HPHLAWLY domain-containing protein

Overview
NameHPHLAWLY domain-containing protein
Smed IDSMED30013350
Length (bp)2630
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HPHLAWLY domain-containing protein (SMED30013350) t-SNE clustered cells

Violin plots show distribution of expression levels for HPHLAWLY domain-containing protein (SMED30013350) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HPHLAWLY domain-containing protein (SMED30013350) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HPHLAWLY domain-containing protein (SMED30013350) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013350

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013350SMESG000034214.1 SMESG000030723.1 SMESG000030612.1 SMESG000030179.1 SmedASXL_016562SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013350SMESG000034214.1 SMESG000030723.1 SMESG000030612.1 SMESG000030179.1 dd_Smed_v4_10891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013350SMESG000034214.1 SMESG000030723.1 SMESG000030612.1 SMESG000030179.1 dd_Smed_v6_10891_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30013350SMESG000033592.1 SMESG000055969.1 SMESG000051837.1 SMESG000034214.1 SMESG000030612.1 SMESG000030179.1 SMESG000026530.1 SMESG000024597.1 Contig31637newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013350SMESG000033592.1 SMESG000055969.1 SMESG000051837.1 SMESG000034214.1 SMESG000030612.1 SMESG000030179.1 SMESG000026530.1 SMESG000024597.1 Contig31637uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013350SMESG000034214.1 SMESG000030612.1 SMESG000030179.1 Contig15870newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013350SMESG000034214.1 SMESG000030612.1 SMESG000030179.1 Contig15870uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013350SMESG000034214.1 SMESG000030612.1 SMESG000030179.1 Contig34460newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013350SMESG000034214.1 SMESG000030612.1 SMESG000030179.1 Contig34460uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013350SMESG000030723.1 Contig41663newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013350SMESG000030723.1 Contig41663uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30013350SMESG000034214.1 SMESG000030723.1 SMESG000030612.1 SMESG000030179.1 dd_Smed_v4_10891_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013350SMESG000034214.1 SMESG000030723.1 SMESG000030612.1 SMESG000030179.1 dd_Smed_v4_10891_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013350SMESG000034214.1 SMESG000030723.1 SMESG000030612.1 SMESG000030179.1 dd_Smed_v4_10891_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Zebrafish
Match: si:ch1073-266p11.2 (si:ch1073-266p11.2 [Source:ZFIN;Acc:ZDB-GENE-141216-287])

HSP 1 Score: 68.5514 bits (166), Expect = 2.549e-11
Identity = 52/194 (26.80%), Postives = 87/194 (44.85%), Query Frame = 2
Query:  131 IFSIEIFIDRIRLLEGEKCLF-PSTILKLLDYEPAIISTVDNNVQTELRDYLDLLEKNNEPTKPAQLNELKDVDG-NYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISK--TNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEVRI 700
            +FS+E+ ID +R       +  P+  ++LLD+ P ++             Y DL         P  L+   D D   Y   KGKS LFK N  +L +   + PLY ++ D       L+G   I L+     +   + K   N   +       PI NL+G ++G I++  +++ +GA+L PH+ +    EV +
Sbjct:    8 LFSLELVIDYVRFGGSRGTVLDPAVGIRLLDF-PTLLIYHSGREDPSKSGYADLC------VSPEALSHPDDGDNFKYTFHKGKSCLFKINLDSLHTHLLNTPLYAMVLDVKDEIPRLIGSSLISLAKVTERIKVDVRKHGINTPAAYGERLSSPICNLMGSSIGVISLAYKIVSLGAHLIPHIPDSRVYEVGV 194          
BLAST of HPHLAWLY domain-containing protein vs. TrEMBL
Match: A0A267EMW7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017898g1 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.191e-25
Identity = 63/192 (32.81%), Postives = 106/192 (55.21%), Query Frame = 2
Query:  128 NIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNN-VQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISK--TNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEV 694
            ++FS+E++IDRIRL     CLFP+T+ KLLD+    +S          LR  +   E+     + +QL+EL+D DGN  +R+GKS LF+     L    +++P+YI + D Y+ P  L  V ++ L      + +  +K      V+ ++ G F +++L+G  VG +T K+RL  +G ++A HL  +  +E 
Sbjct:   19 SLFSVELYIDRIRLSPSADCLFPTTLFKLLDFGTQRLSECPQGPAAASLRRAIADYERATGGQRRSQLDELRDSDGNIRIRRGKSALFRMPPDRLAKCLSAVPMYIFLVDAYHQPPKLAAVCSLALDGLAQEVLQHQAKHGVGVPVTRELSGVFGLLSLMGHEVGLMTAKVRLASLGPSVAAHLPAQAPVEA 210          
BLAST of HPHLAWLY domain-containing protein vs. TrEMBL
Match: A0A267GNR2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023745g2 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.879e-25
Identity = 63/192 (32.81%), Postives = 106/192 (55.21%), Query Frame = 2
Query:  128 NIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNN-VQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISK--TNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEV 694
            ++FS+E++IDRIRL     CLFP+T+ KLLD+    +S          LR  +   E+     + +QL+EL+D DGN  +R+GKS LF+     L    +++P+YI + D Y+ P  L  V ++ L      + +  +K      V+ ++ G F +++L+G  VG +T K+RL  +G ++A HL  +  +E 
Sbjct:   18 SLFSVELYIDRIRLSPSADCLFPTTLFKLLDFGTQRLSECPQGPAAASLRRAIADYERATGGQRRSQLDELRDSDGNIRIRRGKSALFRMPPDRLAKCLSAVPMYIFLVDAYHQPPKLAAVCSLALDGLAQEVLQHQAKHGVGVPVTRELSGVFGLLSLMGHEVGLMTAKVRLASLGPSVAAHLPAQAPVEA 209          
BLAST of HPHLAWLY domain-containing protein vs. TrEMBL
Match: A0A267EH32 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023745g1 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.030e-24
Identity = 63/192 (32.81%), Postives = 106/192 (55.21%), Query Frame = 2
Query:  128 NIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNN-VQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISK--TNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEV 694
            ++FS+E++IDRIRL     CLFP+T+ KLLD+    +S          LR  +   E+     + +QL+EL+D DGN  +R+GKS LF+     L    +++P+YI + D Y+ P  L  V ++ L      + +  +K      V+ ++ G F +++L+G  VG +T K+RL  +G ++A HL  +  +E 
Sbjct:   17 SLFSVELYIDRIRLSPSADCLFPATLFKLLDFGTQRLSECPQGPAAASLRRAIADYERATGGQRRSQLDELRDSDGNIRIRRGKSALFRMPPDRLAKCLSAVPMYIFLVDAYHQPPKLAAVCSLALDGLAQEVLQHQAKHGVGVPVTRELSGVFGLLSLMGYEVGLMTAKVRLASLGPSVAAHLPAQAPVEA 208          
BLAST of HPHLAWLY domain-containing protein vs. TrEMBL
Match: A0A3S0ZJS7 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_011691 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 9.823e-22
Identity = 73/231 (31.60%), Postives = 124/231 (53.68%), Query Frame = 2
Query:  128 NIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNNVQTELRDYLDLLEKNNEP--TKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVS--EDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEVRIKS---KVKSPVDRAIDCG-DPISEETNPPEKILMRN 796
            ++FS+E+ ++++  +    C FP+   +LLD+   +I  V++++ T +R+ +       +P  T P Q +ELKD  GN++VRKGKS LFK     L     S PLY+++ D +     L+G  T+ L   + S+   I K   TV       G F I NL+G  +G+  +  R++  G +L PHL E   ++ + K    KV+  V++ +DC    +S+  N PE +++RN
Sbjct:    3 SLFSLELVVEKL-YIPHTPCRFPAVAFRLLDFPTILIKHVEDDLGTAIRNKISF-----DPYYTLPDQFSELKDKHGNFMVRKGKSCLFKIRAELLKQHLASTPLYVMVIDMFPEVPKLIGNSTVPLDAVIDSICMDIVKMGPTVPSVHGDKGLFKIYNLMGKEIGYFVLGFRMLCFGPSLIPHLPESTLMQRQSKGGRKKVERSVEKMLDCSMKNVSDGENEPE-VILRN 226          
BLAST of HPHLAWLY domain-containing protein vs. TrEMBL
Match: A0A1I8IBL8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.518e-20
Identity = 61/187 (32.62%), Postives = 102/187 (54.55%), Query Frame = 2
Query:  140 IEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNN-VQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISK--TNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIE 691
            +E++IDRIRL     CLFP+T+ KLLD+    +S          LR  +   E+     + +QL+EL+D DGN  +R+GKS LF+     L    +++P+YI + D Y+ P  L  V ++ L      + +  +K      V+ ++ G F +++L+G  VG +T K+RL  +G ++A HL  +  +E
Sbjct: 1303 VELYIDRIRLSPSADCLFPTTLFKLLDFGTQRLSECPQGPAAASLRRAIADYERATGGQRRSQLDELRDSDGNIRIRRGKSALFRMPPDRLAKCLSAVPMYIFLVDAYHQPPKLAAVCSLALDGLAQEVLQHQAKHGVGVPVTRELSGVFGLLSLMGHEVGLMTAKVRLASLGPSVAAHLPAQAPVE 1489          
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Nematostella
Match: EDO46819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNY5])

HSP 1 Score: 83.5741 bits (205), Expect = 1.836e-16
Identity = 55/186 (29.57%), Postives = 90/186 (48.39%), Query Frame = 2
Query:  119 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNNVQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVS--EDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHL 670
            MS ++FS+E+ ++ ++ L+   C  P+   +LLD+   II  V      +LR+   L         P    EL+D  GN    KGKS LF+ N   L  +    P+Y+++ D +     L+G  TI L  ++  +   + K   +V        KF I NL+G  VG   + +RL+ +G +L PH+
Sbjct:    1 MSESLFSLEVHVESVQNLK-VSCSIPAITYRLLDFPTLIIHHVSPLTVDKLREKAKLANLGKNTAFP----ELRDRFGNVPFNKGKSCLFRMNVEDLHQKLQVTPIYVMLVDVWPKKPKLIGSTTIPLKRSIDRIIDDVKKNGVSVPSFSKEENKFDIFNLMGSKVGKAVLGVRLLSLGGSLIPHI 181          
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Medaka
Match: si:ch1073-266p11.2 (microtubule associated protein 10 [Source:NCBI gene;Acc:105355835])

HSP 1 Score: 53.9138 bits (128), Expect = 6.795e-7
Identity = 44/169 (26.04%), Postives = 76/169 (44.97%), Query Frame = 2
Query:  275 DYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISK--TNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEVRIKSKVKSPVDRAIDCGDPISEETNPP 775
            D+  LL +    +  AQ  + K ++  YV  +GKS  FK N   L+      PL+ L+ D       L+G   + L++ +  + + +++  ++   S        I +  G+ VG I++  +L Y+GA L PH+ E    E   +  V+      I  G    EE +PP
Sbjct:   39 DFPALLIRQPRQSAHAQKGDPKVLE--YVFNRGKSCFFKMNLRPLLVRLTGSPLHALVLDVTEEKPRLLGSCLLSLAEAMSRVWQDVTERGSSRPSSHGERRLIGISDPSGEKVGTISLSYKLAYLGAGLLPHIPETRVQEGTGQDHVR---QERIPAGPLACEEEHPP 202          
BLAST of HPHLAWLY domain-containing protein vs. Planmine SMEST
Match: SMESG000030612.1 (SMESG000030612.1)

HSP 1 Score: 1234.55 bits (3193), Expect = 0.000e+0
Identity = 621/642 (96.73%), Postives = 626/642 (97.51%), Query Frame = 2
Query:  119 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNNVQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNSNEKFNKQPIRQPVKNSPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRLNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDLSSAIEPPIPRSKRNSLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYAXXXXXXXXXXXXXDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETASTDDDAWRSVDNKGNEYSDGFNQSFSAENDDGKNQSRRYSMA 2044
            MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDN+VQTELRDYLDLLEK NEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLS+TVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEE HIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRN NEK NKQPIRQPVKN PPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIR NSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSD SSAIEPPIPRSKRN LVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSISYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETASTDDDAWRSVDNKGNEYSDGFNQSFS ENDD    +R + + 
Sbjct:    1 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNDVQTELRDYLDLLEKTNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSNTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEQHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNFNEKVNKQPIRQPVKNLPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRPNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDFSSAIEPPIPRSKRNPLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSISYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETASTDDDAWRSVDNKGNEYSDGFNQSFSTENDDDLELARAHFLT 642          
BLAST of HPHLAWLY domain-containing protein vs. Planmine SMEST
Match: SMESG000030612.1 (SMESG000030612.1)

HSP 1 Score: 1232.62 bits (3188), Expect = 0.000e+0
Identity = 620/631 (98.26%), Postives = 622/631 (98.57%), Query Frame = 2
Query:  119 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNNVQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNSNEKFNKQPIRQPVKNSPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRLNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDLSSAIEPPIPRSKRNSLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYAXXXXXXXXXXXXXDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETASTDDDAWRSVDNKGNEYSDGFNQSFSAENDD 2011
            MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDN+VQTELRDYLDLLEK NEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLS+TVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEE HIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRN NEK NKQPIRQPVKN PPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIR NSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSD SSAIEPPIPRSKRN LVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSISYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETASTDDDAWRSVDNKGNEYSDGFNQSFS ENDD
Sbjct:    1 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNDVQTELRDYLDLLEKTNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSNTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEQHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNFNEKVNKQPIRQPVKNLPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRPNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDFSSAIEPPIPRSKRNPLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSISYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETASTDDDAWRSVDNKGNEYSDGFNQSFSTENDD 631          
BLAST of HPHLAWLY domain-containing protein vs. Planmine SMEST
Match: SMESG000034214.1 (SMESG000034214.1)

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 618/642 (96.26%), Postives = 623/642 (97.04%), Query Frame = 2
Query:  119 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNNVQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNSNEKFNKQPIRQPVKNSPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRLNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDLSSAIEPPIPRSKRNSLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYAXXXXXXXXXXXXXDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETASTDDDAWRSVDNKGNEYSDGFNQSFSAENDDGKNQSRRYSMA 2044
            MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDN+VQTELRDYLDLLEK NEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEE HIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSE EE PNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRN NEK NKQPIRQPVKN PPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIR NSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSD SSAIEPPIPRSKRN LVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSISYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHT QPPPSDSV+NSETASTDDDAWRSVDNKGNEYSDGFNQSFS ENDD    +R + + 
Sbjct:    1 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNDVQTELRDYLDLLEKTNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEQHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEQEECPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNFNEKVNKQPIRQPVKNPPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRPNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDFSSAIEPPIPRSKRNPLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSISYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTAQPPPSDSVENSETASTDDDAWRSVDNKGNEYSDGFNQSFSTENDDDLELARAHFLT 642          
BLAST of HPHLAWLY domain-containing protein vs. Planmine SMEST
Match: SMESG000034214.1 (SMESG000034214.1)

HSP 1 Score: 1228 bits (3176), Expect = 0.000e+0
Identity = 617/631 (97.78%), Postives = 619/631 (98.10%), Query Frame = 2
Query:  119 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNNVQTELRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNSNEKFNKQPIRQPVKNSPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRLNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDLSSAIEPPIPRSKRNSLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYAXXXXXXXXXXXXXDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETASTDDDAWRSVDNKGNEYSDGFNQSFSAENDD 2011
            MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDN+VQTELRDYLDLLEK NEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEE HIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSE EE PNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRN NEK NKQPIRQPVKN PPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIR NSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSD SSAIEPPIPRSKRN LVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSISYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHT QPPPSDSV+NSETASTDDDAWRSVDNKGNEYSDGFNQSFS ENDD
Sbjct:    1 MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNDVQTELRDYLDLLEKTNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISEFNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDVMGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEQHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEQEECPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNFNEKVNKQPIRQPVKNPPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRPNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDFSSAIEPPIPRSKRNPLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSISYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTAQPPPSDSVENSETASTDDDAWRSVDNKGNEYSDGFNQSFSTENDD 631          
BLAST of HPHLAWLY domain-containing protein vs. Planmine SMEST
Match: SMESG000030179.1 (SMESG000030179.1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 310/363 (85.40%), Postives = 313/363 (86.23%), Query Frame = 2
Query:  650 ANL-APHLQEEHHIEVRIKSKVKSPVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVENNLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNSNEKFNKQPIRQPVKNSPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRLNSPLGIVPKGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSINPSTKPDFYRPIYSSDLSSAIEPPIPRSKRNSLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYA 1735
            ANL APHLQ+E HI+VRIKSKVKSPVDRAIDCGDPISEETNP EKILMRNIGCQVNKHKSIRIQV IVSENVENNLAKVGLTID NDPILVDHPPMIYNSYYGNGEDTDSE EE PNKPI+NTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNSNEK                                    ERKDFLKRISKPKIR NSPLGIVPKGK WLRTEPEYSG I SQLQYKLTKTQSKRIELANPKLFRKILRQKSI PSTKPDFYRPIYSSD SSAIEPPIPRSKRN LVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYA
Sbjct:    5 ANLTAPHLQDEQHIQVRIKSKVKSPVDRAIDCGDPISEETNPREKILMRNIGCQVNKHKSIRIQVSIVSENVENNLAKVGLTIDLNDPILVDHPPMIYNSYYGNGEDTDSEQEECPNKPIKNTLSKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNSNEK------------------------------------ERKDFLKRISKPKIRPNSPLGIVPKGKSWLRTEPEYSGLIHSQLQYKLTKTQSKRIELANPKLFRKILRQKSIIPSTKPDFYRPIYSSDFSSAIEPPIPRSKRNPLVPPLFGTGTSGSVPSFTGSIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYA 331          
The following BLAST results are available for this feature:
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch1073-266p11.22.549e-1126.80si:ch1073-266p11.2 [Source:ZFIN;Acc:ZDB-GENE-14121... [more]
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EMW75.191e-2532.81Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GNR25.879e-2532.81Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EH321.030e-2432.81Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3S0ZJS79.823e-2231.60Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A1I8IBL88.518e-2032.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO468191.836e-1629.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HPHLAWLY domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch1073-266p11.26.795e-726.04microtubule associated protein 10 [Source:NCBI gen... [more]
back to top
BLAST of HPHLAWLY domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030612.10.000e+096.73SMESG000030612.1[more]
SMESG000030612.10.000e+098.26SMESG000030612.1[more]
SMESG000034214.10.000e+096.26SMESG000034214.1[more]
SMESG000034214.10.000e+097.78SMESG000034214.1[more]
SMESG000030179.10.000e+085.40SMESG000030179.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013350 ID=SMED30013350|Name=HPHLAWLY domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2630bp
TTTTAATAAAACAGAATAAAAATAGTGATTTAGCTTTAAATAAATTTTGA
TATGAATTTACTTATTTAATGGTTTATTAAGGATTTTTATTATTAAATTG
TATGCAATAAATAAATAAATGAGCTCTAATATATTTTCAATCGAAATTTT
CATTGATCGAATTCGATTACTTGAAGGTGAAAAATGTTTATTTCCATCAA
CAATATTGAAACTACTGGATTACGAGCCAGCGATTATCAGTACAGTCGAT
AATAATGTGCAAACAGAACTTCGTGATTATCTTGATTTGCTTGAGAAAAA
CAATGAACCCACCAAACCAGCCCAATTAAACGAATTGAAAGATGTCGATG
GAAATTATGTCGTGAGAAAGGGTAAAAGCATTCTTTTCAAAGCCAACACA
TTGACTTTGATTTCTGAATTCAATTCACTACCTCTATATATACTGATATG
TGATGACTATTATTATCCCAATCATCTTGTTGGGGTTGTGACAATAAAAT
TATCCGATACGGTAATCAGTTTAGCAAGGAAAATATCCAAAACCAATCAC
ACCGTCAGTGAAGATGTAATGGGAAAATTTCCCATTGTAAACCTGATCGG
AGATGCAGTGGGATTTATCACAATGAAATTACGATTGATTTACATTGGAG
CTAATCTAGCCCCTCATTTACAAGAAGAACATCATATCGAGGTTAGAATC
AAGTCAAAAGTAAAATCTCCGGTTGATAGAGCAATAGACTGTGGAGATCC
TATATCAGAGGAAACTAATCCCCCGGAAAAGATTCTGATGAGAAATATCG
GTTGCCAGGTGAATAAACACAAATCCATTCGAATCCAAGTTCCAATTGTG
TCGGAAAATGTTGAAAATAACCTTGCAAAAGTCGGTTTGACAATAGATCC
CAATGATCCCATCCTAGTTGATCATCCTCCTATGATTTACAATAGTTATT
ATGGCAACGGAGAGGATACCGATTCTGAGCATGAAGAAAGTCCCAACAAA
CCAATTGAAAATACCCTATCAAAAGTCGTCAAATCTTTAACCGAAACCCC
CGAAACCGTTTCCATTCTCAATGAACTTCTCGTGGAATTGAAGTGCTGGA
AAAGCCAAAACGATTTGAATCGAAATTCCAACGAAAAATTCAATAAACAA
CCAATTCGTCAGCCTGTGAAAAATTCGCCCCCAAAATTCAAATCGATAAA
ACGCTCGAAAAGTGTCGAATTCGCGCCTACTCGATCGACTGAAGAGGAAC
GAAAAGATTTTCTAAAGCGCATTTCGAAACCAAAAATCCGACTGAATTCT
CCATTGGGAATCGTTCCGAAAGGCAAAGGCTGGCTGAGAACCGAACCAGA
ATATAGCGGCCCGATTCGCAGTCAATTGCAATACAAATTGACGAAGACCC
AATCAAAACGAATCGAACTGGCCAATCCGAAGTTATTCAGAAAAATCCTC
CGACAGAAATCGATTAATCCCTCAACAAAGCCCGACTTCTATCGACCGAT
TTACAGTTCCGATTTATCGTCTGCTATTGAACCGCCGATTCCTCGCAGTA
AGCGCAATTCACTTGTTCCGCCCTTGTTTGGAACTGGGACGAGTGGTTCA
GTACCAAGCTTCACAGGATCGATCGATTCTCAGTCACCGCCACCAGCGGG
CAACAGCAGACCTCGGCACAACAAATCAATCAATAAACGGCCACCGCATT
CGCCCGGCAAAGAAAACGTCCAATCACAGTATGCCAATCGAAACAACAGC
AACTATAGCAGATCGATTTCCTATGACACAAATGAAACGGTAAATGAAGC
AGATGAATATCTTAACCTCAATCCGGTCCAGTCAAATCGATCGCCCCACA
TGTCCCGTCGGTCCAATCACACCGTTCAGCCACCACCGTCCGACAGCGTG
GACAATTCCGAAACCGCCAGTACCGATGATGATGCTTGGAGAAGTGTCGA
TAATAAAGGCAATGAATATTCCGATGGATTTAACCAATCTTTCTCTGCAG
AAAATGACGACGGTAAAAATCAATCGAGGCGATATTCAATGGCATCACAA
ATTTCTCAGACATCAGAGTGGCGAACCGATTATTCAATAAATTCCTCGAA
TAGTCAGCATAATAACTATAGGAATGAATCTAACAATTCCTCTCCCGATT
TCACAGCTCGAAAGCCTCATTCGAAATCACAAGTGAGGCCAAAGCGAACG
TCTTTGTCTAGTAGCAACATGAATGGTGGGAGATTTCTTGACGGGAACGG
CAGCAATAGTTTCAGAACATTTGAAAGCGGAAGGCCCTCGTTTAATGAGT
CACTGGAAGTGTCTAATATGGATTCGGATGCCAATCGGAACAGATATGAT
CAGGATGATGATGACAACATTCGGCTGTCAATTGATCAGATGGATGACAA
TAATAATTCCATGTTACGGCCGAATTCTGTAGGGGCAGATGTAACCAGCT
TTACCAAGGTCACAAAATATGAACGGTCCCTCAATCCGGGTCCGATGAAT
AGTAATTACATGGGAACTCACCTCGTCACCAGTACAGTGGCCTCGTTGCG
AACTGAGGACTCCCAGACATTGACTTCTGAAGCTTATTACTGATTGGTTG
ATATGATCACAAATCAGATTTGTTGATGTT
back to top

protein sequence of SMED30013350-orf-1

>SMED30013350-orf-1 ID=SMED30013350-orf-1|Name=SMED30013350-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=825bp
MSSNIFSIEIFIDRIRLLEGEKCLFPSTILKLLDYEPAIISTVDNNVQTE
LRDYLDLLEKNNEPTKPAQLNELKDVDGNYVVRKGKSILFKANTLTLISE
FNSLPLYILICDDYYYPNHLVGVVTIKLSDTVISLARKISKTNHTVSEDV
MGKFPIVNLIGDAVGFITMKLRLIYIGANLAPHLQEEHHIEVRIKSKVKS
PVDRAIDCGDPISEETNPPEKILMRNIGCQVNKHKSIRIQVPIVSENVEN
NLAKVGLTIDPNDPILVDHPPMIYNSYYGNGEDTDSEHEESPNKPIENTL
SKVVKSLTETPETVSILNELLVELKCWKSQNDLNRNSNEKFNKQPIRQPV
KNSPPKFKSIKRSKSVEFAPTRSTEEERKDFLKRISKPKIRLNSPLGIVP
KGKGWLRTEPEYSGPIRSQLQYKLTKTQSKRIELANPKLFRKILRQKSIN
PSTKPDFYRPIYSSDLSSAIEPPIPRSKRNSLVPPLFGTGTSGSVPSFTG
SIDSQSPPPAGNSRPRHNKSINKRPPHSPGKENVQSQYANRNNSNYSRSI
SYDTNETVNEADEYLNLNPVQSNRSPHMSRRSNHTVQPPPSDSVDNSETA
STDDDAWRSVDNKGNEYSDGFNQSFSAENDDGKNQSRRYSMASQISQTSE
WRTDYSINSSNSQHNNYRNESNNSSPDFTARKPHSKSQVRPKRTSLSSSN
MNGGRFLDGNGSNSFRTFESGRPSFNESLEVSNMDSDANRNRYDQDDDDN
IRLSIDQMDDNNNSMLRPNSVGADVTSFTKVTKYERSLNPGPMNSNYMGT
HLVTSTVASLRTEDSQTLTSEAYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR039302MAP10
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF14924DUF4497coord: 80..180
e-value: 9.6E-14
score: 51.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 572..711
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 615..682
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 689..711
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 529..548
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 500..516
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 500..548
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 572..597
IPR039302Microtubule associated protein 10PANTHERPTHR21831UNCHARACTERIZEDcoord: 3..193