Guanylate cyclase domain-containing protein

Overview
NameGuanylate cyclase domain-containing protein
Smed IDSMED30013355
Length (bp)2293
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase domain-containing protein (SMED30013355) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase domain-containing protein (SMED30013355) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013355

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013355SMESG000035922.1 SmedASXL_011615SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013355SMESG000035922.1 dd_Smed_v4_18111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013355SMESG000035922.1 dd_Smed_v6_18111_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30013355SMESG000035922.1 OX_Smed_1.0.10775ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 320.087 bits (819), Expect = 8.592e-99
Identity = 214/616 (34.74%), Postives = 327/616 (53.08%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +AS+ LN+   EI+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q +E  D+    I       ++F +  D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK      W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLEHRGPVSMKGKKEPMQVWF 603          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 308.916 bits (790), Expect = 2.607e-94
Identity = 215/638 (33.70%), Postives = 328/638 (51.41%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFL----------------------NGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +AS+ LN+   EI+ + G  F  F  + GYD ILRVLG ++R+FL                      N LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q +E  D+    I       ++F +  D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK      W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQKNESKHISDLHHCFLGIYLCCNNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLEHRGPVSMKGKKEPMQVWF 625          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 306.22 bits (783), Expect = 8.312e-94
Identity = 204/575 (35.48%), Postives = 311/575 (54.09%), Query Frame = 1
Query:  283 VYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            +Y ++   +++ +AS+ LN+   EI+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q +E  D+    I       ++F +  D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK      W 
Sbjct:   22 IYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLEHRGPVSMKGKKEPMQVWF 583          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 305.834 bits (782), Expect = 4.110e-93
Identity = 204/575 (35.48%), Postives = 311/575 (54.09%), Query Frame = 1
Query:  283 VYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            +Y ++   +++ +AS+ LN+   EI+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q +E  D+    I       ++F +  D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK      W 
Sbjct:   74 IYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLEHRGPVSMKGKKEPMQVWF 635          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 291.582 bits (745), Expect = 7.788e-89
Identity = 197/546 (36.08%), Postives = 293/546 (53.66%), Query Frame = 1
Query:  370 GIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q +E  D+    I       ++F +  D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK      W 
Sbjct:    3 GKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLEHRGPVSMKGKKEPMQVWF 535          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-31 (Soluble guanylate cyclase gcy-31 [Source:UniProtKB/Swiss-Prot;Acc:Q86C56])

HSP 1 Score: 496.123 bits (1276), Expect = 6.413e-166
Identity = 281/628 (44.75%), Postives = 408/628 (64.97%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQ-----------IEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP-KISSSKILREGNHSSKKRTLSRNNPS-------LKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKV--TDLQSYKISERGHIDIKGKGNIKTYWL----DGHNLENPKAVAS 1971
            MYGLI++ +  +I  KYGE  W+ +   + +   TF   + + E L   +I +        VDE+M   G  F  F++++ ++ +LRVLGR    FLNGLDNLHEYLRF++PKLKPPSF+C +ES+TG+TL YR++R G++HYV+GQI  I+++ + TE+ IE++    + N+ + IMRLHFNN +F +           I + + + S++FF++FPF IVFNRGMR  N G G+L  +  +  + I + FLL RP I F W+ +MLH+NNIFELI  DP +     IL        + T  R+          L ++GQM YM EW++I F+G P+M  +  MYK+GLFIND ++HDSSRDLVLA  QQSAELKL L QE++KS+ + E++++L +  ++TD+LL+QM+PKSVA +LRHG  AV  CE FD VTILF+D+V FT +CS + P +V+E L  +Y+ FD++ + H VYKVETIGDAYM+ SG PT T++ A FI++ +   +   G +++ ++    + IR G+H+G VVAGVVGL MPRYCLFG+TV  A++ME NS P KI +SE T  K+  +D   Y+   R  I+IK    I+T+++      H + +P+   S
Sbjct:    1 MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGDPVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFYCEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRLHFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMAGIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMTEERHRMGDGEREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDSSRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLRHGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKVETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVVAGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIEIKDDQTIQTFFVVSRHGPHRVPSPRNCES 628          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-31 (Soluble guanylate cyclase gcy-31 [Source:UniProtKB/Swiss-Prot;Acc:Q86C56])

HSP 1 Score: 472.241 bits (1214), Expect = 2.983e-157
Identity = 265/567 (46.74%), Postives = 380/567 (67.02%), Query Frame = 1
Query:  346 VDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQ-----------IEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP-KISSSKILREGNHSSKKRTLSRNNPS-------LKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKV--TDLQSYKISERGHIDIKGKGNIKTYWL----DGHNLENPKAVAS 1971
            VDE+M   G  F  F++++ ++ +LRVLGR    FLNGLDNLHEYLRF++PKLKPPSF+C +ES+TG+TL YR++R G++HYV+GQI  I+++ + TE+ IE++    + N+ + IMRLHFNN +F +           I + + + S++FF++FPF IVFNRGMR  N G G+L  +  +  + I + FLL RP I F W+ +MLH+NNIFELI  DP +     IL        + T  R+          L ++GQM YM EW++I F+G P+M  +  MYK+GLFIND ++HDSSRDLVLA  QQSAELKL L QE++KS+ + E++++L +  ++TD+LL+QM+PKSVA +LRHG  AV  CE FD VTILF+D+V FT +CS + P +V+E L  +Y+ FD++ + H VYKVETIGDAYM+ SG PT T++ A FI++ +   +   G +++ ++    + IR G+H+G VVAGVVGL MPRYCLFG+TV  A++ME NS P KI +SE T  K+  +D   Y+   R  I+IK    I+T+++      H + +P+   S
Sbjct:   25 VDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFYCEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRLHFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMAGIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMTEERHRMGDGEREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDSSRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLRHGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKVETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVVAGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIEIKDDQTIQTFFVVSRHGPHRVPSPRNCES 591          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-31 (Soluble guanylate cyclase gcy-31 [Source:UniProtKB/Swiss-Prot;Acc:Q86C56])

HSP 1 Score: 377.867 bits (969), Expect = 8.645e-122
Identity = 222/495 (44.85%), Postives = 323/495 (65.25%), Query Frame = 1
Query:  562 RTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQ-----------IEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP-KISSSKILREGNHSSKKRTLSRNNPS-------LKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKV--TDLQSYKISERGHIDIKGKGNIKTYWL----DGHNLENPKAVAS 1971
            R++R G++HYV+GQI  I+++ + TE+ IE++    + N+ + IMRLHFNN +F +           I + + + S++FF++FPF IVFNRGMR  N G G+L  +  +  + I + FLL RP I F W+ +MLH+NNIFELI  DP +     IL        + T  R+          L ++GQM YM EW++I F+G P+M  +  MYK+GLFIND ++HDSSRDLVLA  QQSAELKL L QE++KS+ + E++++L +  ++TD+LL+QM+PKSVA +LRHG  AV  CE FD VTILF+D+V FT +CS + P +V+E L  +Y+ FD++ + H VYKVETIGDAYM+ SG PT T++ A FI++ +   +   G +++ ++    + IR G+H+G VVAGVVGL MPRYCLFG+TV  A++ME NS P KI +SE T  K+  +D   Y+   R  I+IK    I+T+++      H + +P+   S
Sbjct:   10 RSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRLHFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMAGIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMTEERHRMGDGEREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDSSRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLRHGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKVETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVVAGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIEIKDDQTIQTFFVVSRHGPHRVPSPRNCES 504          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-33 (Soluble guanylate cyclase gcy-33 [Source:UniProtKB/Swiss-Prot;Acc:P90895])

HSP 1 Score: 367.466 bits (942), Expect = 7.091e-114
Identity = 226/618 (36.57%), Postives = 364/618 (58.90%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQ----------IEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSK--------ILREGNHSSKKRTLSRNN----PSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAER-LRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSI-GFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRME-SNSEPQKIHISEATKAKVTDLQS--YKISERGHIDIKGKGNIKTYWLD 1935
            MYGL++EGVR  I   +G      + +   +   +  TH+ Y E ++P + ++         ++I  L G FF+ F+ + GY  ++ V+GR   DF+ GLDN+HEY RFSYPKL+ PSF+C +ES+ G+ L YR+RR+GY+ YV GQ+ E+AR FY  ++ I+++ +  +   +  ++++ F+N    Q          + + LPV ++ F ++FPF+I FN+ +  +  G+G+LN +P++   L+T+ F L RP I+FT + +M+H N +F++  L P +  ++         + E   S +K+T+  N     P + +RG +  +   +  + L T ++  +++M+K GL++ND    D +R++++A  Q+S  LK  LE E  +S+ L E   ++ E  K    LL QM+P  VA+  +R GS  VD CE F+ V+I F  V  F+ I   I  F+VV +LN +YS  D + + H VYKVETIG++YMI++GCP    Y A  + +  L+M+  I  F     D  + + I+ GI TG VV GVVG++ PRYCLFGDTVNTASRME SN  P  I I + TK +V    S  ++I  +G++ +KGKG+++ Y ++
Sbjct:    1 MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLSEKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIRNGYGDLMNVMGRRFSDFIKGLDNIHEYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQLDIGIQVLKKKEKGRFTFVVLKISFDNVGLGQDLKLKERVKNLNEYLPVDTKSFLQMFPFHIAFNKKLEILMAGQGLLNLMPNIQGLLMTDVFDLQRPCIKFTAEGIMVHQNCVFQIESLHPVVKQTEENITVQINDITEDKVSLEKKTVMDNEYESLPYVTLRGPITVLKSSETFLLLATCVVDTLDTMFKMGLYLNDFGESDCNREIIMATIQKSDTLKTMLENEKRRSEVLTEMTREISEAKKTARTLLTQMMPYEVAQTMMRSGS--VDHCEAFECVSIGFIRVCDFSKISLFIEAFEVVNLLNTIYSHLDSIVDTHGVYKVETIGESYMISAGCPYRDDYDAEMVSDCCLEMVSHIKSFEYQSHDAVKKVLIKCGIFTGPVVGGVVGVRTPRYCLFGDTVNTASRMESSNQTPMTIQIGQRTKDRVEKQASGAFRIKPKGNVFVKGKGDMRVYEIE 616          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-33 (Soluble guanylate cyclase gcy-33 [Source:UniProtKB/Swiss-Prot;Acc:P90895])

HSP 1 Score: 367.081 bits (941), Expect = 1.054e-113
Identity = 226/620 (36.45%), Postives = 364/620 (58.71%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQ----------IEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSK--------ILREGNHSSKKRTLSRNN------PSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAER-LRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSI-GFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRME-SNSEPQKIHISEATKAKVTDLQS--YKISERGHIDIKGKGNIKTYWLD 1935
            MYGL++EGVR  I   +G      + +   +   +  TH+ Y E ++P + ++         ++I  L G FF+ F+ + GY  ++ V+GR   DF+ GLDN+HEY RFSYPKL+ PSF+C +ES+ G+ L YR+RR+GY+ YV GQ+ E+AR FY  ++ I+++ +  +   +  ++++ F+N    Q          + + LPV ++ F ++FPF+I FN+ +  +  G+G+LN +P++   L+T+ F L RP I+FT + +M+H N +F++  L P +  ++         + E   S +K+T+  N       P + +RG +  +   +  + L T ++  +++M+K GL++ND    D +R++++A  Q+S  LK  LE E  +S+ L E   ++ E  K    LL QM+P  VA+  +R GS  VD CE F+ V+I F  V  F+ I   I  F+VV +LN +YS  D + + H VYKVETIG++YMI++GCP    Y A  + +  L+M+  I  F     D  + + I+ GI TG VV GVVG++ PRYCLFGDTVNTASRME SN  P  I I + TK +V    S  ++I  +G++ +KGKG+++ Y ++
Sbjct:    1 MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLSEKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIRNGYGDLMNVMGRRFSDFIKGLDNIHEYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQLDIGIQVLKKKEKGRFTFVVLKISFDNVGLGQDLKLKERVKNLNEYLPVDTKSFLQMFPFHIAFNKKLEILMAGQGLLNLMPNIQGLLMTDVFDLQRPCIKFTAEGIMVHQNCVFQIESLHPVVKQTEENITVQINDITEDKVSLEKKTVMDNEYGLESLPYVTLRGPITVLKSSETFLLLATCVVDTLDTMFKMGLYLNDFGESDCNREIIMATIQKSDTLKTMLENEKRRSEVLTEMTREISEAKKTARTLLTQMMPYEVAQTMMRSGS--VDHCEAFECVSIGFIRVCDFSKISLFIEAFEVVNLLNTIYSHLDSIVDTHGVYKVETIGESYMISAGCPYRDDYDAEMVSDCCLEMVSHIKSFEYQSHDAVKKVLIKCGIFTGPVVGGVVGVRTPRYCLFGDTVNTASRMESSNQTPMTIQIGQRTKDRVEKQASGAFRIKPKGNVFVKGKGDMRVYEIE 618          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0110961)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 314/603 (52.07%), Postives = 420/603 (69.65%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNF-------IQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP-----KISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLD 1935
            MYGL+LE + ++I S YGE+ W  I R A ID  +F  H+VY E L+  + + A + L ++  + M   G++F+ FV QYGYD +L VLGR +RDFLNGLDNLHEYL+FSYP+++ PSF C NE+K G+TL YR++R G+++Y  GQI E+AR FY  EM IE+V +    +  +   +L F+N+ F        + E  LP+ + V FE+FPF +VF   M   + G  ++  LP+L  + IT +F L RPLI F +  ++  TNNIFEL+ +DP      + +  +L+  + S  ++       SL+++GQM YM  W  I+FLGTP+M D+ S+   GL+INDLSMHD SRDL+LAG QQS ELKLAL+QE +KSKKLEES+  LDE M++TDELL+QMIPK VA+RLR G   +DTCE FD V+ILFSD+V FT ICS+I P +VV MLN +YS+FD+LTE++ VYKVETIGDAYM+ +G P     HA  + +M+LDM+ +I  L DPS   + L+IRVG+H+G VVAG+VGLKMPRYCLFGDTVNTASRMES S   K+HISE+TK  +    +YKI ERG ID+KGKG + TYWL+
Sbjct:    1 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEK-------SLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPST-GQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIG--PNYKIIERGEIDVKGKGTMGTYWLE 593          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0306245)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 314/603 (52.07%), Postives = 420/603 (69.65%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNF-------IQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP-----KISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLD 1935
            MYGL+LE + ++I S YGE+ W  I R A ID  +F  H+VY E L+  + + A + L ++  + M   G++F+ FV QYGYD +L VLGR +RDFLNGLDNLHEYL+FSYP+++ PSF C NE+K G+TL YR++R G+++Y  GQI E+AR FY  EM IE+V +    +  +   +L F+N+ F        + E  LP+ + V FE+FPF +VF   M   + G  ++  LP+L  + IT +F L RPLI F +  ++  TNNIFEL+ +DP      + +  +L+  + S  ++       SL+++GQM YM  W  I+FLGTP+M D+ S+   GL+INDLSMHD SRDL+LAG QQS ELKLAL+QE +KSKKLEES+  LDE M++TDELL+QMIPK VA+RLR G   +DTCE FD V+ILFSD+V FT ICS+I P +VV MLN +YS+FD+LTE++ VYKVETIGDAYM+ +G P     HA  + +M+LDM+ +I  L DPS   + L+IRVG+H+G VVAG+VGLKMPRYCLFGDTVNTASRMES S   K+HISE+TK  +    +YKI ERG ID+KGKG + TYWL+
Sbjct:    1 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEK-------SLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPST-GQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIG--PNYKIIERGEIDVKGKGTMGTYWLE 593          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0334926)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 314/603 (52.07%), Postives = 420/603 (69.65%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNF-------IQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP-----KISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLD 1935
            MYGL+LE + ++I S YGE+ W  I R A ID  +F  H+VY E L+  + + A + L ++  + M   G++F+ FV QYGYD +L VLGR +RDFLNGLDNLHEYL+FSYP+++ PSF C NE+K G+TL YR++R G+++Y  GQI E+AR FY  EM IE+V +    +  +   +L F+N+ F        + E  LP+ + V FE+FPF +VF   M   + G  ++  LP+L  + IT +F L RPLI F +  ++  TNNIFEL+ +DP      + +  +L+  + S  ++       SL+++GQM YM  W  I+FLGTP+M D+ S+   GL+INDLSMHD SRDL+LAG QQS ELKLAL+QE +KSKKLEES+  LDE M++TDELL+QMIPK VA+RLR G   +DTCE FD V+ILFSD+V FT ICS+I P +VV MLN +YS+FD+LTE++ VYKVETIGDAYM+ +G P     HA  + +M+LDM+ +I  L DPS   + L+IRVG+H+G VVAG+VGLKMPRYCLFGDTVNTASRMES S   K+HISE+TK  +    +YKI ERG ID+KGKG + TYWL+
Sbjct:    1 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEK-------SLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPST-GQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIG--PNYKIIERGEIDVKGKGTMGTYWLE 593          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc32E (gene:FBgn0010197 transcript:FBtr0346610)

HSP 1 Score: 223.402 bits (568), Expect = 8.302e-61
Identity = 114/230 (49.57%), Postives = 152/230 (66.09%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLE 1989
            KKTD LL+QM+P+ VAE L+ G      C  FD VTILFSD+VGFT +C+   PF+VVEMLN  Y+  D +   + VYKVETIGDAYM+ SG P      HA  I  ++L +++++G L      + ++Q+R+G+H+G   AGVVG KMPRYCLFGDTVNTASRMES  +  +IHISEAT   +  + SY   ERG   IKGKG+++TYWL     + P+    LI+ ++
Sbjct:  832 KKTDMLLYQMLPRPVAELLKRGDPVEAEC--FDCVTILFSDIVGFTELCTTSTPFEVVEMLNDWYTCCDSIISNYDVYKVETIGDAYMVVSGLPLQNGSRHAGEIASLALHLLETVGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQVIGSYVCIERGLTSIKGKGDMRTYWLTKR--QQPELTPDLISTVD 1057          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc32E (gene:FBgn0010197 transcript:FBtr0112856)

HSP 1 Score: 223.402 bits (568), Expect = 9.021e-61
Identity = 114/230 (49.57%), Postives = 152/230 (66.09%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLE 1989
            KKTD LL+QM+P+ VAE L+ G      C  FD VTILFSD+VGFT +C+   PF+VVEMLN  Y+  D +   + VYKVETIGDAYM+ SG P      HA  I  ++L +++++G L      + ++Q+R+G+H+G   AGVVG KMPRYCLFGDTVNTASRMES  +  +IHISEAT   +  + SY   ERG   IKGKG+++TYWL     + P+    LI+ ++
Sbjct:  868 KKTDMLLYQMLPRPVAELLKRGDPVEAEC--FDCVTILFSDIVGFTELCTTSTPFEVVEMLNDWYTCCDSIISNYDVYKVETIGDAYMVVSGLPLQNGSRHAGEIASLALHLLETVGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQVIGSYVCIERGLTSIKGKGDMRTYWLTKR--QQPELTPDLISTVD 1093          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 310.842 bits (795), Expect = 1.083e-95
Identity = 208/615 (33.82%), Postives = 319/615 (51.87%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDLPHQL--ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQS----YKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG D W  I R A +DV   F    +Y +    +++ +AS+ L M    I+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K   + L Y + R G    V G I  +A+Q + TE+ ++++   SE  D++   I       + F +  D                  + FPF+++F++ +    CG  +   LP L   +  ++  F L RP I+F++  ++ H N +F L       S   +L      ++          L+++GQM  +PE + I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN +Y+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    D    +QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T   +  +++    + +  RG + +KGK      W 
Sbjct:    1 MYGFVNHALELLVLRNYGPDVWEDIKREAQVDVEGQFLVRIIYEDAKTYDLVAAASKVLKMDAGGILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSEECDHIKFLIEEKDSEEEAFYEDLDGFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQPGVCNLSSVFSLVRPHIDFSFHGILSHINTVFVLR------SKEGLLNVETAENEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEK-KKTDRLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDED---PVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMKVWF 603          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 304.679 bits (779), Expect = 1.969e-93
Identity = 205/604 (33.94%), Postives = 314/604 (51.99%), Query Frame = 1
Query:  196 FICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDLPHQL--ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQS----YKISERGHIDIKGKGNIKTYWL 1932
             +   YG D W  I R A +DV   F    +Y +    +++ +AS+ L M    I+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K   + L Y + R G    V G I  +A+Q + TE+ ++++   SE  D++   I       + F +  D                  + FPF+++F++ +    CG  +   LP L   +  ++  F L RP I+F++  ++ H N +F L       S   +L      ++          L+++GQM  +PE + I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN +Y+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    D    +QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T   +  +++    + +  RG + +KGK      W 
Sbjct:    6 LVLRNYGPDVWEDIKREAQVDVEGQFLVRIIYEDAKTYDLVAAASKVLKMDAGGILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSEECDHIKFLIEEKDSEEEAFYEDLDGFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQPGVCNLSSVFSLVRPHIDFSFHGILSHINTVFVLR------SKEGLLNVETAENEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEK-KKTDRLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDED---PVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMKVWF 597          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 247.669 bits (631), Expect = 9.108e-71
Identity = 153/385 (39.74%), Postives = 232/385 (60.26%), Query Frame = 1
Query:  784 NIVFNRGMRAINCGKGMLNALPDLPHQLIT--EYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            +IVF+  +   + G  +   +P L    I   EYF +  P + F   ++    N+ F L       +  ++L E         + +N P+LK+RGQM +M   + +++L +P +R ++ + + GL + D++ HD++RDL+L  +Q+ AE++L+ + E +K +    S +   E  +K+++LL+ M+P  VA +L+ G   V+  E F   TILFSDVV FT IC+   P  +V MLN +YS FD LT  H VYKVETIGDAYM+  G P  T  HA  +   +L M  +   + +P    + +QIRVG+HTG V+AGVVG KMPRYCLFGDTVNTASRMES+  P  IH+S  T + + D   ++++ERG I++KGKG ++TY+L
Sbjct:  276 HIVFDSDLVVKHTGVNIQKFVPGLQTAGIRLDEYFTIVHPEVIFNIQSIKKFINSQFVLK------TRREMLPE---------VQQNQPTLKLRGQMMWMESLNCMIYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKKEELRILSRNLEIEK-QKSEKLLYAMLPTHVANQLKEGKR-VEAGE-FKVCTILFSDVVTFTNICAACEPIQIVNMLNAMYSRFDRLTSIHNVYKVETIGDAYMVVGGVPVPTNTHAERVANFALGMRIAAREVTNPIT-GQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHVSPFTFSVIKDKGIFEMAERGEIEVKGKGLMRTYFL 641          

HSP 2 Score: 111.309 bits (277), Expect = 9.854e-25
Identity = 55/171 (32.16%), Postives = 96/171 (56.14%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSED 675
            MYG I   ++  +  ++GE+ W ++   A +   TF T+E+Y + +   +++ A + L+++ + ++ L G +F +F    GYD +LR LG +L +F+  LD LH YL  SY  +  PSF         I L Y + R G  H V G I  +A+ F+ +E+++ I++Q+ ED
Sbjct:    1 MYGFINTCLKSLVIERFGEETWENLRLMAGVQE-TFMTYEIYDDIITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEAMNAPSFRVERMDDGRILLHYYSDRKGLYHIVPGIIEAVAKDFFDSEVTMTILNQSEED 170          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 220.705 bits (561), Expect = 7.992e-61
Identity = 108/213 (50.70%), Postives = 148/213 (69.48%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDG 1938
            +K + LL+Q++P SVAE+L+ G E V   E FD VTI FSD+VGFT++ ++  P  VV +LN LY+ FD + +   VYKVETIGDAYM+ SG P    + H   I  MSL +++++            L++R+GIH+G V AGVVGLKMPRYCLFGDTVNT+SRMESN EP KIH+S AT+A + +   +++  RG +++KGKG ++TYWL G
Sbjct:  601 RKAEALLYQILPHSVAEQLKRG-ETVQA-EAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLG 811          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01078606.1 (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:100333871])

HSP 1 Score: 205.297 bits (521), Expect = 1.705e-60
Identity = 109/224 (48.66%), Postives = 140/224 (62.50%), Query Frame = 1
Query: 1330 MIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQ-YHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERER 1998
            M+PK VA+ LR G       + +   T+ FSD+VGFT + S   P+ VV+ LNKLY+ FDE+ + H VYKVETIGDAYM+ SG P      HA  I  M+LD++        P      LQIR GIH+G VVAGVVG KMPRYCLFGDTVNTASRMES SE  KI  S +    + ++  Y ++ RG + +KGKG++ TYWL+G   ++ K  A   TQ E E+
Sbjct:    1 MLPKQVADDLRLGKPM--QAQSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDEIIDNHDVYKVETIGDAYMVVSGVPRENGILHASEIANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAFYLLEEIGGYLLTCRGLLQVKGKGDMVTYWLEGKCSKDMKKPA---TQQESEK 219          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 314.309 bits (804), Expect = 9.942e-97
Identity = 211/616 (34.25%), Postives = 325/616 (52.76%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +A++ LN+   +I+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G +  +A+Q + TE+ ++++ Q +E  D+    I       ++F + +D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L       S   +L      S+          L+++GQM Y+PE D I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF T CSK         +V +LN +Y+ FD LT+      VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK +    W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVL------RSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLQYRGPVSMKGKTDPMQVWF 603          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 314.309 bits (804), Expect = 1.065e-96
Identity = 211/616 (34.25%), Postives = 325/616 (52.76%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +A++ LN+   +I+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G +  +A+Q + TE+ ++++ Q +E  D+    I       ++F + +D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L       S   +L      S+          L+++GQM Y+PE D I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF T CSK         +V +LN +Y+ FD LT+      VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK +    W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVL------RSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLQYRGPVSMKGKTDPMQVWF 603          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 313.923 bits (803), Expect = 1.553e-96
Identity = 211/616 (34.25%), Postives = 325/616 (52.76%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +A++ LN+   +I+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G +  +A+Q + TE+ ++++ Q +E  D+    I       ++F + +D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L       S   +L      S+          L+++GQM Y+PE D I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF T CSK         +V +LN +Y+ FD LT+      VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK +    W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVL------RSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLQYRGPVSMKGKTDPMQVWF 603          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 304.679 bits (779), Expect = 8.730e-93
Identity = 212/634 (33.44%), Postives = 326/634 (51.42%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFL------------------NGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +A++ LN+   +I+ + G  F  F  + GYD ILRVLG ++R+FL                  N LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G +  +A+Q + TE+ ++++ Q +E  D+    I       ++F + +D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L       S   +L      S+          L+++GQM Y+PE D I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF T CSK         +V +LN +Y+ FD LT+      VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK +    W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQHFIYIIDKKACFLLFPINNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVLR------SKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLQYRGPVSMKGKTDPMQVWF 621          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 283.878 bits (725), Expect = 2.247e-85
Identity = 201/615 (32.68%), Postives = 313/615 (50.89%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +A++ LN+   +I+ + G  F  F  + GYD ILRVLG ++R+FL               +++ P  F       G+ L Y + R G    V G +  +A+Q + TE+ ++++ Q +E  D+    I       ++F + +D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L       S   +L      S+          L+++GQM Y+PE D I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF T CSK         +V +LN +Y+ FD LT+      VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK +    W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFL---------------QVRKPFIFYYCFKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREEDFYEDQDRFEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRPHIDISFHGILSHINTVFVLR------SKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLQYRGPVSMKGKTDPMQVWF 587          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b1 (guanylate cyclase 1, soluble, beta 1 [Source:MGI Symbol;Acc:MGI:1860604])

HSP 1 Score: 319.316 bits (817), Expect = 9.418e-99
Identity = 212/615 (34.47%), Postives = 326/615 (53.01%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQS----YKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +AS+ LN+   EI+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q +E  D+    I       ++F +  D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T   +   ++    + +  RG + +KGK      W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPLFHLEHRGPVSMKGKKEPMQVWF 603          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b1 (guanylate cyclase 1, soluble, beta 1 [Source:MGI Symbol;Acc:MGI:1860604])

HSP 1 Score: 315.079 bits (806), Expect = 3.170e-97
Identity = 207/584 (35.45%), Postives = 315/584 (53.94%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKV 1851
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +AS+ LN+   EI+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q +E  D+    I       ++F +  D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T  K+
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRKL 572          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 243.047 bits (619), Expect = 1.092e-68
Identity = 154/385 (40.00%), Postives = 228/385 (59.22%), Query Frame = 1
Query:  784 NIVFNRGMRAINCGKGMLNALPDLPHQL--ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            ++VF+  +R    G  +   +P +  Q   + EYF +  P + F   ++    N+ F L          K  RE    + K     + P+LK+RGQM +M     +VF+ +P +R ++ + ++ + ++D++ HD++RDL+L  +Q+ AE++L+ + E +K +    S H   E  KKT+ LL+ M+P+ VA +L+ G +       F+  TILFSDVV FT IC+   P  +V MLN +YS FD LT  H VYKVETIGDAYM+  G P   + HA  +   +L M  S   +M+P      +QIRVGIHTG V+AGVVG KMPRYCLFGDTVNTASRMES+  P K+H+S  T  +  + + ++I  RG I++KGKG + TY+L
Sbjct:  357 HVVFDEALRVKQAGVNIQKYVPGILTQKFGLDEYFSIVHPQVTFNISSICKFINSQFIL----------KTRREMMPEAWK-----SQPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEK-KKTETLLYAMLPEHVANQLKEGKKVA--AGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVT-GEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLS-PTAHRALENKGFEIVTRGEIEVKGKGKMTTYFL 721          

HSP 2 Score: 114.005 bits (284), Expect = 1.523e-25
Identity = 56/170 (32.94%), Postives = 95/170 (55.88%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE 672
            MYG I   ++  +  K+GE+ W  +  SA++  + F T+ VY +T+   +I+ A + L+++++ I+ L G +F  F    GYD +LR LG +L +F+  LD LH YL  SY ++  PSF     +   + L Y + R G  H V G I  +A+ F+ T++++ I+    E
Sbjct:   82 MYGFINTCLQSLVTEKFGEETWEKLKASAEVQDV-FMTYTVYDDTITVKLIQEACKALDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEGGADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSILDMNEE 250          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 243.047 bits (619), Expect = 1.199e-68
Identity = 154/385 (40.00%), Postives = 228/385 (59.22%), Query Frame = 1
Query:  784 NIVFNRGMRAINCGKGMLNALPDLPHQL--ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            ++VF+  +R    G  +   +P +  Q   + EYF +  P + F   ++    N+ F L          K  RE    + K     + P+LK+RGQM +M     +VF+ +P +R ++ + ++ + ++D++ HD++RDL+L  +Q+ AE++L+ + E +K +    S H   E  KKT+ LL+ M+P+ VA +L+ G +       F+  TILFSDVV FT IC+   P  +V MLN +YS FD LT  H VYKVETIGDAYM+  G P   + HA  +   +L M  S   +M+P      +QIRVGIHTG V+AGVVG KMPRYCLFGDTVNTASRMES+  P K+H+S  T  +  + + ++I  RG I++KGKG + TY+L
Sbjct:  342 HVVFDEALRVKQAGVNIQKYVPGILTQKFGLDEYFSIVHPQVTFNISSICKFINSQFIL----------KTRREMMPEAWK-----SQPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEK-KKTETLLYAMLPEHVANQLKEGKKVA--AGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVT-GEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLS-PTAHRALENKGFEIVTRGEIEVKGKGKMTTYFL 706          

HSP 2 Score: 114.005 bits (284), Expect = 1.498e-25
Identity = 56/170 (32.94%), Postives = 95/170 (55.88%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE 672
            MYG I   ++  +  K+GE+ W  +  SA++  + F T+ VY +T+   +I+ A + L+++++ I+ L G +F  F    GYD +LR LG +L +F+  LD LH YL  SY ++  PSF     +   + L Y + R G  H V G I  +A+ F+ T++++ I+    E
Sbjct:   82 MYGFINTCLQSLVTEKFGEETWEKLKASAEVQDV-FMTYTVYDDTITVKLIQEACKALDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEGGADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSILDMNEE 250          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:MGI Symbol;Acc:MGI:2660877])

HSP 1 Score: 225.713 bits (574), Expect = 5.228e-63
Identity = 170/537 (31.66%), Postives = 274/537 (51.02%), Query Frame = 1
Query:  301 IPNIIESASRFLNMTVDEIM--FLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPK---LKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTS----EDNVSNCIMRLHF-------------NNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLIT--EYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT 1839
            +  I++  +  L +   EI   F    F I F      + +LR +G  L+DF NG D L E++R S+ K   L+  SF C    +  + L Y          + G I    ++ Y   + +E +          N SNC   L F             N +   Q+   L +    F   FPF+++F+  M  +  G+G+   L    H+ +   + F +  P+I  T+D V+L  +  F +I   P+ S ++                 +  ++++GQM ++PE  AI+FLG+P +  ++ +   GL ++D+ +HD++RD++L GEQ  A+  L    +  K+          +E  KKT +LL+ + P  VA++L            FD+VT+LFSD+VGFT IC++  P  V+ MLN+LY+ FD       +YKVETIGDAY +ASG    +  HA  I  M+L M++    ++ P    +++Q+R+GIH+G V+AGVVG++MPRYCLFG+ V  AS+ ES S P++I++S  T
Sbjct:  149 VSGILQCTANVLGLQFQEIQERFGEEFFKICFDEN---ERVLRAVGSTLQDFFNGFDALLEHIRTSFGKQATLESSSFLCKELPEGTLMLHYFHPHHTVGFAMLGMIKAAGKRIYHLNVEVEQIENEKLCFDGSNPSNCSC-LTFLIKECETTQITKDNPQGTSQVPADLRISINTFCRAFPFHLMFDSNMVVLQLGEGLRKQLRYDTHRALKFEDCFEIVSPMINATFDRVLLRLSTPF-VIRTKPEASGTE---------------NEDKVMEIKGQMIHVPESSAILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEK-KKTVDLLYSIFPGDVAQQLW--QGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGLLDIYKVETIGDAYCVASGLHRKSLCHAKPIALMALKMMELSEEVLTPD--GKAIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTT 660          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8INF0|GCY8E_DROME (Soluble guanylate cyclase 88E OS=Drosophila melanogaster OX=7227 GN=Gyc88E PE=1 SV=4)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 314/603 (52.07%), Postives = 420/603 (69.65%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNF-------IQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP-----KISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLD 1935
            MYGL+LE + ++I S YGE+ W  I R A ID  +F  H+VY E L+  + + A + L ++  + M   G++F+ FV QYGYD +L VLGR +RDFLNGLDNLHEYL+FSYP+++ PSF C NE+K G+TL YR++R G+++Y  GQI E+AR FY  EM IE+V +    +  +   +L F+N+ F        + E  LP+ + V FE+FPF +VF   M   + G  ++  LP+L  + IT +F L RPLI F +  ++  TNNIFEL+ +DP      + +  +L+  + S  ++       SL+++GQM YM  W  I+FLGTP+M D+ S+   GL+INDLSMHD SRDL+LAG QQS ELKLAL+QE +KSKKLEES+  LDE M++TDELL+QMIPK VA+RLR G   +DTCE FD V+ILFSD+V FT ICS+I P +VV MLN +YS+FD+LTE++ VYKVETIGDAYM+ +G P     HA  + +M+LDM+ +I  L DPS   + L+IRVG+H+G VVAG+VGLKMPRYCLFGDTVNTASRMES S   K+HISE+TK  +    +YKI ERG ID+KGKG + TYWL+
Sbjct:    1 MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEK-------SLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPST-GQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIG--PNYKIIERGEIDVKGKGTMGTYWLE 593          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86C56|GCY31_CAEEL (Soluble guanylate cyclase gcy-31 OS=Caenorhabditis elegans OX=6239 GN=gcy-31 PE=2 SV=2)

HSP 1 Score: 496.123 bits (1276), Expect = 8.158e-165
Identity = 281/628 (44.75%), Postives = 408/628 (64.97%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQ-----------IEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP-KISSSKILREGNHSSKKRTLSRNNPS-------LKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKV--TDLQSYKISERGHIDIKGKGNIKTYWL----DGHNLENPKAVAS 1971
            MYGLI++ +  +I  KYGE  W+ +   + +   TF   + + E L   +I +        VDE+M   G  F  F++++ ++ +LRVLGR    FLNGLDNLHEYLRF++PKLKPPSF+C +ES+TG+TL YR++R G++HYV+GQI  I+++ + TE+ IE++    + N+ + IMRLHFNN +F +           I + + + S++FF++FPF IVFNRGMR  N G G+L  +  +  + I + FLL RP I F W+ +MLH+NNIFELI  DP +     IL        + T  R+          L ++GQM YM EW++I F+G P+M  +  MYK+GLFIND ++HDSSRDLVLA  QQSAELKL L QE++KS+ + E++++L +  ++TD+LL+QM+PKSVA +LRHG  AV  CE FD VTILF+D+V FT +CS + P +V+E L  +Y+ FD++ + H VYKVETIGDAYM+ SG PT T++ A FI++ +   +   G +++ ++    + IR G+H+G VVAGVVGL MPRYCLFG+TV  A++ME NS P KI +SE T  K+  +D   Y+   R  I+IK    I+T+++      H + +P+   S
Sbjct:    1 MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGDPVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFYCEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRLHFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMAGIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMTEERHRMGDGEREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDSSRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLRHGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKVETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVVAGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIEIKDDQTIQTFFVVSRHGPHRVPSPRNCES 628          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|P90895|GCY33_CAEEL (Soluble guanylate cyclase gcy-33 OS=Caenorhabditis elegans OX=6239 GN=gcy-33 PE=2 SV=4)

HSP 1 Score: 367.466 bits (942), Expect = 9.020e-113
Identity = 226/618 (36.57%), Postives = 364/618 (58.90%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQ----------IEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSK--------ILREGNHSSKKRTLSRNN----PSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAER-LRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSI-GFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRME-SNSEPQKIHISEATKAKVTDLQS--YKISERGHIDIKGKGNIKTYWLD 1935
            MYGL++EGVR  I   +G      + +   +   +  TH+ Y E ++P + ++         ++I  L G FF+ F+ + GY  ++ V+GR   DF+ GLDN+HEY RFSYPKL+ PSF+C +ES+ G+ L YR+RR+GY+ YV GQ+ E+AR FY  ++ I+++ +  +   +  ++++ F+N    Q          + + LPV ++ F ++FPF+I FN+ +  +  G+G+LN +P++   L+T+ F L RP I+FT + +M+H N +F++  L P +  ++         + E   S +K+T+  N     P + +RG +  +   +  + L T ++  +++M+K GL++ND    D +R++++A  Q+S  LK  LE E  +S+ L E   ++ E  K    LL QM+P  VA+  +R GS  VD CE F+ V+I F  V  F+ I   I  F+VV +LN +YS  D + + H VYKVETIG++YMI++GCP    Y A  + +  L+M+  I  F     D  + + I+ GI TG VV GVVG++ PRYCLFGDTVNTASRME SN  P  I I + TK +V    S  ++I  +G++ +KGKG+++ Y ++
Sbjct:    1 MYGLVIEGVRFMIQENWGPQVLLQVQKLTSLSEKSVSTHDQYSEHVVPQMFKAIHEITGTPYEQIGVLAGRFFVQFLIRNGYGDLMNVMGRRFSDFIKGLDNIHEYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQLDIGIQVLKKKEKGRFTFVVLKISFDNVGLGQDLKLKERVKNLNEYLPVDTKSFLQMFPFHIAFNKKLEILMAGQGLLNLMPNIQGLLMTDVFDLQRPCIKFTAEGIMVHQNCVFQIESLHPVVKQTEENITVQINDITEDKVSLEKKTVMDNEYESLPYVTLRGPITVLKSSETFLLLATCVVDTLDTMFKMGLYLNDFGESDCNREIIMATIQKSDTLKTMLENEKRRSEVLTEMTREISEAKKTARTLLTQMMPYEVAQTMMRSGS--VDHCEAFECVSIGFIRVCDFSKISLFIEAFEVVNLLNTIYSHLDSIVDTHGVYKVETIGESYMISAGCPYRDDYDAEMVSDCCLEMVSHIKSFEYQSHDAVKKVLIKCGIFTGPVVGGVVGVRTPRYCLFGDTVNTASRMESSNQTPMTIQIGQRTKDRVEKQASGAFRIKPKGNVFVKGKGDMRVYEIE 616          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|P20595|GCYB1_RAT (Guanylate cyclase soluble subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Gucy1b1 PE=1 SV=2)

HSP 1 Score: 322.013 bits (824), Expect = 7.668e-99
Identity = 213/616 (34.58%), Postives = 327/616 (53.08%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXX--------NIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-----KAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +AS+ LN+   EI+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q SE  D+    I       ++F +  D           + P+        +I+F+R +    CG  +   LP L P +  +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T       + +D Q + +  RG + +KGK      W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRSEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQDSRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGKCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQ-FHLEHRGPVSMKGKKEPMQVWF 603          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4ZHR9|GCYB1_CANLF (Guanylate cyclase soluble subunit beta-1 OS=Canis lupus familiaris OX=9615 GN=GUCY1B1 PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 3.524e-98
Identity = 214/615 (34.80%), Postives = 327/615 (53.17%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVI-TFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEAT-KAKVTDLQS---YKISERGHIDIKGKGNIKTYWL 1932
            MYG +   +   +   YG + W  I + A +D    F    +Y ++   +++ +AS+ LN+   EI+ + G  F  F  + GYD ILRVLG ++R+FL  LD LH++L   YP ++ PSF C +  K  G+ L Y + R G    V G I  +A+Q + TE+ ++++ Q +E  D+    I       ++F +  D                  + FPF+I+F+R +    CG  +   LP L P    +   F L RP I+ ++  ++ H N +F L   +  +   K+  E   +  + +       L+++GQM Y+PE D+I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF   CSK         +V +LN LY+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T +  +T   S   + +  RG + +KGK      W 
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEIS------CLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEK-KKTDTLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMTPENSDPQFHLEHRGPVSMKGKKEPMQVWF 603          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A1I8J7G2 (Guanylate cyclase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 375/585 (64.10%), Postives = 455/585 (77.78%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSED-NVSNCIMRLHFNNKNFIQIED-------LLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHI 1893
            MYGL+LEG+  FI SK+ ED W++IL  A  D   F T EVY + LIP I+++A   L M+ D+IMF NG+FFI F+S +GYD ILRVLGRDLRDFLNGLDNLHEYLRF+Y K++PPSFFCVNESKTGITLQYR++R G+ HYVRGQITEIAR FY T M IEIVS+T+E   V NCI RLHFNN  F  + D       L  VPSEVFFEVFPFNIVFNRGMR +N G+G+ N LP+L + LI E FLL RP+IEF+WDAV++HTNN+FELI ++ K+   +  +E +    K+  + ++  L+++GQMKYMP WDAIVFLGTP++RDVESMY  GL+INDLSMHDSSRDL+LAGEQQSAELKLALEQE EKS KL ES+ +LDE  KKTDELL+QMIPK+VA+RLR G  AV TCE FDEVTILFSD+ GFT IC  I P DVV MLN +YSVFD+LTE++ VYKVET+GDAYMI SG P  T++HAP + EM+ DMIK+I    DPS  +  L +R+G+HTGMVVAGVVG+KMPRYCLFGDTVNTA++MES+   Q+IHIS  TK K+   ++Y IS+   +
Sbjct:   19 MYGLLLEGIHAFITSKFSEDVWDAILARAKTDTRNFRTREVYSDGLIPLIVDAACEELRMSNDDIMFENGVFFITFLSNFGYDSILRVLGRDLRDFLNGLDNLHEYLRFTYVKMRPPSFFCVNESKTGITLQYRSKRRGFHHYVRGQITEIARLFYQTSMRIEIVSKTAEACGVVNCIFRLHFNNIRFAIVSDRLFESSPLCTVPSEVFFEVFPFNIVFNRGMRILNIGRGLFNTLPNLVNTLINENFLLIRPMIEFSWDAVIIHTNNVFELISMENKLQDGQASKERH----KKASNASDNGLRLKGQMKYMPAWDAIVFLGTPVLRDVESMYSVGLYINDLSMHDSSRDLILAGEQQSAELKLALEQEQEKSAKLTESMKRLDEEKKKTDELLYQMIPKTVADRLRRGDSAVSTCETFDEVTILFSDICGFTNICGAITPLDVVNMLNNMYSVFDKLTEQNCVYKVETVGDAYMIVSGAPVKTEHHAPLMSEMAQDMIKAIANCKDPSGINPHLMMRIGLHTGMVVAGVVGVKMPRYCLFGDTVNTANKMESSG--QRIHISATTKTKLDSYEAYVISDGSEV 597          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A4Z2CYH7 (Soluble guanylate cyclase 88E OS=Schistosoma japonicum OX=6182 GN=EWB00_006595 PE=4 SV=1)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 369/637 (57.93%), Postives = 468/637 (73.47%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPS-DHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGH-NLENPKAVASLITQLERERITISDSNLAGSQI-KGDGWESLT 2064
            MYGL+L+G+R FI +K+  D WN I + A+   + F T  VY E L+PN+ ++++  L    D+I F  GI F+ +V   GY GILRVLGR+LRDFLNGLDNLH++LR +YPK++PPSFFCVNESKTGITLQYR+ R G++ +  G +TE++R  Y  EM IEIV Q         I+RLHF+N +F  IE+ LPVP+ VFFE FPFN VFNRGM+ +N G+ M NALP++  + +++ F L+RP+I FTWD VMLHTN IFEL   +    + +I      ++K   L  N   LK+RGQMKYM EWDAIVFLGTPIMRDV+SM + GL++NDLSMHDSSRD+VLAGEQQSAELKLALEQE+EKSK+LEESL +LDE M++TDELL+QMIP+SVA+RLR G  A+DTCE F+ VT+L SDVVGFTTICS + P +VV +LNKLYSVFD LTEKHKVYKVETIGDAYMIASGCPT T YH+PFI EM+LDM++S+  + D S +   SL+IRVGIHTG  VAGVVG+KMPRYCLFG TV T+  ME  S PQ+I +S      ++    Y ++E+G +++K  G I TYWL+G  N    +  A  + +L  ER  I+DSN+A SQ   G+ WES+T
Sbjct:    1 MYGLLLDGLRNFIVTKWSIDIWNEICQQANSSDVQFETRRVYDEALLPNLFKTSANILETPEDDIKFGMGITFVEYVGGKGYQGILRVLGRELRDFLNGLDNLHQFLRATYPKMQPPSFFCVNESKTGITLQYRSHRVGFVPFFCGWMTELSRVLYEKEMKIEIVGQKDRGKQVETILRLHFHNHSFASIEEELPVPAIVFFEAFPFNFVFNRGMKLLNIGRSMANALPNIVGKNVSDIFRLSRPVIPFTWDDVMLHTNIIFELTSNE---VNKEIALNDEQNNKGNELDSNRGKLKLRGQMKYMFEWDAIVFLGTPIMRDVDSMLEIGLYLNDLSMHDSSRDMVLAGEQQSAELKLALEQENEKSKRLEESLRRLDEEMRRTDELLYQMIPRSVAQRLRAGEAAMDTCETFENVTLLLSDVVGFTTICSGLAPLEVVGLLNKLYSVFDGLTEKHKVYKVETIGDAYMIASGCPTRTDYHSPFIAEMALDMVESVQTVKDESKEPPESLRIRVGIHTGPAVAGVVGVKMPRYCLFGSTVTTSELMEQTSSPQRIQVSVKAYENLSKYGVYDLTEKGTVELKDGGTILTYWLNGRPNPSECEKTAKFLDELNNEREKIADSNMASSQQHTGESWESVT 634          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A1I8GYZ9 (Guanylate cyclase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 363/585 (62.05%), Postives = 444/585 (75.90%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSED-NVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXX-------NIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHI 1893
            MYGL+LEG+  FI SK+ ED W++IL  A  D   F T EVY + LIP I+++A   L M+ D+IMF NG+FFI F+S +GYD ILRVLGRDLRDFLNGLDNLHEYLRF+Y K++PPSFFCVNESKTGITLQYR++R G+ HYVRGQITEIAR FY T M IEIVS+T+E   V NCI RLHFNN  F  + D L   S +              NIVFNRGMR +N G+G+ N LP+L + LI E FLL RP+IEF+WDAV++HTNN+FELI ++ K+   +  +E +    K+  + ++  L+++GQMKYMP WDAIVFLGTP++RDVESMY  GL+INDLSMHDSSRDL+LAGEQQSAELKLALEQE EKS KL ES+ +LDE  KKTDELL+QMIPK+VA+RLR G  AV TCE FDEVTILFSD+ GFT IC  I P DVV MLN +YSVFD+LTE++ VYKVET+GDAYMI SG P  T++HA  + EM+ DMIK+I    DPS  +  L +R+G+HTGMVVAGVVG+KMPRYCLFGDTVNTA++MES+   Q+IHIS  TK K+   ++Y IS+   +
Sbjct:   19 MYGLLLEGIHAFITSKFSEDVWDAILARAKTDTRNFRTREVYSDGLIPLIVDAACEELRMSNDDIMFENGVFFITFLSNFGYDSILRVLGRDLRDFLNGLDNLHEYLRFTYVKMRPPSFFCVNESKTGITLQYRSKRRGFHHYVRGQITEIARLFYQTNMRIEIVSKTAEACGVVNCIFRLHFNNIRFAIVSDRLFESSSLCTVPSEVFFEVFPFNIVFNRGMRILNIGRGLFNTLPNLVNTLINENFLLIRPMIEFSWDAVIIHTNNVFELISMENKLQDGQASKERH----KKASNASDNGLRLKGQMKYMPAWDAIVFLGTPVLRDVESMYSVGLYINDLSMHDSSRDLILAGEQQSAELKLALEQEQEKSAKLTESMKRLDEEKKKTDELLYQMIPKTVADRLRRGDSAVSTCETFDEVTILFSDICGFTNICGAITPLDVVNMLNNMYSVFDKLTEQNCVYKVETVGDAYMIVSGAPVKTEHHAALMSEMAQDMIKAIANCKDPSGINPHLMMRIGLHTGMVVAGVVGVKMPRYCLFGDTVNTANKMESSG--QRIHISATTKTKLDSYEAYVISDGSEV 597          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A3Q0KPP5 (Putative soluble guanylate cyclase gcy OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 369/637 (57.93%), Postives = 468/637 (73.47%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPS-DHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGH-NLENPKAVASLITQLERERITISDSNLAGS-QIKGDGWESLT 2064
            MYGL+LEG+R FI +K+  + W  I   A+   I F T +VY E L+PN+ + +S+ L+   DEI F  GI F+ +V   GY GILRVLGR+LRDFLNGLDNLHE+LR SYPK++PPSFFCVNES+TGITLQYR+ R+G++ +  G +TE+A+  YS +M +EIV Q         I+RLHF+N +F +I++ LPVP+ VFFE FPFN VFNRGM+ +N G+ M NALP++  + + + FLL+RP+I FTWD +MLHTN IFEL   +     + I  + N   +  T   N   LK+RGQMKYM EWDAIVFLGTPIMRDV+SM + GL++NDLSMHDSSRD+VLAGEQQSAELKLALEQE+EKSK+LEESL +LDE M++TDELL+QMIP+SVAERLR G  AVDTCE FD VT+L SDVVGFTTICS + P +VV +LNKLYSVFD LTEKHKVYKVETIGDAYMIASGCP+ T+YHAPFI EM+LDM++S+  + D S +   SL+IRV    G  VAGVVG+KMPRYCLFG TV T+  ME  S PQ+I +S      ++    Y ++E+G +++K  G I TYWL+G  N  + +  A  + +L  ER  I+DSN+A S Q  G+ WES+T
Sbjct:    1 MYGLLLEGLRNFIITKWSSEIWIEICTQANSPEIQFETRKVYDEALLPNLFQISSKLLDTPEDEIKFGMGISFVEYVGSKGYQGILRVLGRELRDFLNGLDNLHEFLRSSYPKIRPPSFFCVNESRTGITLQYRSHRTGFVPFFCGWMTELAKVLYSKDMKVEIVGQKDRGKQVETILRLHFHNHSFNEIDEELPVPAIVFFEAFPFNFVFNRGMKLLNIGRSMANALPNIVGKNVVDIFLLSRPVIPFTWDDIMLHTNIIFELTSNEISKEVNLIDEQNNTGDQSDT---NRGRLKLRGQMKYMSEWDAIVFLGTPIMRDVDSMLEIGLYLNDLSMHDSSRDMVLAGEQQSAELKLALEQENEKSKRLEESLRRLDEEMRRTDELLYQMIPRSVAERLRAGEAAVDTCETFDNVTLLLSDVVGFTTICSGLAPLEVVSLLNKLYSVFDGLTEKHKVYKVETIGDAYMIASGCPSRTEYHAPFIAEMALDMVESVQTVKDESKEPPESLRIRV----GPAVAGVVGVKMPRYCLFGSTVTTSELMEQTSSPQRIQVSVKAYENLSKYGVYDLTEKGRVELKDGGTILTYWLNGRSNPSDDEKTAKFLDELNTERERIADSNMASSYQRSGESWESVT 630          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A4S2L6L0 (Guanylate cyclase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010217 PE=4 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 355/669 (53.06%), Postives = 483/669 (72.20%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDH-SRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLEN-PKAVASLITQLERERITISDSNLAGSQIK-GDGWESLTHXXXXXXXXXTGSILELSHTKRLASINHGDSV 2160
            MYGL++EG + ++ ++Y +  W  IL+ +  +  TF + +VY E ++P +  +ASR L +  DEI +  G  F+ F+   GY GILRVLGR L+DFLNGLDNLHE+LR SYP++KPPSFFCVNES++GITL+YR+ R+ Y+ +  G +  ++  F+ TEM I ++    E+  +  I+RLHF+N ++I+  +  P+P+ VFFE FPFN VF+RGM+ IN G+ M NALP++  + +++ F++ RPLI+  W+A+MLHTNNIFEL   +  +  ++I      S K+ T       L++RGQMK+M EWDAIVF+GTPIM+DV++M++ GLF+NDLSMHDSSRD+VL GEQQ+AELKLALEQESEKS++L ESLH LDE MK+TDELL+QMIPK+VAERLR+G  AV TCE F+E+T+L SDVVGFT ICS ++P +VV +LN+LYS FD LTEKHKVYKVETIGDAY+IASGCP  T+YHAPFI EM+LDM+ S+  + D S +   SL+IR+G+HTG  VAGVVG+KMPRYCLFG TV T   ME+ S PQKI +SE T AK+     Y +S +G   +K  G I+T+WL+G   E   +  A L  ++++ER  ++DSNL+  Q + G+GWES++ SR SSAR         +HT R +S+  G  V
Sbjct:    1 MYGLVIEGFKSYVSAQYSDSIWEEILKQSGYESYTFDSKQVYDEAILPALFTTASRMLQIPEDEIKYATGKSFVRFMCNKGYGGILRVLGRQLKDFLNGLDNLHEFLRCSYPEMKPPSFFCVNESRSGITLEYRSHRANYVSFFMGYMEAVSLTFFKTEMKITVIVPADENLQTATILRLHFDNTSYIRPAEKKPLPARVFFEAFPFNFVFDRGMKLINVGRSMANALPNILGKKVSDVFIVKRPLIQLNWNAIMLHTNNIFELTSTNYDVVDTEI----EESGKEMTCLPQKGCLRLRGQMKFMSEWDAIVFIGTPIMQDVDAMWEVGLFLNDLSMHDSSRDMVLTGEQQAAELKLALEQESEKSRRLTESLHHLDEEMKRTDELLYQMIPKAVAERLRNGEPAVATCEKFEEITLLLSDVVGFTNICSGLSPLEVVNLLNRLYSCFDALTEKHKVYKVETIGDAYIIASGCPIRTKYHAPFIAEMALDMVNSVQMVKDESKNPPESLRIRIGMHTGPTVAGVVGVKMPRYCLFGSTVTTVEVMEATSAPQKIQVSETTHAKLKVYGVYDMSPKGDAQLKDGGVIRTHWLNGRRQETMCEITAKLCEEMDQERSRLADSNLSSHQQQSGEGWESMSASRCSSAR---------THTSRRSSMARGSLV 656          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000045584.1 (soluble guanylate cyclase 88E-like [Source:NCBI gene;Acc:103027224])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 329/670 (49.10%), Postives = 449/670 (67.01%), Query Frame = 1
Query:  157 LAMYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNK--NFIQIED-----LLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP---------KISSSKI-----------------------LREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDG 2049
            ++MYGL+ E +  FI   YG+D W  +   AD+ + +F TH+VY E++IP I ++AS       +E+M   G++F+ FV +YGYD IL+VLGR +RDF+NGLDNLHEYLRFSYPK++PP+FFC  ES TG+TL YR++R GY+HY  GQ+ ++ +QFY T++ +E++S+    + S+  MRL+F+N    +IQ ED     +LP+ S+ FFEVFPFNIVF + M   N G G+    PDL  + I + FLL RPL+EFTW+ ++ H NN+FE++  +P         ++ +S                          ++GN ++   +    +  LK++GQM+YMPEW++I+FLGTP+M  + +M+K GL+INDLSMHDSSRDLVLAG QQS ELK AL QE +KS KLEES+  LD  MKKTD+LL++MIPK VA+RLR G  AV+TCE F +VTILFSDVVGFT ICS I P  VV MLN +Y++FD L+EKH+V+KVETIGDAYM+ +G P  T+YHA  I +M+LDM++SI  L DPS+   ++QIRVGIH+GMVVAGVVG KMPRY L GDTV+TAS MESN +   I +S AT   +     +    RG I IKG   I+TYWL G   ++  A A+   Q E + I+ + ++     I  +G
Sbjct:   33 VSMYGLLCESLHDFIKESYGDDVWKLVRERADVRLHSFVTHQVYSESVIPRIAKAASGVTGTPYNELMNSWGVYFLGFVGKYGYDRILKVLGRHVRDFVNGLDNLHEYLRFSYPKVQPPTFFCQEESATGVTLHYRSKRKGYLHYAMGQLRQMGKQFYDTDIHVEVLSEQLVGDYSHVTMRLNFDNSAYRYIQKEDEEEQEILPITSDFFFEVFPFNIVFRQDMVVHNVGSGLATVFPDLDGKKINDAFLLARPLVEFTWNMIISHPNNLFEIMSKEPVKRERNLHNRVQNSDYENANRSADVDVELMAFQSIIGDDYKDGNSANAMESWGDGSRCLKLKGQMRYMPEWESIIFLGTPVMESLSAMFKTGLYINDLSMHDSSRDLVLAGTQQSEELKRALIQEQKKSSKLEESMKMLDYEMKKTDDLLYRMIPKPVAKRLRKGEPAVNTCEVFPDVTILFSDVVGFTRICSHITPMQVVSMLNTMYTLFDTLSEKHRVFKVETIGDAYMVVAGAPEKTKYHAHNICDMALDMVRSIDHLKDPSN-GNNIQIRVGIHSGMVVAGVVGHKMPRYGLHGDTVHTASAMESNGKEMHIQLSSATYEHLKG-SHFIFERRGTITIKGNVEIETYWLKGKRDKDGNAQAA-CPQFEAQTISKAAASPPEPPIDEEG 699          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000031087.1 (soluble guanylate cyclase 88E-like [Source:NCBI gene;Acc:103027224])

HSP 1 Score: 409.453 bits (1051), Expect = 2.936e-133
Identity = 252/523 (48.18%), Postives = 342/523 (65.39%), Query Frame = 1
Query:  598 GQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNK--NFIQIED-----LLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDP---------KISSSKI-----------------------LREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDG 2049
            GQ+ ++ +QFY T++ +E++S+    + S+  MRL+F+N    +IQ ED     +LP+ S+ FFEVFPFNIVF + M   N G G+    PDL  + I + FLL RPL+EFTW+ ++ H NN+FE++  +P         ++ +S                          ++GN ++   +    +  LK++GQM+YMPEW++I+FLGTP+M  + +M+K GL+INDLSMHDSSRDLVLAG QQS ELK AL QE +KS KLEES+  LD  MKKTD+LL++MIPK VA+RLR G  AV+TCE F +VTILFSDVVGFT ICS I P  VV MLN +Y++FD L+EKH+V+KVETIGDAYM+ +G P  T+YHA  I +M+LDM++SI  L DPS+   ++QIRVGIH+GMVVAGVVG KMPRY L GDTV+TAS MESN +   I +S AT   +     +    RG I IKG   I+TYWL G   ++  A A+   Q E + I+ + ++     I  +G
Sbjct:    2 GQLRQMGKQFYDTDIHVEVLSEQLVGDYSHVTMRLNFDNSAYRYIQKEDEEEQEILPITSDFFFEVFPFNIVFRQDMVVHNVGSGLATVFPDLDGKKINDAFLLARPLVEFTWNMIISHPNNLFEIMSKEPVKRERNLHNRVQNSDYENANRSADVDVELMAFQSIIGDDYKDGNSANAMESWGDGSRCLKLKGQMRYMPEWESIIFLGTPVMESLSAMFKTGLYINDLSMHDSSRDLVLAGTQQSEELKRALIQEQKKSSKLEESMKMLDYEMKKTDDLLYRMIPKPVAKRLRKGEPAVNTCEVFPDVTILFSDVVGFTRICSHITPMQVVSMLNTMYTLFDTLSEKHRVFKVETIGDAYMVVAGAPEKTKYHAHNICDMALDMVRSIDHLKDPSN-GNNIQIRVGIHSGMVVAGVVGHKMPRYGLHGDTVHTASAMESNGKEMHIQLSSATYEHLKG-SHFIFERRGTITIKGNVEIETYWLKGKRDKDGNAQAAC-PQFEAQTISKAAASPPEPPIDEEG 521          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037807.1 (soluble guanylate cyclase 88E-like [Source:NCBI gene;Acc:103038777])

HSP 1 Score: 331.257 bits (848), Expect = 2.488e-101
Identity = 182/297 (61.28%), Postives = 231/297 (77.78%), Query Frame = 1
Query: 1048 LKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDG 1938
            L ++GQMKY+P+WD+++FLGTPI+  VE M K G+++NDL++HDSSR+L+LAG QQSAEL+LAL+QE +K  +L+E + KLDE  K+ D LL+ MIPK+VA+RLR G  A++TC+ F +VTILFSDVV F  IC  I P  VV+MLN++Y VFD L+EKH VYKVETI DAYM+ +G P  T +HA  I +M+LDM+ SI  L DPS    ++QIRVGIH+GMVVAGVVGLKMPRYCLFGDTVNTASRMESN    +IHIS+ TK  + + + Y I ERG I +KGKG +KTYWL G
Sbjct:  370 LHLKGQMKYVPQWDSLIFLGTPIIETVEDMIKMGVYVNDLNLHDSSRELILAGTQQSAELQLALDQEQQKYAQLQEIIKKLDEEKKRGDSLLYAMIPKAVADRLRKGITALETCQVFPDVTILFSDVVKFNEICIHITPMQVVDMLNEIYIVFDTLSEKHNVYKVETIRDAYMVVAGVPNKTTFHAHHICDMALDMLSSIDHLKDPST-GDNIQIRVGIHSGMVVAGVVGLKMPRYCLFGDTVNTASRMESNGVGMQIHISQTTKDHL-EHEPYIIEERGKIFVKGKGYMKTYWLKG 664          

HSP 2 Score: 219.935 bits (559), Expect = 1.392e-60
Identity = 108/274 (39.42%), Postives = 172/274 (62.77%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQI---------EDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELI 957
            MYGL LE V  +I   YGED W  I   A+I  + F  H++Y + LI  + ++A   L  T DE+M+  G++ +  +  YGY+ IL+VLGR++RDF+N LDNLHEY RFS+PK++PPSF    E +T +TL YR+ R G+  +V+GQ++++ RQFY+T++ +EI+S+   + ++  + +++F+N  F             + LP+   +FF++FPF+++F R M     G G+     DL  + + E F L RP++EF+WD +  H NN+FEL+
Sbjct:    1 MYGLYLEAVNDYINESYGEDVWRLIEARAEIPHLKFVRHQMYNDNLILRLAKAAGEVLGKTHDELMYAFGVYMVKRIGNYGYERILKVLGRNVRDFINELDNLHEYFRFSFPKVQPPSFCVEEECETSLTLHYRSTRKGFTQFVKGQLSQVGRQFYNTDIEVEILSKEETEKMTYVVYKMNFDNAAFKHRMPQQKTAPGYEKLPMKRGIFFDMFPFSVIFRRDMTMYRIGDGLKEVFSDLQGKKVNEEFTLVRPMLEFSWDNIYTHLNNVFELL 274          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 320.472 bits (820), Expect = 4.226e-98
Identity = 217/624 (34.78%), Postives = 332/624 (53.21%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSED--------------------------------NVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQ--LITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            MYG I   +R  +  K+GE+ W  +   A++   TF T+E+Y + +   +++ A + L+++ + ++ L G +F +F    GYD +LR LG +L +F+  LD LH YL  SY ++  PSF     +     L Y + R G  + V G I  +A+ F+ +++++ I+ Q  E                                  V   +M  H  +    +    L +  + F   FPF+IVF++ +   + G  +   +P L      + EYF +  P +     ++    N+ F L          K  RE    S +     N   LK+RGQM +M     +V+L +P +R ++ + + GL + D++ HD++RDL+L  +Q+ AE++L+ + E +K +    S +   E  KKT+ LL+ M+P+ VA +L+ G + VD  E F   TILFSDVV FT IC+   P  +V MLN +YS FD LT  H VYKVETIGDAYM+  G P     HA  +   +L M  +   + +P    + +QIRVG+HTG V+AGVVG KMPRYCLFGDTVNTASRMES+  P  IH+S  T + + D + ++I ERG I +KGKG + TY+L
Sbjct:    1 MYGFINTCLRTLVVEKFGEETWEKLRLLAEVQ-DTFMTYEIYDDVITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEEMNAPSFRVERTNDGRTLLHYYSDRKGLHYIVPGIIEAVAKDFFGSKVTMTILEQPKEQERTGKREHVIFLMTQTSEGAKGEEAHLNGGDGTVERKVMSDHIQHSFCPRYPKRLWIEEQAFCNAFPFHIVFDQNLVVKHTGVNIQKFVPGLQKTGCRLDEYFSVVHPEVTLNIHSIKKFINSQFVL----------KTRREMLPESLQ-----NQTMLKLRGQMVWMESLHCMVYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKKEELRILSRNLEVEK-KKTETLLYAMLPRHVANQLKEGKK-VDAGE-FKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHDVYKVETIGDAYMVVGGVPIPKDTHAERVANFALGMRIAAREVTNPIT-GKPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSPFTYSALKD-KMFEIRERGEIQVKGKGLMDTYFL 603          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 318.546 bits (815), Expect = 2.035e-97
Identity = 217/627 (34.61%), Postives = 333/627 (53.11%), Query Frame = 1
Query:  154 LLAMYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSED--------------------------------NVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQ--LITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            L + YG I   +R  +  K+GE+ W  +   A++   TF T+E+Y + +   +++ A + L+++ + ++ L G +F +F    GYD +LR LG +L +F+  LD LH YL  SY ++  PSF     +     L Y + R G  + V G I  +A+ F+ +++++ I+ Q  E                                  V   +M  H  +    +    L +  + F   FPF+IVF++ +   + G  +   +P L      + EYF +  P +     ++    N+ F L          K  RE    S +     N   LK+RGQM +M     +V+L +P +R ++ + + GL + D++ HD++RDL+L  +Q+ AE++L+ + E +K +    S +   E  KKT+ LL+ M+P+ VA +L+ G + VD  E F   TILFSDVV FT IC+   P  +V MLN +YS FD LT  H VYKVETIGDAYM+  G P     HA  +   +L M  +   + +P    + +QIRVG+HTG V+AGVVG KMPRYCLFGDTVNTASRMES+  P  IH+S  T + + D + ++I ERG I +KGKG + TY+L
Sbjct:    4 LPSQYGFINTCLRTLVVEKFGEETWEKLRLLAEVQ-DTFMTYEIYDDVITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEEMNAPSFRVERTNDGRTLLHYYSDRKGLHYIVPGIIEAVAKDFFGSKVTMTILEQPKEQERTGKREHVIFLMTQTSEGAKGEEAHLNGGDGTVERKVMSDHIQHSFCPRYPKRLWIEEQAFCNAFPFHIVFDQNLVVKHTGVNIQKFVPGLQKTGCRLDEYFSVVHPEVTLNIHSIKKFINSQFVL----------KTRREMLPESLQ-----NQTMLKLRGQMVWMESLHCMVYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKKEELRILSRNLEVEK-KKTETLLYAMLPRHVANQLKEGKK-VDAGE-FKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHDVYKVETIGDAYMVVGGVPIPKDTHAERVANFALGMRIAAREVTNPIT-GKPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSPFTYSALKD-KMFEIRERGEIQVKGKGLMDTYFL 609          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 236.498 bits (602), Expect = 3.065e-71
Identity = 149/358 (41.62%), Postives = 221/358 (61.73%), Query Frame = 1
Query:  868 ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGH 1941
            + EYF +  P + FT +++    N+ F L          K  RE    ++     R+ P L +RGQM +M    ++++L +P++R +E + +  L I+D++ HD++RDL+L  +Q+ AE++L+ + E +K +    S +   E  KKT+ LL+ M+P  VA +L+ G + V+  E F   TILFSDVV FT IC+   P  +V MLN +Y  FD LT  H VYKVETIGDAYM+  G P     HA  +   +L M+ +   + +P   S ++QIRVGIH+G V+AGVVG KMPRYCLFGDTVNTASRMES+  P +IH+S +T+  +   + + + ERG I++KGKG + TY+L G+
Sbjct:   24 LDEYFTIGHPEVTFTIESIRKFINSQFVL----------KTRREMLPEAR-----RSQPMLDLRGQMVWMEGSRSMLYLCSPLLRSLEELEERQLHISDIAPHDATRDLILLNQQRLAEMELSTQLERKKEELRVLSKNLQVEK-KKTEALLYAMLPHHVANQLKEGKK-VEAGE-FKVCTILFSDVVTFTNICAVCEPIQIVHMLNAMYMRFDRLTTVHNVYKVETIGDAYMVVGGVPIPVPSHAERVANFALGMVLAAREVTNPVTGS-AIQIRVGIHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGLPGRIHLSPSTREALQG-KEFDVEERGEIEVKGKGRMSTYFLLGN 361          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002650.1 (pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 gene:ENSPMAG00000002416.1 transcript:ENSPMAT00000002650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 217.238 bits (552), Expect = 1.437e-62
Identity = 109/220 (49.55%), Postives = 143/220 (65.00%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQ-YHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPK 1959
            +KTD LL+ M+PK +A+ LR G   V   + +   T+ FSD+VGFT + S   P++VV+ LNKLY+ FD + + + VYKVETIGDAYM+ SG PT     HA     M+LD++      + P      L+IR GIHTG VVAGVVG KMPRYCLFGDTVNTASRMES SE  KI  S +T + +  + SY +S RG + +KGKG + T+WL+G +    K
Sbjct:  286 QKTDRLLYSMLPKQIADDLRQGR--VTKAQSYASATVFFSDIVGFTQLSSSSTPYEVVDFLNKLYTSFDGIIDNYDVYKVETIGDAYMVVSGVPTENHNQHAVETANMALDLVNVCQAFVIPHKPEMQLKIRAGIHTGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSPSTSSILQQIGSYLLSCRGTVTVKGKGEMITWWLEGRDTSTKK 503          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.246 bits (565), Expect = 4.570e-62
Identity = 111/221 (50.23%), Postives = 151/221 (68.33%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKA 1962
            +K + LL+Q++P SVAE+L+ G E V   E FD VTI FSD+VGFT++ ++  P  VV +LN LY+ FD + +   VYKVETIGDAYM+ SG P    + +A  I  MSL ++ ++            L++R+GIHTG V AGVVGLKMPR+CLFGDTVNTASRMESN E  KIH+S+ TK  + +   +++  RG +++KGKG ++TYWL G   ENP+A
Sbjct:  609 RKAETLLYQILPHSVAEQLKRG-ETVQA-EAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLGEIEENPEA 827          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 208.379 bits (529), Expect = 2.465e-59
Identity = 104/214 (48.60%), Postives = 138/214 (64.49%), Query Frame = 1
Query: 1306 KTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHN 1944
            K + LL+Q++P SVAE+L+ G       E FD VTI  SD+VGFT + ++  P  VV  LN LY+ FD + +   VYKVETIGDAYM+ SG P      HA  +  M+L ++ ++         ++ L +R+GIHTG V AGVVGLKMPRYCLFGDTVNTASRME+  E  +IH+S  TKA + +   + +   G +DIKGKG ++TYWL G N
Sbjct:  293 KAEALLYQILPHSVAEQLKRGETV--PAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLGEN 504          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000043.1 (pep scaffold:Pmarinus_7.0:GL480785:4349:14716:1 gene:ENSPMAG00000000040.1 transcript:ENSPMAT00000000043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.333 bits (451), Expect = 3.045e-49
Identity = 96/201 (47.76%), Postives = 130/201 (64.68%), Query Frame = 1
Query: 1306 KTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQ-YHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQS-YKISERGHIDIK 1902
            + D L +Q++PK+V + L+  S      E F+EVTI FSD+VGFTTIC    P +VV +LN LY  FD + + H VYKVETIGDAYM+ SG P     +HA  I  ++LD++  +G           + +R+GIH+G   AGVVG KMPRYCLFGDTVNTASRMES   P +IH+S++T   +   QS ++ + RG I++K
Sbjct:  240 RADHLNYQLLPKTVVQALK--SVGSVQPELFEEVTIYFSDIVGFTTICKHCEPMEVVCLLNDLYKEFDSIVDSHDVYKVETIGDAYMLVSGLPKRNGCHHAMEIANVALDILSFMGSFHIQHLPGLPVWVRIGIHSGKCAAGVVGNKMPRYCLFGDTVNTASRMESTGYPYRIHVSQSTVDTLNAQQSGHQFTCRGIIELK 438          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO43095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZH8])

HSP 1 Score: 480.715 bits (1236), Expect = 2.636e-161
Identity = 263/627 (41.95%), Postives = 382/627 (60.93%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIE---------------DLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSK----------------ILREG---NHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMK-KTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDG 1938
            +YGL++E V   + S+YGED W+ I  +A +   TF  H +Y +++   ++ SA        + ++   G  F++F+ Q+GYD ILR+LGR +RDFLNGLDNLHE++RF+YPKLK PSF C  E++ G+ L YR+ R G+++YV GQI E+ + FY  ++ +E++ Q         +M+L+F+N+ FI                  D L +  +VF+EVFPF++V+++ M   + G  +   LP+L    IT+ F L RP ++F+W++V +HTN +FEL      +S  K                 L EG   NH +    ++  +  + ++GQM Y+ EW A+ +L TPI      +     F+          D++L   ++   + L+ + +  +     E   +  +  K +TD LL+QMIPK+VA+RLR G  A++TCE F  VTILFSDVVGFTTICS I P  VV MLN +Y+ FD+L+EKH VYKVETIGDAYM+ SG P  T+YHA  + +M+L+M+ ++  + DP+  +  L+IR+GIHTG VVAGVVGLKMPRYCLFGDTVNTASRMES      IH+SE T+ K     +Y + +RG +DIKGKG +KTYWL G
Sbjct:    2 VYGLLIENVSSLLTSRYGEDTWHKIRENAGVQQHTFAIHNIYSDSIFQRLVSSAEEITGEDRNSLLESTGALFVSFIGQFGYDKILRILGRHIRDFLNGLDNLHEFMRFTYPKLKAPSFHCSEETERGMKLHYRSSRKGFLYYVVGQIREVGKMFYDQQIEVEVLEQHESKEGFVAVMQLYFDNRAFISARKRPKRHSVISLGGETDSLSIHIDVFYEVFPFHVVYDKSMTITSVGSSLEAVLPNLVGCKITDEFSLIRPFLDFSWESVFVHTNVVFELQSRSKALSMRKNGKVQNGLLMGCPIMDALGEGVNGNHDNN-HNVTEFDSRIHLKGQMMYIDEWKAMAYLATPINISTLMLINFTFFLQTYL----DVDVILLFLRKEIRIILSKDVKCMQKSAKLEESMRELDNEKLRTDALLYQMIPKTVADRLRKGEPALNTCETFSNVTILFSDVVGFTTICSLIAPMQVVTMLNCMYTTFDKLSEKHNVYKVETIGDAYMVVSGIPERTKYHAEHVADMALNMLSAMPEIEDPAGLNDHLRIRIGIHTGTVVAGVVGLKMPRYCLFGDTVNTASRMESTGLAMAIHVSEDTQ-KFLAKANYALKQRGSMDIKGKGGMKTYWLLG 622          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO40362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B2])

HSP 1 Score: 414.461 bits (1064), Expect = 4.091e-136
Identity = 245/598 (40.97%), Postives = 381/598 (63.71%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFL-----NMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYS-TEMSIEIV-SQTSEDNVSNC--IMRLHFNNK-------NFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLP-HQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDA-YMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIK 1902
            MYGL+LE +R FI  KYGE+ W+ I+  A      F TH +Y E  I  I  +A+  L     ++TVD+ M L G+ F+ F S YGYD I+RV GR  RDFL G+D+LHE++RF YPK+K P+F+C  E+ TGI L Y +RR G++ YV GQ+ EIAR+FY  + ++++I+ +++S+ +   C  + RL FNN+       +F+ +     V +EVFF +FPF++V +  M     G G+ + L  L   + I E F+L RP  +FTW   +L    +FEL+   P I   +   +G           +  +L +RGQMK+M +WD  +F+ +P++ ++++M ++GL++NDLSMHD+S+++ L+G +   +L+ A +Q+ E+  +LEE++ KL+E  +++++LL++M+PK +AERL+ G   +DTCE FD  T+LFS + GFT+IC+++N    V ++N L+  FD LTEKH VYK ET+GDA YM  SG P  T++HA  +  M+LDM+K++  + DP    + + I VGIH+G V AG+VG +  +YCLFGDTVN ASR+ + + P +IHISE  +  + +   +    RG I++K
Sbjct:    1 MYGLLLESIRHFIVGKYGEELWSEIVNIAGTSSHEFVTHRLYDENWIFKIANAATTVLGDLDEHITVDDCMRLFGVCFVKFFSFYGYDPIIRVSGRHFRDFLIGIDSLHEHMRFGYPKMKSPTFYCDEETSTGINLHYESRRKGFMFYVVGQVEEIARKFYGISNINVKILKNESSQSSREQCHIVYRLEFNNEGYKPPPPDFLTVGTKKAVSTEVFFSIFPFSLVISPDMTLSMFGNGLQSLLGKLVLGRDIREVFILRRPKTDFTWHT-LLTRKVVFELLSKVPLIRRPQPKHQG-----------STMTLHLRGQMKFMHDWDKFLFICSPLIANLDTMLQSGLYMNDLSMHDTSQEMALSGIKPLPQLEYARDQQFEQGIELEENMRKLEEERQRSEDLLYRMVPKPIAERLKRGGNPIDTCEEFDAATVLFSYMDGFTSICTRLNAMQAVTLINNLFIKFDLLTEKHNVYKFETLGDALYMAVSGVPVRTEHHAEPMAAMALDMLKAVQLVKDPIT-KKPMTITVGIHSGPVAAGLVGERTLQYCLFGDTVNIASRLRTTALPMRIHISENCRECLEE-SDFITEFRGEIELK 584          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO47083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN69])

HSP 1 Score: 301.982 bits (772), Expect = 3.586e-91
Identity = 203/628 (32.32%), Postives = 336/628 (53.50%), Query Frame = 1
Query:  136 VSNY*MLLAMYGLILEGVRQFICSKYGEDHWNSILRSADIDVIT-FGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVN-ESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIV--SQTSEDNVSNCIMRLHFNN-------KNFIQIEDLLXXXXXXXXXXXX------XNIVFNRGMRAINCGKGMLNALPDL-PHQL-ITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKR---TLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEK--HKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQ----SYKISERGHIDIKGKGN-IKTYWL 1932
            + +Y + +  YG +   +   +   +G   W  I R+A++++   F    +Y + +  +++ +A+R L++    I+   G  F +F  + GYD IL+VLG  LRDF+  LD LH++L   YP ++ PSF   + ES   + L Y + R G    V G +  +AR+  +TE+S+E+V   +   D+V   I  +           KN+  I+D   + +E             F+++FNR ++    G+ +   +P L P    ++E F L RP + FT++A++ H N +F L     +    K+ +  N+   K     L  ++  L+++GQM Y+PE D ++FL +P + ++E +   GL+++D+ +HD+++DL+L  EQ  AE  L  + E    K  +      ++  + TD+LL+ ++P SVA  LRH        E  + VT+LFS +V F  IC    P ++V +LN +Y+ FD LT+   + VYKVET+GD YM  SG P    +HA  I  M+LDM      ++   D    +QI++GIH+G VVAGVVG K PRYCLFG+TVN  SR E+   P +++I+E T   + + +    S+    RG + +KG+   + TY L
Sbjct:   90 LKHYDLKVLRYGFVNHALELLVVRNFGVAKWEEIKRAAELEIEGHFLQRIIYDDVMTYSLVGAATRVLDIETSAILEKFGEMFFDFCQESGYDRILQVLGGTLRDFIGNLDALHDHLGSIYPGMRAPSFRVSDRESDGALILHYYSERDGLEPIVVGIVKTVARKLLNTEVSVEVVKGKEYDGDDVQFVIKEISDRGRDCDSQVKNYDPIKDSFQLSNEPKISPATFCKAFPFHLMFNRDLKVTQAGESVSRVVPSLTPGDADMSEIFELIRPQLRFTYEAIIAHINTVFVL-----RTREGKLSKPANNMCNKNGCCKLCWDSLPLRLKGQMVYIPESDNMIFLCSPSVGNLEDLADVGLYLSDIPLHDATKDLILLSEQFKAEYVLTQQLEILTDKLRQTHNALAEKK-QLTDQLLYSVLPPSVANELRHNRPV--QAERAEMVTLLFSGIVDFAQICKNSKPMEIVMLLNNIYTKFDMLTDPSINDVYKVETVGDKYMAVSGLPERCAFHARSICNMALDMKHVTQSIIHKGD---KIQIKIGIHSGEVVAGVVGHKTPRYCLFGNTVNLTSRTETTGAPGQVNITEFTYRCLLEPECQDPSFVFERRGPVAMKGRQEPMVTYLL 706          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO47084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN70])

HSP 1 Score: 273.092 bits (697), Expect = 8.598e-82
Identity = 201/640 (31.41%), Postives = 327/640 (51.09%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDV---ITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNES-KTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDN--VSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXN---------------IVFNRGMRAINCGKGMLNALPDLP--HQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKIN-PFDVVEMLNKLYSVFDELTEKHK-VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIK-SIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAK--VTDLQSYKISERGHIDIKGKGN-IKTYWLDGHNLENPKAVASLIT--QLE 1989
            MYG +   ++  +   YG D W  IL  A++D+     F    +Y +    +++  A   + ++ + I+   G  F       GYD ++R LG +L DF N LD LHE L   YP ++PPSF     +    + L Y + RSG  + V G +  +A + Y  ++++E+ S +S+D       ++  H +   +I   D     +     +   +                VF++ M     G  +   LP +      +T+ F   RP I+ T+D ++ + N ++ +      + S+ +    +  S+    +  +PS++ RGQM Y+PE ++I+FL +P + +++ + + GL+++D+ +HD++RDL+L  EQ +AE KL+   E    K  + S    +E  +  D LL+ ++P SVA  LR           ++ VTI+FS +V FT  C+KI  P ++VEMLN++Y+ FD+LT+ +  +YKVET+GD YM  SG PT    HA  I  ++LDMI  S G           LQ+ +GIH+G VVAGVVG K PRYCLFG+TVN  SR E+     KI++SE       V   + +   +RG + +KGK   + TY L  ++   P      I+  QLE
Sbjct:    1 MYGFVNRALQDLVIQGYGPDVWKEILEKANLDLGDSREFNERRIYDDQNTSDLLIVAEDVIGLSKNAILERFGDAFFEHCIGSGYDSMIRSLGGNLMDFFNSLDGLHEQLLLLYPGMRPPSFRAKQHNINMKLELVYTSERSGLEYMVVGLVKTVASKLYGIQVNVELASMSSKDQSWAMFYVLPQHQDEMKYILPTDTTLERTMKELSIMTLSSRIGTAAFCRACPFHAVFDQRMVIYQAGISLCRVLPAVRVGKSKLTDIFESIRPPIKLTFDNILQYINKVYVIKTKSGLLDSASL----STVSEDDYGNLESPSMRFRGQMMYLPECNSIMFLASPSVVNLDGLNEKGLYMSDIPIHDATRDLILLSEQHNAEFKLSQRLEILTDKLQQTSRELENE-QQLNDRLLYSILPASVANDLRLRKPV--NANKYEIVTIMFSGIVDFTNYCNKIKEPMEIVEMLNEVYTEFDQLTDSNDDIYKVETVGDKYMAVSGLPTRCDKHALNIANLALDMIDISKGM----KAKGIQLQVTIGIHSGEVVAGVVGQKKPRYCLFGNTVNLTSRTETTGLKGKINVSEYAYRCLLVQPHEQFVFKKRGPVVMKGKKEPMITYILQRNDKYQPDGAEQDISLQQLE 629          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO45306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ0])

HSP 1 Score: 224.557 bits (571), Expect = 1.382e-68
Identity = 113/213 (53.05%), Postives = 147/213 (69.01%), Query Frame = 1
Query: 1306 KTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIK-SIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDG 1938
            +TDELL  M P+SVAE L+ G +     EHFD VT+ FSD+V FT +C+ I+P  V +MLN +YSVFD+  EK+ VYKVETIGDAYM+ SG P      HA  I  MSLD+++ +    +D     + L +RVGIHTG  V+GVVG KMPRYCLFGDTVNTASRM++   PQK+HISE T   +T   ++ +  RG +++KGKG ++TYWL G
Sbjct:    1 RTDELLSAMFPRSVAETLKLGEKV--PSEHFDSVTVFFSDIVDFTNMCAMISPMSVTQMLNDVYSVFDDHIEKYDVYKVETIGDAYMVVSGLPLRNGTSHADEIGRMSLDLVRLTETTTLDSVPKGKKLMVRVGIHTGPCVSGVVGYKMPRYCLFGDTVNTASRMQTTGIPQKVHISETTYDLLTKFNTFHMEYRGTLEVKGKGLMRTYWLLG 211          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: gucy1b1 (fatty acid binding protein 2 [Source:NCBI gene;Acc:101170642])

HSP 1 Score: 258.07 bits (658), Expect = 2.213e-76
Identity = 189/561 (33.69%), Postives = 294/561 (52.41%), Query Frame = 1
Query:  352 EIMFLNGIFFINFVSQYGYDGILRVL---------GRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESK-TGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSE--DNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXX--------XXXXXNIVFNRGMRAINCGKGMLNALPDLP--HQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSK----INPFDVVEMLNKLYSVFDELTEKHK---VYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATK-----AKVTDLQSYKISERGHIDIKGKGNIKTYWL 1932
            EI++L G+  ++ VS      +L+VL              ++ + LD LH++L   YP ++ PSF C +  K   + L Y + R G    V G I  +A+Q + TE+ ++++ Q SE  D++   I       + F +  D                  + FPF+++F++ +    CG  +   LP L     ++   F L RP I+F++  ++ H N +F L   +  ++   +  E   +  + +       L+++GQM Y+PE + I+FL +P + +++ + + GL+++D+ +HD++RDLVL GEQ   E KL  E E    +         DE  KKTD LL+ ++P SVA  LRH        + +D VTILFS +VGF T CSK         +V +LN +Y+ FD LT+  K   VYKVET+GD YM  SG P    +HA  I  ++LDM++  G +    +   S+QI +GIHTG VV GV+G +MPRYCLFG+TVN  SR E+  E  KI++SE T      A+  D Q +++  RG I +KGK      W 
Sbjct:   13 EIIWLFGLL-LHVVSDNRNQALLKVLHGVHDHNLGSVRWTEWFDNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQQKSEECDHIKFLIEEKDSEEEAFNEDLDGFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIYRVLPQLQPGSCILPSVFSLVRPHIDFSFHGILSHINTVFVLRSKEGLLNVETVENEDELTGVEIS------CLRLKGQMIYLPEAENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEK-KKTDRLLYSVLPPSVANELRHKRPV--PAKRYDNVTILFSGIVGFNTFCSKHASAEGAIKIVNLLNDVYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDDE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQCAENADPQ-FQLEYRGPITMKGKKEPMKVWF 559          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 219.55 bits (558), Expect = 9.523e-60
Identity = 106/218 (48.62%), Postives = 150/218 (68.81%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLEN 1953
            +K + LL+Q++P SVA++L+ G E V   E FD VTI FSD+VGFT + ++  P  VV +LN LY+ FD + +   VYKVETIGDAYM+ SG P    + H   +  M+L ++ ++         S+ L++R+G+H+G V AGVVGLKMPRYCLFGDTVNTASRMES  E  KIH+SEAT+  + +  ++++  RG I++KGKG+++TYWL G +  N
Sbjct:  780 RKAEALLYQILPHSVADQLKRG-ETVQA-EAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGEDNSN 995          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 219.55 bits (558), Expect = 1.095e-59
Identity = 106/218 (48.62%), Postives = 150/218 (68.81%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLEN 1953
            +K + LL+Q++P SVA++L+ G E V   E FD VTI FSD+VGFT + ++  P  VV +LN LY+ FD + +   VYKVETIGDAYM+ SG P    + H   +  M+L ++ ++         S+ L++R+G+H+G V AGVVGLKMPRYCLFGDTVNTASRMES  E  KIH+SEAT+  + +  ++++  RG I++KGKG+++TYWL G +  N
Sbjct:  839 RKAEALLYQILPHSVADQLKRG-ETVQA-EAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGEDNSN 1054          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 217.238 bits (552), Expect = 6.492e-59
Identity = 113/216 (52.31%), Postives = 148/216 (68.52%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSL---DMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDG 1938
            +K + LL+Q++P SVAE+L+ G E V   E FD VTI FSD+VGFT++ ++  P  VV +LN LY+ FD + +   VYKVETIGDAYM+ SG P    + HA  I  MSL   + +K+      P+D    L++R+GIHTG V AGVVGLKMPRYCLFGDTVNTASRMESN E  KIH+S ATK  + +   + +  RG +++KGKG ++TYWL G
Sbjct:  785 RKAENLLYQILPHSVAEQLKRG-ETVQA-EAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQ---LRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLG 995          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc5 (guanylate cyclase OlGC5 [Source:NCBI gene;Acc:100125800])

HSP 1 Score: 217.624 bits (553), Expect = 7.646e-59
Identity = 114/216 (52.78%), Postives = 147/216 (68.06%), Query Frame = 1
Query: 1303 KKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVT-QYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQ-SYKISERGHIDIKGKGNIKTYWLDGHN 1944
            +KTD L+ QM+PKSVA+ L+ G       EHF EVT+ FSD+VGF+TI +   P +VV++LN LYS+FD +   H VYKVETIGDAYM+ASG PT     HA  I  MSLD++  IG           ++IR+G+H+G VVAGVVGL MPRYCLFGDTVNT SRMES S P ++H++++T   +  L+  YKI  RG  ++KGKG   TYWL G +
Sbjct:  898 QKTDNLVAQMLPKSVAQSLKLGKPV--EPEHFSEVTLYFSDIVGFSTISTLSEPIEVVDLLNDLYSLFDAIIPLHDVYKVETIGDAYMVASGVPTRNGNRHAAEIANMSLDILHCIGTFKARHMPDLKIRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTTSRMESTSSPYRVHVNQSTVNLLNSLKLGYKIDVRGLTELKGKGIETTYWLVGKD 1111          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000035922.1 (SMESG000035922.1)

HSP 1 Score: 1279.23 bits (3309), Expect = 0.000e+0
Identity = 676/676 (100.00%), Postives = 676/676 (100.00%), Query Frame = 1
Query:  151 MLLAMYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDGWESLTHXXXXXXXXXTGSILELSHTKRLASINHGDSVPGGPEN 2178
            MLLAMYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLPVPSEVFFEVFPFNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGEQQSAELKLALEQESEKSKKLEESLHKLDELMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDGWESLTHSRASSARSRTGSILELSHTKRLASINHGDSVPGGPEN
Sbjct:    1 MLLAMYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLPVPSEVFFEVFPFNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGEQQSAELKLALEQESEKSKKLEESLHKLDELMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDGWESLTHSRASSARSRTGSILELSHTKRLASINHGDSVPGGPEN 676          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000035922.1 (SMESG000035922.1)

HSP 1 Score: 1271.14 bits (3288), Expect = 0.000e+0
Identity = 672/672 (100.00%), Postives = 672/672 (100.00%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDGWESLTHXXXXXXXXXTGSILELSHTKRLASINHGDSVPGGPEN 2178
            MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLPVPSEVFFEVFPFNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGEQQSAELKLALEQESEKSKKLEESLHKLDELMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDGWESLTHSRASSARSRTGSILELSHTKRLASINHGDSVPGGPEN
Sbjct:    1 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLPVPSEVFFEVFPFNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGEQQSAELKLALEQESEKSKKLEESLHKLDELMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDGWESLTHSRASSARSRTGSILELSHTKRLASINHGDSVPGGPEN 672          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000079311.1 (SMESG000079311.1)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 379/635 (59.69%), Postives = 473/635 (74.49%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDN-VSNCIMRLHFNNKNFIQIEDLLXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDGWESLT 2064
            MYGL+LEG+RQFICS YG   W  IL  + +DV  F  HEVY E L+  I+ +A+ +  +T DE+MF NG +FI+F+S YGYD ILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNES+TGITLQYRT+R+G++HYVRGQI EIA+ FY+T + IEI+ +    N V NC                             PFNIVFNRG+R +NCG+GM N +PD+    + + F + RP+I+ +WD ++LH+NN+FELI L  K S          S    +L  +N  L+MRGQMKYM EWDAIVFLGTPIMRDVESM+KAGL+INDLSMHDSSRDLVLAGEQQSAEL+LALEQESEKSK+LE+SL +LD+ M++TDELL+QMIP++VA RLR+G ++V+TCE F+EVTILFSDVVGFT ICS I P DVVEMLN +YSVFD+LTE+HKVYKVET+GDAYMIASGCP +T  +AP I EM+L+MI  I  + +P++   SL+IRVGIHTG VVAGVVG+KMPRYCLFGDTVNTASRMES  E QKI IS +T+ K+     Y+I ERG +++KGKGN+ TYWL+ H  +    + + +  + +ER  + D+N++  Q  G+ W  L+
Sbjct:    1 MYGLLLEGIRQFICSTYGLQAWTQILEKSKLDVNVFAIHEVYDEELLKRIVFTAADYCRITKDELMFQNGKYFISFLSHYGYDSILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESRTGITLQYRTQRAGFVHYVRGQIFEIAKTFYNTTIEIEIIGENKMPNKVFNCF----------------------------PFNIVFNRGLRVVNCGRGMRNLIPDIIGDYVGDVFHVNRPIIQISWDTIILHSNNVFELILLHIKKSRLSD------SDSSNSLKESNYRLRMRGQMKYMNEWDAIVFLGTPIMRDVESMWKAGLYINDLSMHDSSRDLVLAGEQQSAELRLALEQESEKSKRLEDSLKRLDDEMRRTDELLYQMIPRAVANRLRNGEKSVNTCETFNEVTILFSDVVGFTKICSNITPLDVVEMLNSMYSVFDQLTERHKVYKVETVGDAYMIASGCPVLTTLNAPLIAEMALEMIDKICTIKNPANEIESLKIRVGIHTGTVVAGVVGIKMPRYCLFGDTVNTASRMESTGETQKIQISSSTQKKLMMHNVYQIVERGVVEVKGKGNVSTYWLEKHLDKQSLGLLNYMETVTKERERLGDANMSTYQSHGEYWHELS 601          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000051217.1 (SMESG000051217.1)

HSP 1 Score: 474.552 bits (1220), Expect = 2.438e-155
Identity = 270/627 (43.06%), Postives = 412/627 (65.71%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDL------LXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKI--LREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIK-SIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDS 2016
            MYGL++  ++ F+ S YG D W   L  A+ID  +  TH VY ET+IP I+ + S  LN   ++IMF NG +F+ ++S  GYD ILRVLGR+  DF+ GLDNLHEYLRFSYPK+KPPSF   + +++ I L YRT+R G+ HYVRGQ+  IA+ FY  ++ I ++S+  +   ++    +  + K F +  ++       P+  ++FFE+FPF++V +  +   +CG G  +  P L +    + F+L++P I+ T++ ++ + N+ FE+I L P  SS  +    + + ++ KR  S     +K +GQM  MP W+ ++FLGTP++RDV+ + +AGLF+NDL+  D+ +D++LAG QQS EL    E++ EKSK+LEE++  L++  KKTDELL+Q IPKS+A+RLR G  ++DTC+ F  V+I FS VV F  ICS+I+   +V +LN +Y+ FD LTE +KVYKVETI D+YM+ SG P+ T  H+  I+EM+L MI  +   L +P+  S S+++ +G H+GM+VAG+VG+KMPRYCLFGDTVNT+SRM S+  P K+H+S+     ++    Y  ++RG ++IKGKG++ TY+++     +   V     +LE +R+   DS
Sbjct:    1 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEII-LMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKQLEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKV--FKQKLEEDRLMHDDS 623          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000051217.1 (SMESG000051217.1)

HSP 1 Score: 474.167 bits (1219), Expect = 2.472e-155
Identity = 270/627 (43.06%), Postives = 412/627 (65.71%), Query Frame = 1
Query:  163 MYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDL------LXXXXXXXXXXXXXNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPLIEFTWDAVMLHTNNIFELIHLDPKISSSKI--LREGNHSSKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIK-SIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDS 2016
            MYGL++  ++ F+ S YG D W   L  A+ID  +  TH VY ET+IP I+ + S  LN   ++IMF NG +F+ ++S  GYD ILRVLGR+  DF+ GLDNLHEYLRFSYPK+KPPSF   + +++ I L YRT+R G+ HYVRGQ+  IA+ FY  ++ I ++S+  +   ++    +  + K F +  ++       P+  ++FFE+FPF++V +  +   +CG G  +  P L +    + F+L++P I+ T++ ++ + N+ FE+I L P  SS  +    + + ++ KR  S     +K +GQM  MP W+ ++FLGTP++RDV+ + +AGLF+NDL+  D+ +D++LAG QQS EL    E++ EKSK+LEE++  L++  KKTDELL+Q IPKS+A+RLR G  ++DTC+ F  V+I FS VV F  ICS+I+   +V +LN +Y+ FD LTE +KVYKVETI D+YM+ SG P+ T  H+  I+EM+L MI  +   L +P+  S S+++ +G H+GM+VAG+VG+KMPRYCLFGDTVNT+SRM S+  P K+H+S+     ++    Y  ++RG ++IKGKG++ TY+++     +   V     +LE +R+   DS
Sbjct:    1 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQSINTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIKIFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSKPFIDATYEKIVRYNNSNFEII-LMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKQLEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQF-PYNYTKRGEMEIKGKGSMTTYFIESRKSGDEYKV--FKQKLEEDRLMHDDS 623          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUCY1B18.592e-9934.74guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B12.607e-9433.70guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B18.312e-9435.48guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B14.110e-9335.48guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B17.788e-8936.08guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-316.413e-16644.75Soluble guanylate cyclase gcy-31 [Source:UniProtK... [more]
gcy-312.983e-15746.74Soluble guanylate cyclase gcy-31 [Source:UniProtK... [more]
gcy-318.645e-12244.85Soluble guanylate cyclase gcy-31 [Source:UniProtK... [more]
gcy-337.091e-11436.57Soluble guanylate cyclase gcy-33 [Source:UniProtK... [more]
gcy-331.054e-11336.45Soluble guanylate cyclase gcy-33 [Source:UniProtK... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gyc88E0.000e+052.07gene:FBgn0038295 transcript:FBtr0110961[more]
Gyc88E0.000e+052.07gene:FBgn0038295 transcript:FBtr0306245[more]
Gyc88E0.000e+052.07gene:FBgn0038295 transcript:FBtr0334926[more]
Gyc32E8.302e-6149.57gene:FBgn0010197 transcript:FBtr0346610[more]
Gyc32E9.021e-6149.57gene:FBgn0010197 transcript:FBtr0112856[more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b11.083e-9533.82guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
gucy1b11.969e-9333.94guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
gucy1b29.108e-7139.74guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
npr1b7.992e-6150.70natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
CABZ01078606.11.705e-6048.66atrial natriuretic peptide receptor 1-like [Source... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUCY1B19.942e-9734.25guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.065e-9634.25guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.553e-9634.25guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B18.730e-9333.44guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B12.247e-8532.68guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gucy1b19.418e-9934.47guanylate cyclase 1, soluble, beta 1 [Source:MGI S... [more]
Gucy1b13.170e-9735.45guanylate cyclase 1, soluble, beta 1 [Source:MGI S... [more]
Gucy1b21.092e-6840.00guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy1b21.199e-6840.00guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy1a25.228e-6331.66guanylate cyclase 1, soluble, alpha 2 [Source:MGI ... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8INF0|GCY8E_DROME0.000e+052.07Soluble guanylate cyclase 88E OS=Drosophila melano... [more]
sp|Q86C56|GCY31_CAEEL8.158e-16544.75Soluble guanylate cyclase gcy-31 OS=Caenorhabditis... [more]
sp|P90895|GCY33_CAEEL9.020e-11336.57Soluble guanylate cyclase gcy-33 OS=Caenorhabditis... [more]
sp|P20595|GCYB1_RAT7.668e-9934.58Guanylate cyclase soluble subunit beta-1 OS=Rattus... [more]
sp|Q4ZHR9|GCYB1_CANLF3.524e-9834.80Guanylate cyclase soluble subunit beta-1 OS=Canis ... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J7G20.000e+064.10Guanylate cyclase domain-containing protein OS=Mac... [more]
A0A4Z2CYH70.000e+057.93Soluble guanylate cyclase 88E OS=Schistosoma japon... [more]
A0A1I8GYZ90.000e+062.05Guanylate cyclase domain-containing protein OS=Mac... [more]
A0A3Q0KPP50.000e+057.93Putative soluble guanylate cyclase gcy OS=Schistos... [more]
A0A4S2L6L00.000e+053.06Guanylate cyclase domain-containing protein OS=Opi... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000045584.10.000e+049.10soluble guanylate cyclase 88E-like [Source:NCBI ge... [more]
ENSAMXT00000031087.12.936e-13348.18soluble guanylate cyclase 88E-like [Source:NCBI ge... [more]
ENSAMXT00000037807.12.488e-10161.28soluble guanylate cyclase 88E-like [Source:NCBI ge... [more]
gucy1b24.226e-9834.78guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy1b22.035e-9734.61guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b23.065e-7141.62guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSPMAT00000002650.11.437e-6249.55pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 ge... [more]
ENSPMAT00000006352.14.570e-6250.23pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR12.465e-5948.60natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000000043.13.045e-4947.76pep scaffold:Pmarinus_7.0:GL480785:4349:14716:1 ge... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO430952.636e-16141.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403624.091e-13640.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470833.586e-9132.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470848.598e-8231.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453061.382e-6853.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b12.213e-7633.69fatty acid binding protein 2 [Source:NCBI gene;Acc... [more]
olgc79.523e-6048.62membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc71.095e-5948.62membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
npr26.492e-5952.31natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
olgc57.646e-5952.78guanylate cyclase OlGC5 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035922.10.000e+0100.00SMESG000035922.1[more]
SMESG000035922.10.000e+0100.00SMESG000035922.1[more]
SMESG000079311.10.000e+059.69SMESG000079311.1[more]
SMESG000051217.12.438e-15543.06SMESG000051217.1[more]
SMESG000051217.12.472e-15543.06SMESG000051217.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013355 ID=SMED30013355|Name=Guanylate cyclase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2293bp
CATTGACATTCAATTGGTCGATGGGATCGAGACATGTTCACTTCTGGAAA
TGAATTCCTTTAGTTTTTAATGGGAAAACGACTCGTCTCCTTTGCAGTTG
GCTGGTTTGTTTACTAATAGAACTATAAATAAATTGTGAGCAATTATTAA
ATGCTACTTGCAATGTATGGATTGATATTAGAAGGAGTTCGACAGTTTAT
TTGCTCGAAATATGGAGAGGATCATTGGAACAGCATCCTACGTTCCGCCG
ATATTGACGTTATCACATTCGGAACGCACGAAGTCTACGGAGAAACATTA
ATCCCAAACATCATTGAATCAGCCTCAAGATTTCTCAACATGACTGTCGA
TGAAATTATGTTCCTAAATGGGATCTTTTTTATAAACTTTGTCTCTCAAT
ATGGATACGATGGAATTCTTAGAGTTTTAGGAAGAGATCTGAGAGATTTT
CTCAATGGATTAGACAATCTTCACGAGTACCTTCGATTCAGTTATCCTAA
ATTGAAACCGCCATCGTTTTTCTGTGTCAATGAAAGCAAAACCGGAATCA
CGTTGCAATATCGCACCAGAAGAAGCGGATATATACATTATGTCCGGGGA
CAAATCACTGAAATCGCCCGACAGTTTTACAGTACAGAAATGTCCATAGA
AATCGTCAGTCAAACAAGTGAGGATAACGTTTCCAATTGCATCATGAGGT
TGCATTTCAACAATAAGAACTTCATTCAAATCGAAGATTTACTTCCTGTT
CCATCGGAAGTATTCTTCGAGGTTTTCCCATTCAATATTGTTTTCAATCG
GGGGATGAGAGCCATAAATTGTGGGAAAGGAATGCTGAATGCTCTTCCAG
ACCTACCTCATCAGTTAATAACAGAATATTTTCTTTTAACCAGACCGTTA
ATTGAGTTCACTTGGGATGCGGTAATGCTCCATACGAACAATATATTTGA
ACTGATTCATCTTGATCCTAAGATTAGCTCATCAAAAATTCTCCGAGAAG
GAAATCACTCATCGAAAAAGCGTACTTTATCTAGAAATAATCCTAGTCTA
AAGATGAGAGGACAAATGAAATATATGCCGGAATGGGATGCGATAGTTTT
CCTTGGTACTCCTATAATGAGGGATGTTGAAAGCATGTACAAAGCTGGAC
TTTTTATTAATGATCTGAGTATGCATGACTCTAGCCGTGACTTAGTACTT
GCCGGAGAGCAGCAATCTGCCGAATTGAAATTAGCCTTAGAGCAGGAAAG
TGAAAAAAGTAAAAAATTGGAAGAAAGTTTACATAAACTGGATGAATTAA
TGAAGAAAACCGACGAGCTTTTGTTTCAAATGATTCCAAAAAGCGTGGCG
GAACGATTACGACACGGATCAGAGGCTGTTGACACTTGTGAACATTTTGA
CGAAGTAACGATATTGTTCAGCGATGTGGTTGGCTTCACCACTATATGCT
CTAAAATAAATCCATTTGATGTAGTGGAAATGCTCAATAAATTATATTCA
GTATTTGATGAGCTCACTGAAAAACACAAAGTTTATAAAGTTGAAACTAT
TGGTGATGCGTACATGATCGCATCTGGATGCCCAACTGTCACCCAATATC
ATGCACCATTTATAATTGAAATGTCATTGGATATGATAAAATCTATAGGT
TTTCTTATGGATCCTTCAGATCATTCAAGAAGTCTACAAATTCGAGTTGG
AATACATACAGGCATGGTTGTGGCGGGAGTAGTCGGATTGAAAATGCCCC
GGTATTGTCTATTTGGGGACACAGTTAATACGGCTTCGCGGATGGAATCA
AACAGTGAGCCACAAAAGATCCACATCAGTGAAGCTACAAAAGCTAAAGT
CACCGATCTGCAGTCTTACAAAATCAGTGAAAGAGGCCATATTGACATTA
AGGGAAAAGGAAACATTAAAACATACTGGCTAGATGGTCATAACTTAGAA
AATCCGAAGGCTGTGGCGTCTTTGATAACCCAACTCGAACGAGAGCGAAT
TACAATATCCGATTCCAATTTGGCTGGATCTCAAATTAAAGGTGACGGTT
GGGAAAGTCTTACTCACAGTCGAGCTAGTTCAGCTCGCAGTCGAACGGGA
TCAATTTTGGAACTGTCTCATACCAAAAGACTGGCTTCAATAAATCACGG
AGATTCCGTTCCCGGGGGACCAGAAAATGGCCGTGGAATCAAAAGAAAAT
AAATTGCAATTATTTGCATTTATACCAATGTATTTCTTAAAATCAGTATT
TTTATATCTTAGATAGTGCTAGATTTGTTTTTTTAGATAACCC
back to top

protein sequence of SMED30013355-orf-1

>SMED30013355-orf-1 ID=SMED30013355-orf-1|Name=SMED30013355-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=684bp
MLLAMYGLILEGVRQFICSKYGEDHWNSILRSADIDVITFGTHEVYGETL
IPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDF
LNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRG
QITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLPV
PSEVFFEVFPFNIVFNRGMRAINCGKGMLNALPDLPHQLITEYFLLTRPL
IEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHSSKKRTLSRNNPSL
KMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVL
AGEQQSAELKLALEQESEKSKKLEESLHKLDELMKKTDELLFQMIPKSVA
ERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYS
VFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIG
FLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMES
NSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLE
NPKAVASLITQLERERITISDSNLAGSQIKGDGWESLTHSRASSARSRTG
SILELSHTKRLASINHGDSVPGGPENGRGIKRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042463HNOB_dom_associated_sf
IPR038158H-NOX_domain_sf
IPR001054A/G_cyclase
IPR011644Heme_NO-bd
IPR011645HNOB_dom_associated
IPR018297A/G_cyclase_CS
IPR029787Nucleotide_cyclase
IPR024096NO_sig/Golgi_transp_ligand-bd
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0009190cyclic nucleotide biosynthetic process
GO:0006182cGMP biosynthetic process
GO:0000302response to reactive oxygen species
GO:0001666response to hypoxia
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0020037heme binding
GO:0004383guanylate cyclase activity
GO:0000166nucleotide binding
GO:0005525GTP binding
GO:0016829lyase activity
GO:0019825oxygen binding
GO:0019826oxygen sensor activity
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0046982protein heterodimerization activity
GO:0070025carbon monoxide binding
GO:0070026nitric oxide binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0008074guanylate cyclase complex, soluble
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 356..390
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 663..683
NoneNo IPR availablePANTHERPTHR45655FAMILY NOT NAMEDcoord: 5..600
NoneNo IPR availablePANTHERPTHR45655:SF10SOLUBLE GUANYLATE CYCLASE 88Ecoord: 5..600
NoneNo IPR availableCDDcd07302CHDcoord: 418..594
e-value: 1.30524E-69
score: 222.84
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 382..585
e-value: 2.3E-92
score: 322.9
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 414..595
e-value: 2.6E-66
score: 222.7
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 420..549
score: 48.203
IPR042463Haem NO binding associated domain superfamilyGENE3DG3DSA:3.30.450.260coord: 200..337
e-value: 7.9E-26
score: 92.1
IPR011645Haem NO binding associatedPFAMPF07701HNOBAcoord: 199..403
e-value: 6.4E-67
score: 225.2
IPR011644Heme NO-bindingPFAMPF07700HNOBcoord: 6..168
e-value: 4.3E-53
score: 179.6
IPR038158H-NOX domain superfamilyGENE3DG3DSA:3.90.1520.10coord: 5..194
e-value: 1.2E-59
score: 202.9
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 409..598
e-value: 8.6E-74
score: 249.1
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 412..594
IPR018297Adenylyl cyclase class-4/guanylyl cyclase, conserved sitePROSITEPS00452GUANYLATE_CYCLASE_1coord: 526..549
IPR024096NO signalling/Golgi transport ligand-binding domain superfamilySUPERFAMILYSSF111126Ligand-binding domain in the NO signalling and Golgi transportcoord: 5..191