Deoxyribonuclease II

Overview
NameDeoxyribonuclease II
Smed IDSMED30013360
Length (bp)1387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Deoxyribonuclease II (SMED30013360) t-SNE clustered cells

Violin plots show distribution of expression levels for Deoxyribonuclease II (SMED30013360) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Deoxyribonuclease II (SMED30013360) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Deoxyribonuclease II (SMED30013360) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013360

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30013360SMESG000081053.1 SMESG000081051.1 dd_Smed_v4_1691_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013360SMESG000081053.1 SMESG000081051.1 dd_Smed_v6_1691_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Deoxyribonuclease II vs. Ensembl Human
Match: DNASE2 (deoxyribonuclease 2, lysosomal [Source:HGNC Symbol;Acc:HGNC:2960])

HSP 1 Score: 84.7297 bits (208), Expect = 2.507e-17
Identity = 45/175 (25.71%), Postives = 80/175 (45.71%), Query Frame = 2
Query:  599 FIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXX--------XNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDED---TAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNE---YKYGSGQLKFGQSFICVSLKFQNFNSLGRLQT 1081
             I L L   + +   +L+C  ++ + VDWF+  K P +      + +         ++  W      + +   ++  +++  Y S   Q  ++ YND+    +   +    GH+KGV+  D   G+WLVHSVP FP P     Y +      +GQ+ +CVS  F  F+ +G+  T
Sbjct:    1 MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPASSAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLT 175          
BLAST of Deoxyribonuclease II vs. Ensembl Human
Match: DNASE2B (deoxyribonuclease 2 beta [Source:HGNC Symbol;Acc:HGNC:28875])

HSP 1 Score: 74.7146 bits (182), Expect = 6.307e-14
Identity = 47/155 (30.32%), Postives = 79/155 (50.97%), Query Frame = 2
Query:  641 SSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXX-------XNNTDWLLSSYKLTNGNNSIALTIKQTYE---SKLKQRFYVYYNDE-DTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKF-PFPNE-YKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            +++SC+NE  + VDWF   K P   +  S  +        S    W  S   + +  + +  T++Q YE   SK     Y+ YND      N     GH+KG++ +++ +G+WL+HS+P+F P P E Y Y     + GQS IC++ K+  + ++
Sbjct:   28 ATISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFWLIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAI 182          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-7 (Cell-death-related nuclease 7 [Source:UniProtKB/Swiss-Prot;Acc:P34387])

HSP 1 Score: 94.3597 bits (233), Expect = 6.475e-21
Identity = 48/165 (29.09%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  593 LKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXX-----XNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            L F+++F ++        + CKN   + VDWF+  K P +    +   +     + ++DW   +  + + N ++  T+ Q Y +     F+  Y+D+D   +     GH+KGV  FD + G+WL+HSVP FP    + Y +   K+GQSF C S++ Q+   L  
Sbjct:    3 LYFVLIFSVI-FTTGNGKIQCKNMRGKSVDWFVVYKLPKLSGAGTSGKEFVYFDAESSDWTRGN-DINDPNVAVGATVSQVYSADKSNNFWFMYSDDDPIKSADSYRGHAKGVSLFDSTTGFWLIHSVPNFPPIKSFSYPNTAEKYGQSFFCASMEVQHLTELAE 165          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: nuc-1 (Deoxyribonuclease-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17778])

HSP 1 Score: 93.2041 bits (230), Expect = 1.708e-20
Identity = 59/200 (29.50%), Postives = 97/200 (48.50%), Query Frame = 2
Query:  581 MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXNNTDWLL-----------SSYKLTNGNNSIALTIKQTYESK-LKQRFYVYYNDE-----DTAG--------NEKYN------------MGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSLG 1069
            M  +   +++FLL+ +  + ++ SCK+++  DVDWF   K P      S++  +    W             S+  L + + +IA T++Q Y+ +  K  F+V YNDE      T+G        N  Y+             GH+KG + FD + G WLVHSVP FP P +Y+Y      +GQ+ +C++ K+    S+G
Sbjct:    1 MGLSPAAVLIFLLLGVSQTYAAFSCKDQSGNDVDWFAVYKMPIEKDDGSVTGLAGGVAWYYVDVNKKGTLTPSAKTLDDNDQAIAYTLQQYYDKQNDKTIFHVMYNDEPWGSKSTSGIKLEEILSNRVYSNYTHEDDSTSTAFGHTKGTIFFDGTSGVWLVHSVPLFPNPTKYEYPVSGHDYGQTMLCMTFKYAQLKSIG 200          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-6 (Cell death-related nuclease 6 [Source:UniProtKB/Swiss-Prot;Acc:P34508])

HSP 1 Score: 92.8189 bits (229), Expect = 2.217e-20
Identity = 52/156 (33.33%), Postives = 81/156 (51.92%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHV----------DXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNM-GHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVS 1039
            I+ ++  I IS ++  CK+ N  +VDWF+  K PH+          +    L    NN +W L    +   NN++  T++Q Y S +   F   YNDE        N  GH+KGV  FD+  G+W++HS+PKFP  + +++ S    +GQ  IC+S
Sbjct:    5 IILIVSLIGISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICIS 160          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-6 (Cell death-related nuclease 6 [Source:UniProtKB/Swiss-Prot;Acc:P34508])

HSP 1 Score: 92.8189 bits (229), Expect = 2.217e-20
Identity = 52/156 (33.33%), Postives = 81/156 (51.92%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHV----------DXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNM-GHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVS 1039
            I+ ++  I IS ++  CK+ N  +VDWF+  K PH+          +    L    NN +W L    +   NN++  T++Q Y S +   F   YNDE        N  GH+KGV  FD+  G+W++HS+PKFP  + +++ S    +GQ  IC+S
Sbjct:    5 IILIVSLIGISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICIS 160          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-6 (Cell death-related nuclease 6 [Source:UniProtKB/Swiss-Prot;Acc:P34508])

HSP 1 Score: 92.8189 bits (229), Expect = 2.311e-20
Identity = 52/156 (33.33%), Postives = 81/156 (51.92%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHV----------DXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNM-GHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVS 1039
            I+ ++  I IS ++  CK+ N  +VDWF+  K PH+          +    L    NN +W L    +   NN++  T++Q Y S +   F   YNDE        N  GH+KGV  FD+  G+W++HS+PKFP  + +++ S    +GQ  IC+S
Sbjct:    5 IILIVSLIGISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICIS 160          
BLAST of Deoxyribonuclease II vs. Ensembl Fly
Match: DNaseII (gene:FBgn0000477 transcript:FBtr0083538)

HSP 1 Score: 78.5666 bits (192), Expect = 1.552e-15
Identity = 54/176 (30.68%), Postives = 83/176 (47.16%), Query Frame = 2
Query:  581 MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPP----HVDXXXXXX-------XXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSLGRL 1075
            + F L F+  F   E   +KS +SCK+E   DVDW+   K P    H D     S       +  N   W +S   +++  +  A T+    +          YND+   G    + GH+KGVV  D     W+VHSVPKFP   +Y Y +   ++ QS +CV+LK ++   +G++
Sbjct:    4 LCFVLLFVWFFYQNE---AKSKVSCKDEAGNDVDWWHLYKLPKHYQHNDLGKDTSGLKYLYVTSQNYDTWQMSGKFISDPLSLPAQTLNPLNDDP-SHTLLAAYNDQQPNGTVFSSGGHAKGVVASDGETAIWIVHSVPKFPTIPDYSYPTSGEQYAQSMLCVTLKGEDLEKVGQI 175          
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Match: dnase2 (deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:ZDB-GENE-010724-16])

HSP 1 Score: 88.1965 bits (217), Expect = 1.183e-18
Identity = 51/168 (30.36%), Postives = 82/168 (48.81%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXX------XXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNE----KYNMGHSKGVVTFDKSEGYWLVHSVPKFPFP---NEYKYGSGQLKFGQSFICVSLKFQNFNSLG 1069
            +L LL   + + SS+SC N+  + VDW+   K PH                  +  W   +  + +  +++  T+   YE       Y+ YND+     +      + GH+KGVV FDK +G+WLVHS P FP P    ++ Y +  +  GQ+FICV+  F+ F ++G
Sbjct:    5 VLLLLHASRGAFSSISCYNDQGKPVDWYYLYKLPHEHHTPLEEGLKYLFMDVESEGWTDGTTLVNDTQSAVGRTVGPLYEGG--DVGYILYNDQPPKQKQVEGASRSCGHTKGVVVFDKEQGFWLVHSTPHFPPPKSEGQFSYPTSGISNGQNFICVTYPFERFQTIG 170          
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Match: dnase2 (deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:ZDB-GENE-010724-16])

HSP 1 Score: 88.1965 bits (217), Expect = 1.183e-18
Identity = 51/168 (30.36%), Postives = 82/168 (48.81%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXX------XXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNE----KYNMGHSKGVVTFDKSEGYWLVHSVPKFPFP---NEYKYGSGQLKFGQSFICVSLKFQNFNSLG 1069
            +L LL   + + SS+SC N+  + VDW+   K PH                  +  W   +  + +  +++  T+   YE       Y+ YND+     +      + GH+KGVV FDK +G+WLVHS P FP P    ++ Y +  +  GQ+FICV+  F+ F ++G
Sbjct:    5 VLLLLHASRGAFSSISCYNDQGKPVDWYYLYKLPHEHHTPLEEGLKYLFMDVESEGWTDGTTLVNDTQSAVGRTVGPLYEGG--DVGYILYNDQPPKQKQVEGASRSCGHTKGVVVFDKEQGFWLVHSTPHFPPPKSEGQFSYPTSGISNGQNFICVTYPFERFQTIG 170          
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Match: dnase2b (deoxyribonuclease II beta [Source:ZFIN;Acc:ZDB-GENE-090824-2])

HSP 1 Score: 81.6481 bits (200), Expect = 1.485e-16
Identity = 48/160 (30.00%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  614 LLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXX------XXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLK-QRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKF-PFPNE-YKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            LL  +  S++ +SC NE+ + VDWFI  K P             +    +  D+ +S Y + +   ++  T+ Q Y         Y+ YND           GH+KGV+ FD+ +G+WL HSVP F PFP   Y Y      +GQ+ +C++  +  F  +
Sbjct:   12 LLFLMGFSEAVISCLNEDGQPVDWFIMYKLPIYKMEVKGSGVDYMYLDPSIMDFQISKYTVNSSTGALGRTLTQLYSGYTSNSSVYMLYNDAPPELKYPSKYGHTKGVLMFDQDQGFWLTHSVPHFPPFPERNYSYPLTGKYYGQTLLCITFNYTQFPRI 171          
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Match: dnase2b (deoxyribonuclease II beta [Source:ZFIN;Acc:ZDB-GENE-090824-2])

HSP 1 Score: 81.2629 bits (199), Expect = 1.828e-16
Identity = 47/160 (29.38%), Postives = 75/160 (46.88%), Query Frame = 2
Query:  614 LLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXX------XXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLK-QRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKF-PFPNE-YKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            + V  ++S   +SC NE+ + VDWFI  K P             +    +  D+ +S Y + +   ++  T+ Q Y         Y+ YND           GH+KGV+ FD+ +G+WL HSVP F PFP   Y Y      +GQ+ +C++  +  F  +
Sbjct:    1 MFVLFQLSACLISCLNEDGQPVDWFIMYKLPIYKMEVKGSGVDYMYLDPSIMDFQISKYTVNSSTGALGRTLTQLYSGYTSNSSVYMLYNDAPPELKYPSKYGHTKGVLMFDQDQGFWLTHSVPHFPPFPERNYSYPLTGKYYGQTLLCITFNYTQFPRI 160          
BLAST of Deoxyribonuclease II vs. Ensembl Xenopus
Match: dnase2b (deoxyribonuclease II beta [Source:NCBI gene;Acc:496759])

HSP 1 Score: 90.8929 bits (224), Expect = 1.438e-19
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query:  626 IKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXN-------NTDWLLSSYKLTNGNNSIALTIKQTYESKLKQ-RFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKF-PFPNE-YKYGSGQLKFGQSFICVSLKFQNFNSLG 1069
            + +  + +SC+NE  + +DWF+  K P +    S  S  +       N +W +S +++    +++   ++Q Y+   K    Y+ YND           GH+KG++ FD S+G+WL+HSVP F P+P + Y Y S   +FGQ+ ICV+ ++  F  + 
Sbjct:    1 MSMVAAEISCRNEAGDPIDWFVVYKLPMLKMNGSTGSGLDYLYMDSTNQEWQISKFQINTTKSAVGQVLQQLYQDYDKNNTVYMIYNDAPPNVTNSTRKGHTKGILFFDNSQGFWLIHSVPHFPPYPEDGYGYPSTGKRFGQTAICVTYQYNEFKEIA 158          
BLAST of Deoxyribonuclease II vs. Ensembl Xenopus
Match: dnase2 (deoxyribonuclease II, lysosomal [Source:NCBI gene;Acc:733868])

HSP 1 Score: 85.1149 bits (209), Expect = 1.864e-17
Identity = 46/159 (28.93%), Postives = 90/159 (56.60%), Query Frame = 2
Query:  635 SKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXX------NNTDWLLSSYKLTNGNNSIALTIKQTYES-KLKQRFYVYYNDE----DTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNE--YKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            S ++ SC  ++ + VDWFI  K P + +    +  +      ++  W+  +  + + ++++  T+ Q Y++  +K   Y+ YNDE     ++G+++   GH+KG++  DK +G+WLVHS P+FP P +  Y +     + GQSF+CV+  ++ F  +G+
Sbjct:   15 SFAATSCYGDHGKQVDWFIVYKLPQLRNKGEEAGMTYVYQDSSSGGWVPGATLMNSTDSAVGQTVSQLYKAFGMKDVAYILYNDEPANISSSGSDR---GHTKGMLLLDKKQGFWLVHSTPRFPPPADQSYDWPLSAHRNGQSFLCVTYPYKQFGDIGQ 170          
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Match: Dnase2a (deoxyribonuclease II alpha [Source:MGI Symbol;Acc:MGI:1329019])

HSP 1 Score: 84.7297 bits (208), Expect = 1.639e-17
Identity = 46/160 (28.75%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  632 ISKSSLSCKNENNEDVDWFIAIK-PPHVDXXXXXX------XXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDE---DTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFP---NEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            +   +LSC  ++ + VDWF+  K P H  S  +           N+  W      + +   ++  +++  Y     Q  ++ YND+    ++  +    GH+KGV+  D+  G+WLVHSVP+FP P     Y +      FGQ+ +CVSL F  F  +G+
Sbjct:   15 VPAEALSCYGDSGQPVDWFVVYKLPAHSGSRDTPKGLTYKYMDQNSDGWQDGVGYINSSEGAVGRSLQPLYRKNSSQLAFLLYNDQPPKSSSARDSTGHGHTKGVLLLDQEGGFWLVHSVPRFPPPASSGAYTWPPNAQTFGQTLLCVSLPFTQFARIGK 174          
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Match: Dnase2b (deoxyribonuclease II beta [Source:MGI Symbol;Acc:MGI:1913283])

HSP 1 Score: 83.9593 bits (206), Expect = 2.972e-17
Identity = 49/165 (29.70%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXX-------XNNTDWLLSSYKLTNGNNSIALTIKQTYES--KLKQRFYVYYNDEDTAGNEKYNM--GHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            +LF  +   +    +SC+NE  E VDWFI  K P   S +S  +        S    W  S Y + +  +++  T++  Y++        Y+ YND    G+  Y+   GH+KG++ +++++G+WL+HSVPKFP  + Y+Y +   ++GQ+ IC++  +  F  +
Sbjct:   12 LLFFALSGVLGTPEISCRNEYGEAVDWFIFYKLPKRTSKASEEAGLQYLYLDSTRQTWNKSLYLINSTRSALGRTLQHLYDTHNSTNDTAYLIYND-GVPGSVNYSRQYGHAKGLLVWNRTQGFWLIHSVPKFPPVHGYEYPTSGRRYGQTGICITFGYSQFEEI 175          
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Match: Dnase2b (deoxyribonuclease II beta [Source:MGI Symbol;Acc:MGI:1913283])

HSP 1 Score: 83.9593 bits (206), Expect = 2.972e-17
Identity = 49/165 (29.70%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXX-------XNNTDWLLSSYKLTNGNNSIALTIKQTYES--KLKQRFYVYYNDEDTAGNEKYNM--GHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            +LF  +   +    +SC+NE  E VDWFI  K P   S +S  +        S    W  S Y + +  +++  T++  Y++        Y+ YND    G+  Y+   GH+KG++ +++++G+WL+HSVPKFP  + Y+Y +   ++GQ+ IC++  +  F  +
Sbjct:   12 LLFFALSGVLGTPEISCRNEYGEAVDWFIFYKLPKRTSKASEEAGLQYLYLDSTRQTWNKSLYLINSTRSALGRTLQHLYDTHNSTNDTAYLIYND-GVPGSVNYSRQYGHAKGLLVWNRTQGFWLIHSVPKFPPVHGYEYPTSGRRYGQTGICITFGYSQFEEI 175          
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Match: Dnase2a (deoxyribonuclease II alpha [Source:MGI Symbol;Acc:MGI:1329019])

HSP 1 Score: 72.7886 bits (177), Expect = 1.415e-13
Identity = 36/119 (30.25%), Postives = 60/119 (50.42%), Query Frame = 2
Query:  743 NNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDE---DTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFP---NEYKYGSGQLKFGQSFICVSLKFQNFNSLGRLQT 1081
            N+  W      + +   ++  +++  Y     Q  ++ YND+    ++  +    GH+KGV+  D+  G+WLVHSVP+FP P     Y +      FGQ+ +CVSL F  F  +G+  T
Sbjct:   38 NSDGWQDGVGYINSSEGAVGRSLQPLYRKNSSQLAFLLYNDQPPKSSSARDSTGHGHTKGVLLLDQEGGFWLVHSVPRFPPPASSGAYTWPPNAQTFGQTLLCVSLPFTQFARIGKQLT 156          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|Q75WF2|DNA2_ACAPL (Plancitoxin-1 OS=Acanthaster planci OX=133434 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.999e-21
Identity = 57/173 (32.95%), Postives = 92/173 (53.18%), Query Frame = 2
Query:  599 FIILFLLVEIKISKS-SLSCKNENNEDVDWFIAIKPPH---------VDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRF-YVYYNDEDTAGNEKYN--MGHSKGVVTFDKSEGYWLVHSVPKFPFP--NEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            F+ L +L  + +  S ++SC +  N+ VDWFI  K P           + +  +    NN     SS  L + +++IA T+   Y++  K    +V YND+  AG E  +  +GH+KGV+ FD + G+WLVHSVPKFP P    Y +     + GQ+ +C++ K+  F  +G+
Sbjct:   10 FLALTVLTAVMVGTSEAVSCMDNKNKPVDWFIVYKLPQDSASSKPVIREGYGQMYMDVNNQALKFSSTSLKDDDHAIAYTVDDIYKNHGKGNLAHVMYNDQPPAGEEIQSGLVGHTKGVLAFDGTSGFWLVHSVPKFPLPASKSYNWPDNAKRNGQTLLCITFKYDQFEKIGQ 182          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|P34387|TG198_CAEEL (Cell-death-related nuclease 7 OS=Caenorhabditis elegans OX=6239 GN=crn-7 PE=2 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 8.236e-20
Identity = 48/165 (29.09%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  593 LKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXX-----XNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            L F+++F ++        + CKN   + VDWF+  K P +    +   +     + ++DW   +  + + N ++  T+ Q Y +     F+  Y+D+D   +     GH+KGV  FD + G+WL+HSVP FP    + Y +   K+GQSF C S++ Q+   L  
Sbjct:    3 LYFVLIFSVI-FTTGNGKIQCKNMRGKSVDWFVVYKLPKLSGAGTSGKEFVYFDAESSDWTRGN-DINDPNVAVGATVSQVYSADKSNNFWFMYSDDDPIKSADSYRGHAKGVSLFDSTTGFWLIHSVPNFPPIKSFSYPNTAEKYGQSFFCASMEVQHLTELAE 165          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|Q17778|NUC1_CAEEL (Deoxyribonuclease-2 OS=Caenorhabditis elegans OX=6239 GN=nuc-1 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.172e-19
Identity = 59/200 (29.50%), Postives = 97/200 (48.50%), Query Frame = 2
Query:  581 MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXNNTDWLL-----------SSYKLTNGNNSIALTIKQTYESK-LKQRFYVYYNDE-----DTAG--------NEKYN------------MGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSLG 1069
            M  +   +++FLL+ +  + ++ SCK+++  DVDWF   K P      S++  +    W             S+  L + + +IA T++Q Y+ +  K  F+V YNDE      T+G        N  Y+             GH+KG + FD + G WLVHSVP FP P +Y+Y      +GQ+ +C++ K+    S+G
Sbjct:    1 MGLSPAAVLIFLLLGVSQTYAAFSCKDQSGNDVDWFAVYKMPIEKDDGSVTGLAGGVAWYYVDVNKKGTLTPSAKTLDDNDQAIAYTLQQYYDKQNDKTIFHVMYNDEPWGSKSTSGIKLEEILSNRVYSNYTHEDDSTSTAFGHTKGTIFFDGTSGVWLVHSVPLFPNPTKYEYPVSGHDYGQTMLCMTFKYAQLKSIG 200          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|P34508|CRN6_CAEEL (Cell death-related nuclease 6 OS=Caenorhabditis elegans OX=6239 GN=crn-6 PE=2 SV=3)

HSP 1 Score: 92.8189 bits (229), Expect = 2.939e-19
Identity = 52/156 (33.33%), Postives = 81/156 (51.92%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHV----------DXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNM-GHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVS 1039
            I+ ++  I IS ++  CK+ N  +VDWF+  K PH+          +    L    NN +W L    +   NN++  T++Q Y S +   F   YNDE        N  GH+KGV  FD+  G+W++HS+PKFP  + +++ S    +GQ  IC+S
Sbjct:    5 IILIVSLIGISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICIS 160          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|P56542|DNS2A_MOUSE (Deoxyribonuclease-2-alpha OS=Mus musculus OX=10090 GN=Dnase2 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.147e-16
Identity = 46/160 (28.75%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  632 ISKSSLSCKNENNEDVDWFIAIK-PPHVDXXXXXX------XXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDE---DTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFP---NEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            +   +LSC  ++ + VDWF+  K P H  S  +           N+  W      + +   ++  +++  Y     Q  ++ YND+    ++  +    GH+KGV+  D+  G+WLVHSVP+FP P     Y +      FGQ+ +CVSL F  F  +G+
Sbjct:   15 VPAEALSCYGDSGQPVDWFVVYKLPAHSGSRDTPKGLTYKYMDQNSDGWQDGVGYINSSEGAVGRSLQPLYRKNSSQLAFLLYNDQPPKSSSARDSTGHGHTKGVLLLDQEGGFWLVHSVPRFPPPASSGAYTWPPNAQTFGQTLLCVSLPFTQFARIGK 174          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A0C2CMT7 (Deoxyribonuclease II OS=Ancylostoma duodenale OX=51022 GN=ANCDUO_11866 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.116e-27
Identity = 68/156 (43.59%), Postives = 98/156 (62.82%), Query Frame = 2
Query:  593 LKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIK-PPHVDXXXXXXXX---XNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDE--DTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSL 1042
            L  I++ +   I +  +++SCK+ N EDVDWF+A+K P  VDS    S     SN   W+ S  K+T+ +++I  T+ Q Y+ K K RFY+ YND   +  G + Y   HSKGV  FD+++G+W+VHSVPKFP   +Y Y  GQ KF QSF+C++L
Sbjct:    2 LSLILILVSAPIYVD-AAVSCKDLNGEDVDWFVALKRPTAVDSSGGTSFVYFDSNANKWVESKEKITDKDSAIGATVSQLYKDKSK-RFYITYNDHCPEKPGADSYT-AHSKGVAVFDRNQGFWMVHSVPKFPVEGKYAYPEGQTKFAQSFLCMTL 154          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A0D8XRM7 (Deoxyribonuclease II OS=Dictyocaulus viviparus OX=29172 GN=DICVIV_07557 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.585e-25
Identity = 62/158 (39.24%), Postives = 93/158 (58.86%), Query Frame = 2
Query:  605 ILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXX--XXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVY-YNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSLG 1069
            +  LL+  K +KS ++C+    E VDW+   KPP   + ++    + SN+ +W LSS  ++NG  +I  T+++ Y  K  Q+ +V+ YND   +G      GHSKGVV FDK  G+WL+HSVPKFP    Y Y    +KFGQ F+C++L  Q   ++G
Sbjct:    4 LAVLLLFTKCTKSIITCRGLAGEAVDWYAVYKPPSTSNSTAFFYYADSNSKNWTLSSLPISNGKTAIGATLEEFY--KYDQKVFVFAYNDHSPSGGVDSYRGHSKGVVVFDKQTGFWLIHSVPKFPKLGSYSYPVTGMKFGQMFLCLTLPLQFLGNVG 159          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A368FC76 (Deoxyribonuclease II OS=Ancylostoma caninum OX=29170 GN=ANCCAN_24471 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.889e-23
Identity = 61/161 (37.89%), Postives = 82/161 (50.93%), Query Frame = 2
Query:  602 IILFLLVEIKISKSSLSCKNENNEDVDWFIAIK-PPHVDXXXXXXXX---XNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            + L  +V I    + L CKN   EDVDWF AIK PP VD     S     S    W +S   + +  ++I  TI Q Y+   ++ F + YND+          GHSKGV  FD   G+W+VHSVP FP   +YKY     +F QSF+C+SL       +G+
Sbjct:    4 LCLAFVVFINHGNAKLGCKNMQGEDVDWFAAIKLPPGVDKRKGTSFVYFDSTQDGWKMSPQSIDSKKSAIGATINQIYKVDKRKTFTIAYNDDSPVKAVDSGRGHSKGVAAFDSDVGFWMVHSVPNFPPIKKYKYPESGTRFAQSFLCLSLSTNALEDVGQ 164          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A368FAX0 (Deoxyribonuclease II OS=Ancylostoma caninum OX=29170 GN=ANCCAN_26296 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.446e-23
Identity = 57/161 (35.40%), Postives = 83/161 (51.55%), Query Frame = 2
Query:  602 IILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVD----XXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            + L +   I    + L CKN    DVDWF+AIK P         S +        W++S   + +  ++I  TI Q Y +   + F + YND    G  ++  GHSKGV  FD   G+W++HSVPKFP    Y Y S   +FGQSF+C+SL  ++   +G+
Sbjct:    4 VCLAITALINYGHARLGCKNMQGGDVDWFVAIKLPREADGGWGTSFVYYDPTQEGWMMSPVPIDSYMSAIGATISQIYVADKSRTFTIAYNDGSPVGEAEWGRGHSKGVAAFDAYTGFWMIHSVPKFPPFYWYGYPSTGRRFGQSFMCLSLSTRSLEDVGQ 164          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: R7USA3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_171507 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 4.110e-23
Identity = 66/186 (35.48%), Postives = 103/186 (55.38%), Query Frame = 2
Query:  641 SSLSCKNENNEDVDWFIAIKPPHV---------DXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYES-KLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKF-PFPNE-YKYGSGQLKFGQSFICVSLKFQNFNSLGRLQTIL*IDFR*P*ISVFVMTSMYNKNTQNM 1162
            S++ CK++NN++VDWFI  K P +         +    L    +   W +S+  L   N++IA T++Q Y++ + K   Y  YNDE     E  + GH+KG + FD + G+WLVHS+PKF P  NE Y Y      FGQ+F+C+SL  QNFN++G     L + +  P I  + +  ++ K+  N+
Sbjct:   23 SAIQCKDQNNQNVDWFIIYKLPKISKSQYPLVREGLGHLYMDVHRQSWTMSNVSLEQRNHAIAYTLQQIYDNYESKDVAYALYNDEAPPDRESSSHGHTKGDLAFDSTSGFWLVHSLPKFPPVANESYAYPETGKLFGQTFLCISLGNQNFNTIG-----LQLKYTYPFIYDYSLPDVFTKDNPNL 203          
BLAST of Deoxyribonuclease II vs. Ensembl Cavefish
Match: dnase2b (deoxyribonuclease 2 beta [Source:NCBI gene;Acc:103030372])

HSP 1 Score: 84.3445 bits (207), Expect = 1.868e-17
Identity = 47/157 (29.94%), Postives = 82/157 (52.23%), Query Frame = 2
Query:  632 ISKSSLSCKNENNEDVDWFIAIKPPHV------DXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYES-KLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYG---SGQLKFGQSFICVSLKFQNFNSLGR 1072
            +S+++LSC NE  + VDWFI  K P             +   ++   W +S Y +   + ++  T+ + Y++ K     Y+ YND       + N GHSKG + FD+S+G+W+ HS+P FP   E  +G   +G+L +GQ+  C +  ++ F  + +
Sbjct:   35 LSEANLSCLNEEGQPVDWFIMYKLPKYKKGEVGSGVEYMYLDASMLTWRMSPYAVNTSDGAVGRTLGRLYKTYKSNSSVYMLYNDAPPLLKYQSNYGHSKGTLLFDRSQGFWITHSIPHFPPFLEMGFGYPSTGKL-YGQTVHCTTYSYEQFKKISQ 190          
BLAST of Deoxyribonuclease II vs. Ensembl Cavefish
Match: dnase2 (deoxyribonuclease-2-alpha-like [Source:NCBI gene;Acc:103028211])

HSP 1 Score: 77.7962 bits (190), Expect = 3.097e-15
Identity = 48/159 (30.19%), Postives = 76/159 (47.80%), Query Frame = 2
Query:  635 SKSSLSCKNENNEDVDWFIAIK------PPHVDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDE----DTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFP---FPNEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            + S+LSC ++    VDWF   K       P  +    L  +  +  W+  S  + + + ++  T+   YE    +  Y+ YND+    D   N   + GH+KGVV FD  +G+WLVHS P FP      ++ Y     + GQ+FICV+     F ++G 
Sbjct:   16 ANSTLSCYDDQGNTVDWFYLYKLPRPHEAPREEGLKYLLQEEKSEGWVDGSVLVEDTSGALGRTVGPLYEEG--ELGYILYNDQPPEKDRLENAHRSAGHTKGVVLFDDKQGFWLVHSTPHFPPLKTEGKFSYPESGTQNGQNFICVTYPLDRFETIGE 172          
BLAST of Deoxyribonuclease II vs. Ensembl Sea Lamprey
Match: dnase2 (deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:ZDB-GENE-010724-16])

HSP 1 Score: 78.1814 bits (191), Expect = 3.825e-16
Identity = 48/148 (32.43%), Postives = 72/148 (48.65%), Query Frame = 2
Query:  647 LSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQR---FYVYYNDEDTAGNEKYN--MGHSKGVVTFDKSEGYWLVHSVPKFP--FPNEYKYGSGQLKFGQSFICVSLKFQNFNSLG 1069
            +SC N   + VDWFI  K P       L    +   W  +   + + ++ +  T+ Q Y+    +     +V YNDE    +  Y+   GH+KGVV  D + G+WLVHS P FP   P  + +    L++GQSF+CVS  F  F  + 
Sbjct:    1 VSCLNGEGKSVDWFIVYKLPK--GKDYLYLDKSTQSWQNAQVDVDSNSSPVYQTVNQLYDGNATEAGDVAFVLYNDE-PPNSPHYDSICGHTKGVVMLDGTGGFWLVHSTPHFPPSVPGPFAWPHTALRYGQSFLCVSYGFDQFGDIA 145          
BLAST of Deoxyribonuclease II vs. Ensembl Medaka
Match: dnase2b (deoxyribonuclease-2-beta [Source:NCBI gene;Acc:101174093])

HSP 1 Score: 90.1225 bits (222), Expect = 2.259e-19
Identity = 57/172 (33.14%), Postives = 80/172 (46.51%), Query Frame = 2
Query:  575 LMMSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXX------NNTDWLLSSYKLTNGNNSIALTIKQTYESKL---KQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFP-FPNE-YKYGSGQLKFGQSFICVSLKFQNF 1057
            ++  FTL   I  LL    +  + +SC+NE    VDWFI  K P        S         +   W +S Y +     +IA T+KQ Y  K        YV YND           GH+KGV+ FD ++G+WL HS+P FP FP   Y Y S     GQ+ +C++ ++  F
Sbjct:    1 MVTHFTLCCQIALLLFTCLVCAADISCRNEEGNPVDWFIIYKLPKYKVGEVGSGVEYMYLDESVARWQMSKYMINTSQGAIANTLKQLYMGKAYMSNSSVYVLYNDGPPDLKYIQAYGHTKGVLLFDHAKGFWLSHSIPHFPSFPERGYLYPSSGKLNGQTLLCMTYQYAQF 172          
BLAST of Deoxyribonuclease II vs. Ensembl Medaka
Match: dnase2 (deoxyribonuclease 2, lysosomal [Source:NCBI gene;Acc:101162954])

HSP 1 Score: 82.4185 bits (202), Expect = 9.328e-17
Identity = 51/162 (31.48%), Postives = 79/162 (48.77%), Query Frame = 2
Query:  641 SSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXX-------NNTDWLLSSYKLTNGNNSIALTIKQTY-ESKLKQRFYVYYNDE-------DTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFP---FPNEYKYGSGQLKFGQSFICVSLKFQNFNSLGR 1072
            S +SC N+  + VDWF   K P     ++                W+     + + + ++  T+ Q Y E K  +  YV YND+       D +GN     GH+KGVV  D+++G+WLVHS P FP      EY Y S  +  GQ+F+CV+   ++F ++G 
Sbjct:   18 SQISCYNDQGDAVDWFYIYKLPKEHQKTAPRRGEQYLLLEKGGEGWMEGKVTVNDSSGALGRTVGQLYSERKSSEVAYVLYNDQSPVDGFGDGSGNSG---GHTKGVVLLDQNQGFWLVHSTPHFPPERQAGEYYYPSSGVNNGQNFLCVTYPLKSFQTIGE 176          
BLAST of Deoxyribonuclease II vs. Ensembl Medaka
Match: ENSORLT00000036979.1 (deoxyribonuclease-2-alpha [Source:NCBI gene;Acc:101173852])

HSP 1 Score: 72.0182 bits (175), Expect = 2.402e-13
Identity = 46/167 (27.54%), Postives = 85/167 (50.90%), Query Frame = 2
Query:  602 IILFLLVEIKI----SKSSLSCKNENNEDVDWFI--AIKPPHVDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQR---FYVYYNDEDTAGN-EKYNMGHSKGVVTFDKSEGYWLVHSVPKFP-FPNEYKYGSGQLKFGQSFICVSLKFQNFNSLG 1069
            +++ +LV + I     +S + C+N++  +VDW+I   ++    D  S L    N   W +S+ K+ + +  +  T+K   +  +KQ     Y+ YND+         + GHSKGVV  D+  G WL HS P+FP + ++  +        Q+F+C++  +  F ++G
Sbjct:    5 VLIKVLVSVGIFFHGCQSDVRCRNDHGVEVDWYILYKLRNTQKDGSSYLYMDENTNGWTVSNQKIDSRSGCLGWTLKPLLDFYVKQTEGFGYLLYNDQPPNPYVAPKSFGHSKGVVMLDRQTGVWLSHSTPRFPTYRSQNFWPESGNANAQAFMCITFPYAQFEAIG 171          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000081051.1 (SMESG000081051.1)

HSP 1 Score: 313.538 bits (802), Expect = 2.074e-105
Identity = 162/163 (99.39%), Postives = 162/163 (99.39%), Query Frame = 2
Query:  578 MMSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            MMSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQN NSL
Sbjct:    1 MMSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNLNSL 163          

HSP 2 Score: 68.5514 bits (166), Expect = 6.419e-13
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 2
Query: 1289 VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL 1387
            VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL
Sbjct:  164 VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL 196          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000081051.1 (SMESG000081051.1)

HSP 1 Score: 313.923 bits (803), Expect = 6.279e-105
Identity = 162/163 (99.39%), Postives = 162/163 (99.39%), Query Frame = 2
Query:  578 MMSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            MMSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQN NSL
Sbjct:    1 MMSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNLNSL 163          

HSP 2 Score: 68.5514 bits (166), Expect = 1.175e-12
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 2
Query: 1289 VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL 1387
            VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL
Sbjct:  164 VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL 196          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000081051.1 (SMESG000081051.1)

HSP 1 Score: 310.842 bits (795), Expect = 1.858e-104
Identity = 161/162 (99.38%), Postives = 161/162 (99.38%), Query Frame = 2
Query:  581 MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQN NSL
Sbjct:    1 MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNLNSL 162          

HSP 2 Score: 68.5514 bits (166), Expect = 6.206e-13
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 2
Query: 1289 VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL 1387
            VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL
Sbjct:  163 VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL 195          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000081051.1 (SMESG000081051.1)

HSP 1 Score: 311.227 bits (796), Expect = 8.479e-104
Identity = 161/162 (99.38%), Postives = 161/162 (99.38%), Query Frame = 2
Query:  581 MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQN NSL
Sbjct:    1 MSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNLNSL 162          

HSP 2 Score: 68.5514 bits (166), Expect = 1.141e-12
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 2
Query: 1289 VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL 1387
            VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL
Sbjct:  163 VDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSL 195          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000062993.1 (SMESG000062993.1)

HSP 1 Score: 125.561 bits (314), Expect = 4.577e-32
Identity = 70/160 (43.75%), Postives = 99/160 (61.88%), Query Frame = 2
Query:  593 LKFIILFLLVEI--KISKSSLSCKNENNEDVDWFIAIKPPHVDXXXXXXXXXNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNFNSL 1066
            +K I + L+  I  +++   LSCKNENN+D++WFI +K P   S+  +   S +  W  S + L++ NN I  TI+QTY S   Q FY YYNDE T      + GH KGV++FD + G+WL+HSVP FP    Y YG  +  +GQSFICVSL+ +N  ++
Sbjct:    1 MKIIQVALIFNILHQLAICELSCKNENNQDIEWFIGLKFP--KSYKFVYISSQSETWTTSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDE-TPKFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI 157          
The following BLAST results are available for this feature:
BLAST of Deoxyribonuclease II vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DNASE22.507e-1725.71deoxyribonuclease 2, lysosomal [Source:HGNC Symbol... [more]
DNASE2B6.307e-1430.32deoxyribonuclease 2 beta [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crn-76.475e-2129.09Cell-death-related nuclease 7 [Source:UniProtKB/S... [more]
nuc-11.708e-2029.50Deoxyribonuclease-2 [Source:UniProtKB/Swiss-Prot;... [more]
crn-62.217e-2033.33Cell death-related nuclease 6 [Source:UniProtKB/S... [more]
crn-62.217e-2033.33Cell death-related nuclease 6 [Source:UniProtKB/S... [more]
crn-62.311e-2033.33Cell death-related nuclease 6 [Source:UniProtKB/S... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DNaseII1.552e-1530.68gene:FBgn0000477 transcript:FBtr0083538[more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dnase21.183e-1830.36deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:Z... [more]
dnase21.183e-1830.36deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:Z... [more]
dnase2b1.485e-1630.00deoxyribonuclease II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
dnase2b1.828e-1629.38deoxyribonuclease II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnase2b1.438e-1930.38deoxyribonuclease II beta [Source:NCBI gene;Acc:49... [more]
dnase21.864e-1728.93deoxyribonuclease II, lysosomal [Source:NCBI gene;... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dnase2a1.639e-1728.75deoxyribonuclease II alpha [Source:MGI Symbol;Acc:... [more]
Dnase2b2.972e-1729.70deoxyribonuclease II beta [Source:MGI Symbol;Acc:M... [more]
Dnase2b2.972e-1729.70deoxyribonuclease II beta [Source:MGI Symbol;Acc:M... [more]
Dnase2a1.415e-1330.25deoxyribonuclease II alpha [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q75WF2|DNA2_ACAPL3.999e-2132.95Plancitoxin-1 OS=Acanthaster planci OX=133434 PE=1... [more]
sp|P34387|TG198_CAEEL8.236e-2029.09Cell-death-related nuclease 7 OS=Caenorhabditis el... [more]
sp|Q17778|NUC1_CAEEL2.172e-1929.50Deoxyribonuclease-2 OS=Caenorhabditis elegans OX=6... [more]
sp|P34508|CRN6_CAEEL2.939e-1933.33Cell death-related nuclease 6 OS=Caenorhabditis el... [more]
sp|P56542|DNS2A_MOUSE1.147e-1628.75Deoxyribonuclease-2-alpha OS=Mus musculus OX=10090... [more]
back to top
BLAST of Deoxyribonuclease II vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0C2CMT71.116e-2743.59Deoxyribonuclease II OS=Ancylostoma duodenale OX=5... [more]
A0A0D8XRM71.585e-2539.24Deoxyribonuclease II OS=Dictyocaulus viviparus OX=... [more]
A0A368FC761.889e-2337.89Deoxyribonuclease II OS=Ancylostoma caninum OX=291... [more]
A0A368FAX03.446e-2335.40Deoxyribonuclease II OS=Ancylostoma caninum OX=291... [more]
R7USA34.110e-2335.48Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnase2b1.868e-1729.94deoxyribonuclease 2 beta [Source:NCBI gene;Acc:103... [more]
dnase23.097e-1530.19deoxyribonuclease-2-alpha-like [Source:NCBI gene;A... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dnase23.825e-1632.43deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dnase2b2.259e-1933.14deoxyribonuclease-2-beta [Source:NCBI gene;Acc:101... [more]
dnase29.328e-1731.48deoxyribonuclease 2, lysosomal [Source:NCBI gene;A... [more]
ENSORLT00000036979.12.402e-1327.54deoxyribonuclease-2-alpha [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081051.12.074e-10599.39SMESG000081051.1[more]
SMESG000081051.16.279e-10599.39SMESG000081051.1[more]
SMESG000081051.11.858e-10499.38SMESG000081051.1[more]
SMESG000081051.18.479e-10499.38SMESG000081051.1[more]
SMESG000062993.14.577e-3243.75SMESG000062993.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013360 ID=SMED30013360|Name=Deoxyribonuclease II|organism=Schmidtea mediterranea sexual|type=transcript|length=1387bp
ATAAACAACTAAAGTTTTATCGTAAAATGATGATTTCTAGGTAGCTTCAC
AAATTAAATGTTAAACCAGACAATGACAAAATAAGGCTTTTGATGCAAAA
TTTTCTCATCTTATAAATATTTTTCAGCAATGTCTAATCTTGGTATTTAC
TTGTCCGTTTACTTGTCTAGTATAAATAAAAATTTTTAATTAAAATTTAA
TTAATTCTTTATTGTAGTTGTATAGTTAGAGTGTTTATGTGCCATGATTT
ATTTCATAAAGAGTTGCAAGATAATCCTAACGTTTTAAGGATCGTTTTTA
CTAAAGTCTTTAATTAATTTTATTATTATTTTGATGATTGAAATGTTGCT
ATTTTTCTCAATGATTTAATTTTCTTTTATTTAAAATACTCCTTAAAATT
TCTTTAAACACATATAAGGGCCTTTTCAATCTTTATTTATGTTGCATGTA
TGCTTCATTATAAAATAATTTATAAATAGTCAATTCATAGTGTAATTATA
TTCGATACAAATATAAACAATAAATCGCATTTGTTACAGCAATATAAATA
GATTGTCAACATTTCAATTATTAACTGATGATGTCCTTCACTTTAAAATT
TATAATTTTATTCTTGTTGGTTGAAATAAAAATTTCTAAGTCTAGTTTAT
CGTGTAAAAATGAAAATAATGAAGATGTCGATTGGTTTATTGCAATAAAA
CCTCCTCATGTTGATTCATTTTCGTCTTTGAGTTCTCAATCCAACAATAC
CGATTGGCTGCTTTCCTCATATAAATTGACCAATGGAAATAATTCAATTG
CGCTGACAATCAAACAAACTTATGAGTCTAAATTAAAACAAAGGTTTTAT
GTTTATTATAATGATGAGGATACAGCGGGCAATGAAAAATATAACATGGG
TCATTCGAAAGGTGTCGTTACTTTTGATAAAAGTGAAGGATATTGGTTAG
TTCATTCTGTTCCGAAATTTCCATTTCCCAATGAATATAAATATGGTTCA
GGGCAGTTGAAATTTGGACAGTCATTTATTTGCGTTTCTCTGAAGTTTCA
AAATTTTAACTCATTAGGTAGGTTACAAACCATTTTATAAATAGACTTTC
GGTGACCATAAATATCTGTGTTTGTTATGACCAGCATGTATAACAAAAAT
ACTCAAAACATGTTTATATTATTATTTAATATTATAAACATATTTTACGA
GCACAATTTATTAGACAACAATCTAATTTCCAATAATTTATTTTTATTTA
TATTATTTTCATATTTATCGTAATTTTTTTATATTACAGTCGATCAACTT
CTAATTATGACAACAAATGTTTACAGTTATTTTGTTCCCGAGGGATTCTC
CCAAAACTCCAGTTTAATGGACAAAATAAATTCTCTC
back to top

protein sequence of SMED30013360-orf-1

>SMED30013360-orf-1 ID=SMED30013360-orf-1|Name=SMED30013360-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MMSFTLKFIILFLLVEIKISKSSLSCKNENNEDVDWFIAIKPPHVDSFSS
LSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTA
GNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSF
ICVSLKFQNFNSLGRLQTIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004947DNase_II
Vocabulary: molecular function
TermDefinition
GO:0004531deoxyribonuclease II activity
Vocabulary: biological process
TermDefinition
GO:0006259DNA metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004947Deoxyribonuclease IIPFAMPF03265DNase_IIcoord: 25..164
e-value: 4.0E-39
score: 134.8
IPR004947Deoxyribonuclease IIPANTHERPTHR10858DEOXYRIBONUCLEASE IIcoord: 9..165
NoneNo IPR availablePANTHERPTHR10858:SF23DEOXYRIBONUCLEASE IIcoord: 9..165
NoneNo IPR availableCDDcd09120PLDc_DNaseII_1coord: 22..155
e-value: 2.09373E-40
score: 131.262
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.704