGACAGAAATCCACCAGCT
CGATTTACCCGTACACAGAAAAATGTTAAGCCATTCGGACAAACCAAACC
TGTCAAGGCCTAATTTTTTCAATAAAATTTGGATTTAATTACTTTCATTG
AAATCTATACTTTATATTTTGTCTAGCGCTATTGAAATATATATAATTAT
TAGTTATATTTCAAT
back to top

protein sequence of SMED30013371-orf-1

>SMED30013371-orf-1 ID=SMED30013371-orf-1|Name=SMED30013371-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
MTCKRRNHGRNKKGRGHVKFIRCTNCGKCCPKDKSIKKFVVRNVVEAAAV
RDMTDASVYSSYPLPKLYNKMHYCISCAIHNKVVRNRSRESRRDRNPPAR
FTRTQKNVKPFGQTKPVKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008340determination of adult lifespan
GO:0006412translation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR038551Ribosomal_S26e_sf
IPR000892Ribosomal_S26e
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000892Ribosomal protein S26ePFAMPF01283Ribosomal_S26ecoord: 1..106
e-value: 6.3E-51
score: 171.3
IPR000892Ribosomal protein S26ePANTHERPTHR1253840S RIBOSOMAL PROTEIN S26coord: 1..111
IPR000892Ribosomal protein S26ePROSITEPS00733RIBOSOMAL_S26Ecoord: 73..80
IPR038551Ribosomal protein S26e superfamilyGENE3DG3DSA:3.30.1740.20coord: 1..107
e-value: 3.4E-50
score: 170.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 85..100
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 85..119