Eukaryotic translation initiation factor 4H-like protein

Overview
NameEukaryotic translation initiation factor 4H-like protein
Smed IDSMED30013357
Length (bp)1295
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 4H-like protein (SMED30013357) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4H-like protein (SMED30013357) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 4H-like protein (SMED30013357) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4H-like protein (SMED30013357) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013357

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30013357h1SMcG0013805 dd_Smed_v4_4137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013357h1SMcG0013805 Contig13565newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013357h1SMcG0013805 Contig13565uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30013357h1SMcG0013805 dd_Smed_v4_4137_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Human
Match: EIF4H (eukaryotic translation initiation factor 4H [Source:HGNC Symbol;Acc:HGNC:12741])

HSP 1 Score: 70.4774 bits (171), Expect = 3.036e-13
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 51.9878 bits (123), Expect = 4.864e-7
Identity = 22/39 (56.41%), Postives = 28/39 (71.79%), Query Frame = 2
Query:   53 SVMANQIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            S    ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   30 SRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Human
Match: EIF4H (eukaryotic translation initiation factor 4H [Source:HGNC Symbol;Acc:HGNC:12741])

HSP 1 Score: 70.8626 bits (172), Expect = 3.144e-13
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 52.373 bits (124), Expect = 5.259e-7
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   35 ELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Celegans
Match: drr-2 (Dietary Restriction Response (WT but not eat-2 lifespan increased) [Source:UniProtKB/TrEMBL;Acc:O45781])

HSP 1 Score: 40.817 bits (94), Expect = 3.556e-6
Identity = 20/50 (40.00%), Postives = 31/50 (62.00%), Query Frame = 1
Query:  181 NTRMIRDRETDEFKGYAYVEFSDPQSLEEALS-FNKARIGENILKVNVAE 327
            +  ++ DR++  FKG+AYV F + Q +  A+S  N A  G  +LKVN A+
Sbjct:   40 DIHLVHDRDSGSFKGFAYVTFENEQQMNTAISGLNGADFGNRVLKVNRAQ 89          

HSP 2 Score: 28.8758 bits (63), Expect = 3.556e-6
Identity = 12/36 (33.33%), Postives = 21/36 (58.33%), Query Frame = 2
Query:   59 MANQIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSF 166
            MA++I     + A++G LP +++  D E I + C F
Sbjct:    1 MADEI-----FKAFIGGLPYDSIATDIETILKHCKF 31          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Fly
Match: eIF4H2 (gene:FBgn0039797 transcript:FBtr0339513)

HSP 1 Score: 51.9878 bits (123), Expect = 6.151e-7
Identity = 26/68 (38.24%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENI---LKVNVAEGRKK 339
            ++  +F    + N R+I+DRETDEFKGY YVEF     L+ AL+ N     +N    L++++A+ R++
Sbjct:   78 DVMKIFSDFEVKNVRLIKDRETDEFKGYGYVEFETLAQLKSALNCNGRIKLDNFSAPLRIDIADHRRQ 145          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Fly
Match: eIF4H2 (gene:FBgn0039797 transcript:FBtr0085699)

HSP 1 Score: 51.9878 bits (123), Expect = 6.151e-7
Identity = 26/68 (38.24%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENI---LKVNVAEGRKK 339
            ++  +F    + N R+I+DRETDEFKGY YVEF     L+ AL+ N     +N    L++++A+ R++
Sbjct:   78 DVMKIFSDFEVKNVRLIKDRETDEFKGYGYVEFETLAQLKSALNCNGRIKLDNFSAPLRIDIADHRRQ 145          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Zebrafish
Match: eif4h (eukaryotic translation initiation factor 4h [Source:ZFIN;Acc:ZDB-GENE-010328-19])

HSP 1 Score: 64.3142 bits (155), Expect = 1.775e-11
Identity = 26/60 (43.33%), Postives = 45/60 (75.00%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVA 324
            +I  +F    + + R++RD+ETD+FKG+ YVEF D +SL+EAL+++ A +G+  L+V++A
Sbjct:   59 DIDAIFRDLSVRSVRLVRDKETDKFKGFCYVEFDDLESLKEALTYDGALLGDRSLRVDIA 118          

HSP 2 Score: 51.9878 bits (123), Expect = 2.329e-7
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   37 ELPTEPPYTAYVGNLPFNTVQGDIDAIFRDLSVR 70          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Zebrafish
Match: eif4h (eukaryotic translation initiation factor 4h [Source:ZFIN;Acc:ZDB-GENE-010328-19])

HSP 1 Score: 64.3142 bits (155), Expect = 3.083e-11
Identity = 26/60 (43.33%), Postives = 45/60 (75.00%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVA 324
            +I  +F    + + R++RD+ETD+FKG+ YVEF D +SL+EAL+++ A +G+  L+V++A
Sbjct:   59 DIDAIFRDLSVRSVRLVRDKETDKFKGFCYVEFDDLESLKEALTYDGALLGDRSLRVDIA 118          

HSP 2 Score: 51.9878 bits (123), Expect = 4.882e-7
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   37 ELPTEPPYTAYVGNLPFNTVQGDIDAIFRDLSVR 70          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Zebrafish
Match: eif4h (eukaryotic translation initiation factor 4h [Source:ZFIN;Acc:ZDB-GENE-010328-19])

HSP 1 Score: 64.3142 bits (155), Expect = 3.250e-11
Identity = 26/60 (43.33%), Postives = 45/60 (75.00%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVA 324
            +I  +F    + + R++RD+ETD+FKG+ YVEF D +SL+EAL+++ A +G+  L+V++A
Sbjct:   59 DIDAIFRDLSVRSVRLVRDKETDKFKGFCYVEFDDLESLKEALTYDGALLGDRSLRVDIA 118          

HSP 2 Score: 51.6026 bits (122), Expect = 5.300e-7
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   37 ELPTEPPYTAYVGNLPFNTVQGDIDAIFRDLSVR 70          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Xenopus
Match: tfec (transcription factor EC [Source:Xenbase;Acc:XB-GENE-986001])

HSP 1 Score: 67.3958 bits (163), Expect = 4.303e-12
Identity = 29/66 (43.94%), Postives = 48/66 (72.73%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD+ETD+FKG+ YVEF D  SL+EAL+++ A   +  ++V++AEGRK++
Sbjct:   57 DIDNIFKDLSIRSVRLVRDKETDKFKGFCYVEFDDLDSLKEALTYDGAIFIDRAIRVDIAEGRKQD 122          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Xenopus
Match: tfec (transcription factor EC [Source:Xenbase;Acc:XB-GENE-986001])

HSP 1 Score: 67.0106 bits (162), Expect = 4.637e-12
Identity = 29/66 (43.94%), Postives = 48/66 (72.73%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD+ETD+FKG+ YVEF D  SL+EAL+++ A   +  ++V++AEGRK++
Sbjct:   57 DIDNIFKDLSIRSVRLVRDKETDKFKGFCYVEFDDLDSLKEALTYDGAIFIDRAIRVDIAEGRKQD 122          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Mouse
Match: Eif4h (eukaryotic translation initiation factor 4H [Source:MGI Symbol;Acc:MGI:1341822])

HSP 1 Score: 70.8626 bits (172), Expect = 1.909e-13
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 52.373 bits (124), Expect = 3.644e-7
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   35 ELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Mouse
Match: Eif4h (eukaryotic translation initiation factor 4H [Source:MGI Symbol;Acc:MGI:1341822])

HSP 1 Score: 70.4774 bits (171), Expect = 1.932e-13
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 51.9878 bits (123), Expect = 3.340e-7
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   35 ELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. UniProt/SwissProt
Match: sp|Q9WUK2|IF4H_MOUSE (Eukaryotic translation initiation factor 4H OS=Mus musculus OX=10090 GN=Eif4h PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.336e-12
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 52.373 bits (124), Expect = 2.549e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   35 ELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. UniProt/SwissProt
Match: sp|Q5XI72|IF4H_RAT (Eukaryotic translation initiation factor 4H OS=Rattus norvegicus OX=10116 GN=Eif4h PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.400e-12
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 51.9878 bits (123), Expect = 2.644e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   35 ELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. UniProt/SwissProt
Match: sp|Q1JPH6|IF4H_BOVIN (Eukaryotic translation initiation factor 4H OS=Bos taurus OX=9913 GN=EIF4H PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.431e-12
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 51.9878 bits (123), Expect = 2.424e-6
Identity = 22/39 (56.41%), Postives = 28/39 (71.79%), Query Frame = 2
Query:   53 SVMANQIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            S    ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   30 SRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. UniProt/SwissProt
Match: sp|Q15056|IF4H_HUMAN (Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5)

HSP 1 Score: 70.8626 bits (172), Expect = 1.510e-12
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 52.373 bits (124), Expect = 2.525e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   35 ELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. UniProt/SwissProt
Match: sp|Q5RBR8|IF4H_PONAB (Eukaryotic translation initiation factor 4H OS=Pongo abelii OX=9601 GN=EIF4H PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.558e-12
Identity = 29/66 (43.94%), Postives = 50/66 (75.76%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            +I  +F    I + R++RD++TD+FKG+ YVEF +  SL+EAL+++ A +G+  L+V++AEGRK++
Sbjct:   57 DIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 122          

HSP 2 Score: 51.9878 bits (123), Expect = 2.230e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   35 ELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIR 68          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. TrEMBL
Match: T1L2B2 (RRM domain-containing protein OS=Tetranychus urticae OX=32264 GN=107369648 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 6.624e-18
Identity = 80/251 (31.87%), Postives = 117/251 (46.61%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQNNXXXXXXXXXXXXXXXXXXXXXXXXXFAQNNIDSQNEIVNRGNFFPSR--GQGSRPNNQQYKNERYPNNQYKDTEGFNRVYHGARNRGGNNFSANRGAGNFYNDNRLRNDSERXXXXXXXXXXXXXXXXXXXXXAIAQKDRPRLRLLPRSIDAPLNEQIHSERTAAIFGLGKPREASPIREKR 891
            +I  +F    I   R++RD+ETD FKGY +VEF D +SL+++L  + A     +L+++  + ++K+QN     G  R RG   N   +     GF            NRGNFF  R  G+G   NN++     Y +  Y D     R +     RG NNF      GN Y  NR  N+ ER                  +   IA  +RP+L+LLPR+   P+N+   ++   AIFG  KPR+     E+R
Sbjct:   63 DIDVIFKSLKISTARLVRDKETDIFKGYGFVEFHDVESLKKSLELDGAEYCGRVLRIHPCDNKRKDQNRNQRGGFDRNRGSQGNMNNRGRGTGGFVPQ---------NRGNFFNDREEGRGGFDNNRRGG---YNDRNYNDRGFRGRSFE---ERGKNNF------GNRYGGNRNFNNRER------KPAPVFEEFKEPTEEEIA--NRPKLKLLPRTKPTPVNDLAETKDRDAIFGGAKPRDEKVYEERR 284          

HSP 2 Score: 40.817 bits (94), Expect = 6.624e-18
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = 2
Query:   80 EPPYLAYVGNLPKNTVQGDFEKIFQ 154
            EPPY  YVGNLP NTVQGD + IF+
Sbjct:   45 EPPYQIYVGNLPPNTVQGDIDVIFK 69          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. TrEMBL
Match: A0A443SWJ3 (Eukaryotic translation initiation factor 4H-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_04013 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.436e-17
Identity = 79/250 (31.60%), Postives = 122/250 (48.80%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQNNXXXXXXXXXXXXXXXXXXXXXXXXXFAQNNIDSQNEIVNRGNFFPSRGQGSRPNNQQYKNERYPNNQYKDTEGFNRVYHGARNRGGNNFSANRGAGNFYNDNRLRNDSERXXXXXXXXXXXXXXXXXXXXXAIAQ-KDRPRLRLLPRSIDAPLNEQIHSERTAAIFGLGKPREASPIREKR 891
            +I  +F    I ++R++RD+ETD+FKGY +VEF D +SL++AL F+ A  G N+L+V+V + ++ E+    G         G      R+Q       ++  +    NRG +F  RG G R        ER     + D  GF   +    +RG  NF    G    +   R R ++               P   F  SA+    +RPRL+LLPRS++AP+N+   ++R +AIFG  KPR+     E+R
Sbjct:   66 DIDYIFKNLKIRSSRLVRDKETDKFKGYCFVEFYDVESLKQALEFDGADFGGNLLRVHVVDHKRNEKKGFAGGRGGGASRVGTGYDRNRSQG-----QSVRGRGFQQNRGGYFNDRG-GDRQGRPGQDRER-----FGDQRGFRSGFGDRSDRGRGNFGGRYGG---FTKGRERRNTP--------------PSEDFKESAVGDGTERPRLKLLPRSVEAPVNDVAETKRRSAIFGEAKPRDERVYEERR 287          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. TrEMBL
Match: V9L529 (Eukaryotic translation initiation factor 4H OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.331e-16
Identity = 29/69 (42.03%), Postives = 50/69 (72.46%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQNN 351
            +I  +F    + + R++RD+ETD+FKG+ YVEF D +SLEE+L+F+ A  G+  L+V++AE R++++  
Sbjct:   49 DIDLIFKDLRVRSIRLVRDKETDKFKGFCYVEFDDLESLEESLTFDGALYGDRTLRVDIAESRRQDKGG 117          

HSP 2 Score: 43.1282 bits (100), Expect = 6.331e-16
Identity = 20/47 (42.55%), Postives = 29/47 (61.70%), Query Frame = 2
Query:   26 FCNQRKLKIS----VMANQIPSEPPYLAYVGNLPKNTVQGDFEKIFQ 154
            F  +RK +          ++P+EPP+ A+VGNLP N VQGD + IF+
Sbjct:    9 FGGRRKPRAGGDCPRRQKELPTEPPFTAFVGNLPFNAVQGDIDLIFK 55          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. TrEMBL
Match: V9LA30 (Eukaryotic translation initiation factor 4H OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.337e-16
Identity = 29/69 (42.03%), Postives = 50/69 (72.46%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQNN 351
            +I  +F    + + R++RD+ETD+FKG+ YVEF D +SLEE+L+F+ A  G+  L+V++AE R++++  
Sbjct:   49 DIDLIFKDLRVRSIRLVRDKETDKFKGFCYVEFDDLESLEESLTFDGALYGDRTLRVDIAESRRQDKGG 117          

HSP 2 Score: 43.1282 bits (100), Expect = 6.337e-16
Identity = 20/47 (42.55%), Postives = 29/47 (61.70%), Query Frame = 2
Query:   26 FCNQRKLKIS----VMANQIPSEPPYLAYVGNLPKNTVQGDFEKIFQ 154
            F  +RK +          ++P+EPP+ A+VGNLP N VQGD + IF+
Sbjct:    9 FGGRRKPRAGGDCPRRQKELPTEPPFTAFVGNLPFNAVQGDIDLIFK 55          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. TrEMBL
Match: V4A9B2 (RRM domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_69072 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.179e-16
Identity = 31/66 (46.97%), Postives = 51/66 (77.27%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKE 342
            ++  +F    + + R++RDR+TDEFKG+AYVEF D +SL+EAL+++ A + +  L+V+VAEGR+K+
Sbjct:   52 DLEEIFRDLKVHSVRLVRDRDTDEFKGFAYVEFDDIESLKEALTYDGALLEDKNLRVDVAEGRRKD 117          

HSP 2 Score: 43.5134 bits (101), Expect = 8.179e-16
Identity = 16/29 (55.17%), Postives = 22/29 (75.86%), Query Frame = 2
Query:   71 IPSEPPYLAYVGNLPKNTVQGDFEKIFQQ 157
            +P+EPPY  Y+GNLP+  VQ D E+IF+ 
Sbjct:   31 LPTEPPYTCYIGNLPRGVVQMDLEEIFRD 59          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Cavefish
Match: eif4h (eukaryotic translation initiation factor 4H [Source:NCBI gene;Acc:103040479])

HSP 1 Score: 74.7146 bits (182), Expect = 7.392e-15
Identity = 31/69 (44.93%), Postives = 52/69 (75.36%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQNN 351
            +I  +F    + + R++RD+ETD+FKG+ YVEF D +SL+EAL+++ A +G+  L+V++AEGRK+E+  
Sbjct:   59 DIDAIFKDLSVRSVRLVRDKETDKFKGFCYVEFDDLESLKEALTYDGALLGDRSLRVDIAEGRKQERGG 127          

HSP 2 Score: 51.2174 bits (121), Expect = 5.566e-7
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPPY AYVGNLP NTVQGD + IF+  S +
Sbjct:   37 ELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSVR 70          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Sea Lamprey
Match: eif4h (eukaryotic translation initiation factor 4h [Source:ZFIN;Acc:ZDB-GENE-010328-19])

HSP 1 Score: 70.4774 bits (171), Expect = 8.328e-14
Identity = 30/67 (44.78%), Postives = 50/67 (74.63%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQ 345
            +I  +F    + + R++RDR+TD+FKG+ YVEF D +SL+EAL+++ A   +  L+++VAEGRK+E+
Sbjct:   70 DIDQIFQDLRVRSIRLVRDRDTDKFKGFCYVEFDDIESLQEALTYDGALFMDRSLRIDVAEGRKQEK 136          

HSP 2 Score: 50.8322 bits (120), Expect = 2.108e-7
Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 2
Query:   71 IPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFKLRS 178
            +P+EPPY AYVGNLP NTVQGD ++IFQ    ++RS
Sbjct:   49 LPTEPPYTAYVGNLPFNTVQGDIDQIFQ--DLRVRS 82          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Nematostella
Match: EDO39655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E2])

HSP 1 Score: 68.5514 bits (166), Expect = 1.442e-14
Identity = 29/64 (45.31%), Postives = 45/64 (70.31%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRK 336
            ++  +F    I N R++RD+ETD FKG+ YVEF DP+SL  AL FN A + +  ++V++AEG++
Sbjct:   30 DLDQIFADLRIRNVRLVRDKETDRFKGFCYVEFEDPESLTAALEFNGALVNDRQIRVDIAEGKR 93          

HSP 2 Score: 46.9802 bits (110), Expect = 6.855e-7
Identity = 18/34 (52.94%), Postives = 26/34 (76.47%), Query Frame = 2
Query:   68 QIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCSFK 169
            ++P+EPP+ A+VGNLP NTVQGD ++IF     +
Sbjct:    8 RMPTEPPFTAFVGNLPINTVQGDLDQIFADLRIR 41          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Medaka
Match: eif4h (eukaryotic translation initiation factor 4H [Source:NCBI gene;Acc:101167018])

HSP 1 Score: 74.3294 bits (181), Expect = 8.949e-15
Identity = 31/68 (45.59%), Postives = 53/68 (77.94%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQN 348
            +I  +F +  I + R++RD+ETD+FKG+ YVEF D +SL+EAL+++ A +G+  L+V++AEGR++E+ 
Sbjct:   61 DIDIIFKELNIRSVRLVRDKETDKFKGFCYVEFEDLESLKEALTYDGALLGDRSLRVDIAEGRRQERG 128          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Medaka
Match: eif4h (eukaryotic translation initiation factor 4H [Source:NCBI gene;Acc:101167018])

HSP 1 Score: 74.3294 bits (181), Expect = 1.244e-14
Identity = 31/68 (45.59%), Postives = 53/68 (77.94%), Query Frame = 1
Query:  145 NISTVFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQN 348
            +I  +F +  I + R++RD+ETD+FKG+ YVEF D +SL+EAL+++ A +G+  L+V++AEGR++E+ 
Sbjct:   61 DIDIIFKELNIRSVRLVRDKETDKFKGFCYVEFEDLESLKEALTYDGALLGDRSLRVDIAEGRRQERG 128          
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Planmine SMEST
Match: SMESG000058217.1 (SMESG000058217.1)

HSP 1 Score: 435.647 bits (1119), Expect = 8.109e-153
Identity = 270/276 (97.83%), Postives = 272/276 (98.55%), Query Frame = 1
Query:  157 VFFQT*IVNTRMIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKKEQNNXXXXXXXXXXXXXXXXXXXXXXXXXFAQNNIDSQNEIVNRGNFFPSRGQGSRPNNQQYKNERYPNNQYKDTEGFNRVYHGARNRGGNNFSANRGAGNFYNDNRLRNDSERXXXXXXXXXXXXXXXXXXXXXAIAQKDRPRLRLLPRSIDAPLNEQIHSERTAAIFGLGKPREASPIREKRVSNLSGDSIENKSRPHSRVSEECSDNMHKDE 984
            +F Q  IVNTRMIRDRETDEFKGYAYVEFSDPQSL+EALSFNKARIGENILKVNVAEGRKKEQNNRTGQGHFRGRGRGNNRYGQRNQANGFAQNNIDSQNEIVNRGNFFPSRGQGSRPNNQQYKNERY NNQYKDTEGFNRVYHGARNRGGNNFSANRGAGNFYNDNRLRNDSERSVGSSNGGKSSNIPESSFSNSAIAQKDRPRLRLLPRSIDAPLNEQIHSERTAAIFGLGKPREASPIREKRVSNLSGDSIENKSRPHSRVSEECSDNMHKDE
Sbjct:   30 IFQQCSIVNTRMIRDRETDEFKGYAYVEFSDPQSLDEALSFNKARIGENILKVNVAEGRKKEQNNRTGQGHFRGRGRGNNRYGQRNQANGFAQNNIDSQNEIVNRGNFFPSRGQGSRPNNQQYKNERYSNNQYKDTEGFNRVYHGARNRGGNNFSANRGAGNFYNDNRLRNDSERSVGSSNGGKSSNIPESSFSNSAIAQKDRPRLRLLPRSIDAPLNEQIHSERTAAIFGLGKPREASPIREKRVSNLSGDSIENKSRPHSRVSEECSDNMHKDE 305          

HSP 2 Score: 80.1073 bits (196), Expect = 1.718e-16
Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 2
Query:   59 MANQIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCS 163
            MANQIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCS
Sbjct:    1 MANQIPSEPPYLAYVGNLPKNTVQGDFEKIFQQCS 35          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EIF4H3.036e-1343.94eukaryotic translation initiation factor 4H [Sourc... [more]
EIF4H3.144e-1343.94eukaryotic translation initiation factor 4H [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
drr-23.556e-640.00Dietary Restriction Response (WT but not eat-2 lif... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eIF4H26.151e-738.24gene:FBgn0039797 transcript:FBtr0339513[more]
eIF4H26.151e-738.24gene:FBgn0039797 transcript:FBtr0085699[more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eif4h1.775e-1143.33eukaryotic translation initiation factor 4h [Sourc... [more]
eif4h3.083e-1143.33eukaryotic translation initiation factor 4h [Sourc... [more]
eif4h3.250e-1143.33eukaryotic translation initiation factor 4h [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tfec4.303e-1243.94transcription factor EC [Source:Xenbase;Acc:XB-GEN... [more]
tfec4.637e-1243.94transcription factor EC [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Eif4h1.909e-1343.94eukaryotic translation initiation factor 4H [Sourc... [more]
Eif4h1.932e-1343.94eukaryotic translation initiation factor 4H [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WUK2|IF4H_MOUSE1.336e-1243.94Eukaryotic translation initiation factor 4H OS=Mus... [more]
sp|Q5XI72|IF4H_RAT1.400e-1243.94Eukaryotic translation initiation factor 4H OS=Rat... [more]
sp|Q1JPH6|IF4H_BOVIN1.431e-1243.94Eukaryotic translation initiation factor 4H OS=Bos... [more]
sp|Q15056|IF4H_HUMAN1.510e-1243.94Eukaryotic translation initiation factor 4H OS=Hom... [more]
sp|Q5RBR8|IF4H_PONAB1.558e-1243.94Eukaryotic translation initiation factor 4H OS=Pon... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1L2B26.624e-1831.87RRM domain-containing protein OS=Tetranychus urtic... [more]
A0A443SWJ31.436e-1731.60Eukaryotic translation initiation factor 4H-like p... [more]
V9L5296.331e-1642.03Eukaryotic translation initiation factor 4H OS=Cal... [more]
V9LA306.337e-1642.03Eukaryotic translation initiation factor 4H OS=Cal... [more]
V4A9B28.179e-1646.97RRM domain-containing protein (Fragment) OS=Lottia... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif4h7.392e-1544.93eukaryotic translation initiation factor 4H [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif4h8.328e-1444.78eukaryotic translation initiation factor 4h [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO396551.442e-1445.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eif4h8.949e-1545.59eukaryotic translation initiation factor 4H [Sourc... [more]
eif4h1.244e-1445.59eukaryotic translation initiation factor 4H [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4H-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058217.18.109e-15397.83SMESG000058217.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013357 ID=SMED30013357|Name=Eukaryotic translation initiation factor 4H-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1295bp
CTCTTCCGATCTGTTTGTTATTTTATTCTGTAATCAGCGAAAATTGAAAA
TATCTGTCATGGCGAATCAAATTCCTAGTGAACCTCCTTATTTAGCATAT
GTTGGTAATTTACCTAAGAATACGGTACAAGGCGATTTTGAAAAAATATT
TCAACAGTGTTCTTTCAAACTTAGATCGTGAATACGCGGATGATTCGCGA
TAGAGAAACGGATGAATTTAAAGGTTACGCATATGTTGAGTTTTCAGATC
CTCAATCGTTAGAGGAAGCTTTAAGTTTTAATAAAGCGCGAATTGGGGAA
AATATTCTTAAAGTAAATGTCGCAGAAGGAAGAAAGAAGGAACAAAACAA
TAGAACTGGCCAAGGACATTTCAGAGGTCGAGGTCGCGGAAATAATCGAT
ATGGCCAAAGAAATCAAGCTAATGGATTTGCTCAAAATAATATTGATTCT
CAAAATGAAATAGTCAATCGAGGAAATTTTTTCCCATCACGAGGTCAAGG
TAGCAGGCCAAATAATCAACAATATAAAAATGAAAGATATCCTAATAATC
AATACAAAGACACTGAAGGTTTTAACCGCGTTTATCATGGTGCTAGAAAT
CGGGGAGGAAATAATTTTTCTGCTAACCGTGGCGCTGGCAATTTCTATAA
TGATAATCGTTTACGCAACGACAGTGAGAGAAGTGTTGGTAGTAGTAATG
GTGGGAAATCTAGTAATATACCGGAAAGTAGTTTTTCTAATAGTGCCATC
GCCCAAAAAGATAGACCAAGATTAAGGCTTCTTCCAAGATCTATAGACGC
TCCATTGAATGAGCAAATACATTCTGAGCGTACTGCTGCTATATTTGGGC
TAGGTAAGCCCAGAGAAGCTAGTCCGATTAGAGAAAAGCGTGTTTCGAAT
TTATCAGGCGATTCAATAGAAAATAAATCAAGACCACATAGTCGTGTATC
AGAAGAATGTTCAGACAATATGCATAAGGATGAATGATGGATTTTATTCA
TATATCTATGACAAAATTTAACTTTCAAAACAGTCTACTGTTGTTGTTGT
GTTTAATTGAATTTAGAATATTCCTCCATATCAATAATGGATGAAGTAAT
GGCGTTATATTTCCGTTACAATTGGTATATTGATTCGAATTGTACAAATT
TAGTATTTAATGTAAAATAAATAATTGAAAGAAATGCCTTAAATATATAC
ATATTTTTTGTTTTGTCTTGTTATCTTTAAATCTATTATGACAGATTAAA
TGTTATTTATTTTTCTTTGGTGGAATTATCTTGAGTGTATTCTGG
back to top

protein sequence of SMED30013357-orf-1

>SMED30013357-orf-1 ID=SMED30013357-orf-1|Name=SMED30013357-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=266bp
MIRDRETDEFKGYAYVEFSDPQSLEEALSFNKARIGENILKVNVAEGRKK
EQNNRTGQGHFRGRGRGNNRYGQRNQANGFAQNNIDSQNEIVNRGNFFPS
RGQGSRPNNQQYKNERYPNNQYKDTEGFNRVYHGARNRGGNNFSANRGAG
NFYNDNRLRNDSERSVGSSNGGKSSNIPESSFSNSAIAQKDRPRLRLLPR
SIDAPLNEQIHSERTAAIFGLGKPREASPIREKRVSNLSGDSIENKSRPH
SRVSEECSDNMHKDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003743translation initiation factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR012677Nucleotide-bd_a/b_plait_sf
IPR000504RRM_dom
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 1..40
e-value: 2.2E-4
score: 21.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 1..47
score: 9.303
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..84
e-value: 3.9E-11
score: 45.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 139..156
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..69
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 163..188
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 98..125
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 245..265
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 138..188
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 220..265
NoneNo IPR availablePANTHERPTHR23236:SF11EUKARYOTIC TRANSLATION INITIATION FACTOR 4Hcoord: 1..249
NoneNo IPR availablePANTHERPTHR23236EUKARYOTIC TRANSLATION INITIATION FACTOR 4B/4Hcoord: 1..249
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 1..76