Glutathione peroxidase

Overview
NameGlutathione peroxidase
Smed IDSMED30013334
Length (bp)948
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutathione peroxidase (SMED30013334) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutathione peroxidase (SMED30013334) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutathione peroxidase (SMED30013334) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutathione peroxidase (SMED30013334) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013334

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013334SMESG000076482.1 SMESG000076385.1 SMESG000076371.1 SMESG000076223.1 SMESG000040665.1 SMESG000064685.1 Contig5047GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013334SMESG000049117.1 Contig4048GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013334SMESG000077750.1 Contig4048GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013334SMESG000077750.1 Contig5047GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30013334SMESG000077750.1 dd_Smed_v6_662_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013334SMESG000077750.1 dd_Smed_v6_662_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30013334SMESG000077750.1 dd_Smed_v4_662_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutathione peroxidase vs. Ensembl Human
Match: GPX4 (glutathione peroxidase 4 [Source:HGNC Symbol;Acc:HGNC:4556])

HSP 1 Score: 191.815 bits (486), Expect = 2.505e-60
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPI 632
            A+ D W+ A +++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFLI + G  VKRYGP   P+
Sbjct:    3 ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPL 160          
BLAST of Glutathione peroxidase vs. Ensembl Human
Match: GPX4 (glutathione peroxidase 4 [Source:HGNC Symbol;Acc:HGNC:4556])

HSP 1 Score: 191.815 bits (486), Expect = 4.723e-60
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPI 632
            A+ D W+ A +++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFLI + G  VKRYGP   P+
Sbjct:   30 ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPL 187          
BLAST of Glutathione peroxidase vs. Ensembl Human
Match: GPX4 (glutathione peroxidase 4 [Source:HGNC Symbol;Acc:HGNC:4556])

HSP 1 Score: 189.119 bits (479), Expect = 6.352e-59
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPI 632
            A+ D W+ A +++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFLI + G  VKRYGP   P+
Sbjct:   30 ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ-GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPL 186          
BLAST of Glutathione peroxidase vs. Ensembl Human
Match: GPX4 (glutathione peroxidase 4 [Source:HGNC Symbol;Acc:HGNC:4556])

HSP 1 Score: 189.119 bits (479), Expect = 1.899e-58
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPI 632
            A+ D W+ A +++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFLI + G  VKRYGP   P+
Sbjct:   67 ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ-GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPL 223          
BLAST of Glutathione peroxidase vs. Ensembl Human
Match: GPX4 (glutathione peroxidase 4 [Source:HGNC Symbol;Acc:HGNC:4556])

HSP 1 Score: 181.415 bits (459), Expect = 1.433e-56
Identity = 91/148 (61.49%), Postives = 111/148 (75.00%), Query Frame = 3
Query:  195 IYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPI 632
            ++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFLI + G  VKRYGP   P+
Sbjct:    1 MHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPL 147          
BLAST of Glutathione peroxidase vs. Ensembl Celegans
Match: gpx-1 (Glutathione peroxidase 1 [Source:UniProtKB/Swiss-Prot;Acc:O02621])

HSP 1 Score: 172.555 bits (436), Expect = 1.981e-53
Identity = 84/159 (52.83%), Postives = 111/159 (69.81%), Query Frame = 3
Query:  189 STIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAEL 665
            S++Y+F+ K  +G+D+SLS YKG V+++VNVAS+ G T KNY QL+EL  +    GL +L FPCNQF GQEP  + +I+ FV  KF  E  +F KIDVNGD   PLFK+LK +  G+  D+IKWNFTKFL+ R G  +KR+GPTT P  D + DI+  L
Sbjct:    2 SSVYDFNVKNANGDDVSLSDYKGKVLIIVNVASQCGLTNKNYTQLKELLDVYKKDGLEVLAFPCNQFAGQEPSCEIDIQAFVADKFKFEPTLFQKIDVNGDKQSPLFKFLKNEKGGFMFDAIKWNFTKFLVGRDGKIIKRFGPTTDP-KDMEKDIKEAL 159          
BLAST of Glutathione peroxidase vs. Ensembl Celegans
Match: gpx-1 (Glutathione peroxidase 1 [Source:UniProtKB/Swiss-Prot;Acc:O02621])

HSP 1 Score: 172.555 bits (436), Expect = 1.981e-53
Identity = 84/159 (52.83%), Postives = 111/159 (69.81%), Query Frame = 3
Query:  189 STIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAEL 665
            S++Y+F+ K  +G+D+SLS YKG V+++VNVAS+ G T KNY QL+EL  +    GL +L FPCNQF GQEP  + +I+ FV  KF  E  +F KIDVNGD   PLFK+LK +  G+  D+IKWNFTKFL+ R G  +KR+GPTT P  D + DI+  L
Sbjct:    2 SSVYDFNVKNANGDDVSLSDYKGKVLIIVNVASQCGLTNKNYTQLKELLDVYKKDGLEVLAFPCNQFAGQEPSCEIDIQAFVADKFKFEPTLFQKIDVNGDKQSPLFKFLKNEKGGFMFDAIKWNFTKFLVGRDGKIIKRFGPTTDP-KDMEKDIKEAL 159          
BLAST of Glutathione peroxidase vs. Ensembl Celegans
Match: gpx-2 (Glutathione peroxidase 2 [Source:UniProtKB/Swiss-Prot;Acc:O62327])

HSP 1 Score: 166.007 bits (419), Expect = 1.518e-50
Identity = 80/159 (50.31%), Postives = 105/159 (66.04%), Query Frame = 3
Query:  189 STIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAEL 665
            ++++  + K   GED  LS Y+G V+++VNVAS+ G T  NYNQ +EL  +    GL +L FPCNQFGGQEP  + +I  FV  KF  E  +F KIDVNGD   PL+K+LK +  G+  D+IKWNFTKFL+ R G  +KR+ PTT P  D + DIEA L
Sbjct:   18 ASVHGITVKNAQGEDTPLSNYQGKVLIIVNVASQCGLTNSNYNQFKELLDVYKKDGLEVLAFPCNQFGGQEPSCEIDIAAFVADKFKFEPTLFQKIDVNGDNTAPLYKFLKQEKGGFLVDAIKWNFTKFLVGRDGHVIKRFSPTTEP-KDMKKDIEAAL 175          
BLAST of Glutathione peroxidase vs. Ensembl Celegans
Match: gpx-2 (Glutathione peroxidase 2 [Source:UniProtKB/Swiss-Prot;Acc:O62327])

HSP 1 Score: 166.007 bits (419), Expect = 1.518e-50
Identity = 80/159 (50.31%), Postives = 105/159 (66.04%), Query Frame = 3
Query:  189 STIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAEL 665
            ++++  + K   GED  LS Y+G V+++VNVAS+ G T  NYNQ +EL  +    GL +L FPCNQFGGQEP  + +I  FV  KF  E  +F KIDVNGD   PL+K+LK +  G+  D+IKWNFTKFL+ R G  +KR+ PTT P  D + DIEA L
Sbjct:   18 ASVHGITVKNAQGEDTPLSNYQGKVLIIVNVASQCGLTNSNYNQFKELLDVYKKDGLEVLAFPCNQFGGQEPSCEIDIAAFVADKFKFEPTLFQKIDVNGDNTAPLYKFLKQEKGGFLVDAIKWNFTKFLVGRDGHVIKRFSPTTEP-KDMKKDIEAAL 175          
BLAST of Glutathione peroxidase vs. Ensembl Celegans
Match: gpx-2 (Glutathione peroxidase 2 [Source:UniProtKB/Swiss-Prot;Acc:O62327])

HSP 1 Score: 165.236 bits (417), Expect = 1.745e-50
Identity = 80/159 (50.31%), Postives = 105/159 (66.04%), Query Frame = 3
Query:  189 STIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAEL 665
            ++++  + K   GED  LS Y+G V+++VNVAS+ G T  NYNQ +EL  +    GL +L FPCNQFGGQEP  + +I  FV  KF  E  +F KIDVNGD   PL+K+LK +  G+  D+IKWNFTKFL+ R G  +KR+ PTT P  D + DIEA L
Sbjct:    2 ASVHGITVKNAQGEDTPLSNYQGKVLIIVNVASQCGLTNSNYNQFKELLDVYKKDGLEVLAFPCNQFGGQEPSCEIDIAAFVADKFKFEPTLFQKIDVNGDNTAPLYKFLKQEKGGFLVDAIKWNFTKFLVGRDGHVIKRFSPTTEP-KDMKKDIEAAL 159          
BLAST of Glutathione peroxidase vs. Ensembl Fly
Match: PHGPx (gene:FBgn0035438 transcript:FBtr0073067)

HSP 1 Score: 174.481 bits (441), Expect = 6.336e-54
Identity = 91/172 (52.91%), Postives = 117/172 (68.02%), Query Frame = 3
Query:  156 FKANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEE--IKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAEL 665
              ANGD +KNA++IYEF+ K   G D+SL KYKG VVLVVN+ASK G T  NY +L +L +    +GL IL FPCNQFG Q P +D E  +     SK ++  ++F+K+DVNGD A PL+KYLK K  G  G  IKWNFTKFL++++G+P+ RY PTT P+ D   DIE  L
Sbjct:    1 MSANGD-YKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIG-EVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPM-DIAKDIEKLL 169          
BLAST of Glutathione peroxidase vs. Ensembl Fly
Match: PHGPx (gene:FBgn0035438 transcript:FBtr0073068)

HSP 1 Score: 176.022 bits (445), Expect = 1.099e-53
Identity = 91/172 (52.91%), Postives = 117/172 (68.02%), Query Frame = 3
Query:  156 FKANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEE--IKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAEL 665
              ANGD +KNA++IYEF+ K   G D+SL KYKG VVLVVN+ASK G T  NY +L +L +    +GL IL FPCNQFG Q P +D E  +     SK ++  ++F+K+DVNGD A PL+KYLK K  G  G  IKWNFTKFL++++G+P+ RY PTT P+ D   DIE  L
Sbjct:   70 MSANGD-YKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIG-EVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPM-DIAKDIEKLL 238          
BLAST of Glutathione peroxidase vs. Ensembl Fly
Match: PHGPx (gene:FBgn0035438 transcript:FBtr0073066)

HSP 1 Score: 174.481 bits (441), Expect = 1.688e-53
Identity = 91/170 (53.53%), Postives = 117/170 (68.82%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEE--IKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAEL 665
            ANGD +KNA++IYEF+ K   G D+SL KYKG VVLVVN+ASK G T  NY +L +L +    +GL IL FPCNQFG Q P +D E  +     SK ++  ++F+K+DVNGD A PL+KYLK K  G  G  IKWNFTKFL++++G+P+ RY PTT P+ D   DIE  L
Sbjct:   32 ANGD-YKNAASIYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIG-EVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINRYAPTTDPM-DIAKDIEKLL 198          
BLAST of Glutathione peroxidase vs. Ensembl Fly
Match: CG15116 (gene:FBgn0034415 transcript:FBtr0086596)

HSP 1 Score: 114.39 bits (285), Expect = 1.831e-30
Identity = 66/161 (40.99%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  192 TIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSD-EEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            TI+  + +   G  + L  + G V+L+VN+ASK G T   YN L+ L +    +GLRIL FPCNQFGGQ P SD +E+ + ++ +      +F+KIDV G  A PL+K L           I+WNF KFL+ RKG   KRYG    P++    DIE  L +
Sbjct:   39 TIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFPCNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTRH-----QHDIEWNFVKFLVDRKGNIHKRYGAELEPVA-LTDDIELLLGR 193          
BLAST of Glutathione peroxidase vs. Ensembl Zebrafish
Match: gpx4b (glutathione peroxidase 4b [Source:ZFIN;Acc:ZDB-GENE-030410-3])

HSP 1 Score: 198.749 bits (504), Expect = 2.651e-63
Identity = 98/158 (62.03%), Postives = 117/158 (74.05%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGY--FGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A  + W++A +IYEFSA  IDG D+SL KY+G V ++ NVASK G T  NY QL  +H   A KGLRILGFPCNQFG QEPGS+ EIKEF K  +N EFD+FSKIDVNGD AHPL+K++K + KG    G++IKWNFTKFLI R+G  VKRYGP   P
Sbjct:    3 AQANDWQSAKSIYEFSAIDIDGNDVSLEKYRGYVCIITNVASKUGKTPVNYTQLAAMHVTYAEKGLRILGFPCNQFGKQEPGSEAEIKEFAKG-YNAEFDLFSKIDVNGDAAHPLWKWMKEQPKGRGTLGNNIKWNFTKFLIDREGQVVKRYGPMDDP 159          
BLAST of Glutathione peroxidase vs. Ensembl Zebrafish
Match: gpx4a (glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GENE-030410-2])

HSP 1 Score: 191.045 bits (484), Expect = 3.662e-60
Identity = 93/158 (58.86%), Postives = 117/158 (74.05%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKL--KGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A  + W+ A +IYEF+A  IDG ++SL KY+G VV++ NVASK G T  NY+Q  E+H   + +GLRIL FP NQFG QEPG++ +IKEF KS +N EFDMFSKIDVNGD AHPL+K+LK +   KG+ G+ IKWNFTKFLI+R+G  VKRY P   P
Sbjct:    9 AQLEDWQTAKSIYEFTATDIDGNEVSLEKYRGKVVIITNVASKUGKTPVNYSQFAEMHAKYSERGLRILAFPSNQFGRQEPGTNSQIKEFAKS-YNAEFDMFSKIDVNGDGAHPLWKWLKDQPNGKGFLGNGIKWNFTKFLINREGQVVKRYSPLQDP 165          
BLAST of Glutathione peroxidase vs. Ensembl Zebrafish
Match: gpx4a (glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GENE-030410-2])

HSP 1 Score: 191.43 bits (485), Expect = 3.681e-60
Identity = 93/158 (58.86%), Postives = 117/158 (74.05%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKL--KGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A  + W+ A +IYEF+A  IDG ++SL KY+G VV++ NVASK G T  NY+Q  E+H   + +GLRIL FP NQFG QEPG++ +IKEF KS +N EFDMFSKIDVNGD AHPL+K+LK +   KG+ G+ IKWNFTKFLI+R+G  VKRY P   P
Sbjct:   19 AQLEDWQTAKSIYEFTATDIDGNEVSLEKYRGKVVIITNVASKUGKTPVNYSQFAEMHAKYSERGLRILAFPSNQFGRQEPGTNSQIKEFAKS-YNAEFDMFSKIDVNGDGAHPLWKWLKDQPNGKGFLGNGIKWNFTKFLINREGQVVKRYSPLQDP 175          
BLAST of Glutathione peroxidase vs. Ensembl Zebrafish
Match: gpx4b (glutathione peroxidase 4b [Source:ZFIN;Acc:ZDB-GENE-030410-3])

HSP 1 Score: 136.732 bits (343), Expect = 5.793e-40
Identity = 68/102 (66.67%), Postives = 79/102 (77.45%), Query Frame = 3
Query:  330 LHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLK--GYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            +H   A KGLRILGFPCNQFG QEPGS+ EIKEF K  +N EFD+FSKIDVNGD AHPL+K++K + K  G  G++IKWNFTKFLI R+G  VKRYGP   P
Sbjct:    1 MHVTYAEKGLRILGFPCNQFGKQEPGSEAEIKEFAKG-YNAEFDLFSKIDVNGDAAHPLWKWMKEQPKGRGTLGNNIKWNFTKFLIDREGQVVKRYGPMDDP 101          
BLAST of Glutathione peroxidase vs. Ensembl Zebrafish
Match: gpx4a (glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GENE-030410-2])

HSP 1 Score: 130.183 bits (326), Expect = 2.215e-37
Identity = 64/102 (62.75%), Postives = 78/102 (76.47%), Query Frame = 3
Query:  330 LHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKL--KGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            +H   + +GLRIL FP NQFG QEPG++ +IKEF KS +N EFDMFSKIDVNGD AHPL+K+LK +   KG+ G+ IKWNFTKFLI+R+G  VKRY P   P
Sbjct:    1 MHAKYSERGLRILAFPSNQFGRQEPGTNSQIKEFAKS-YNAEFDMFSKIDVNGDGAHPLWKWLKDQPNGKGFLGNGIKWNFTKFLINREGQVVKRYSPLQDP 101          
BLAST of Glutathione peroxidase vs. Ensembl Xenopus
Match: acvr1b (activin A receptor type 1B [Source:Xenbase;Acc:XB-GENE-483904])

HSP 1 Score: 118.242 bits (295), Expect = 1.142e-31
Identity = 66/160 (41.25%), Postives = 89/160 (55.62%), Query Frame = 3
Query:  198 YEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK*I 677
            Y F    I G+ +SL KY+G V LVVNVAS+ G T  +Y  LQ+L + L      +L FPCNQFG QEP SD EI+ FV+  ++  F MFSK  V G   +  FKYL        G    WNF K+L+   G  V  +GP+ S +++ +  I + + K I
Sbjct:   29 YTFKVVNIRGKLVSLEKYRGSVTLVVNVASECGFTDSHYKALQQLQRDLGSYHFNVLAFPCNQFGQQEPNSDREIENFVRKNYSASFPMFSKTAVTGTGVNSAFKYLIESS----GKEPDWNFWKYLVGPDGKVVDAWGPSVS-VAEVRPHITSLVRKII 183          
BLAST of Glutathione peroxidase vs. Ensembl Xenopus
Match: gpx8 (glutathione peroxidase 8 (putative) [Source:NCBI gene;Acc:100145599])

HSP 1 Score: 112.849 bits (281), Expect = 2.377e-29
Identity = 58/140 (41.43%), Postives = 77/140 (55.00%), Query Frame = 3
Query:  198 YEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGP 617
            Y +      G  ++LSKY+G   LVVNVAS    +  NY  LQELH+        +L FPCNQFG  EPGS+ EI+   K  + V F MFSKI + G  A P +K+L    K       +WNF K+L++ +G  VK + P
Sbjct:   48 YSYEVTDAKGRTVALSKYRGKASLVVNVASSCPHSETNYRSLQELHREFGPYHFTVLAFPCNQFGESEPGSNREIEALAKRNYGVTFPMFSKIKILGPEAEPAYKFLVDSTK----TKPRWNFWKYLVNPEGQVVKYWRP 183          
BLAST of Glutathione peroxidase vs. Ensembl Xenopus
Match: gpx1 (glutathione peroxidase 1 [Source:NCBI gene;Acc:548457])

HSP 1 Score: 88.5817 bits (218), Expect = 6.142e-21
Identity = 53/141 (37.59%), Postives = 71/141 (50.35%), Query Frame = 3
Query:  321 LQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKS-----KFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIK-------------------WNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            +  L  +   +GL++L FPCNQFG QE   ++EI   +K       F   F +F K+DVNG+  HPLF +LK +L     DSI                    WNF KFLI+R G+P KRYG       + Q DIE  L++
Sbjct:    1 MSRLQSMYGPRGLQVLAFPCNQFGHQENSGNQEILNILKHVRPGGGFEPNFPLFEKVDVNGEKEHPLFTFLKGQLPYPSDDSISLMQDPKSIIWSPVRRNDIAWNFEKFLIARNGVPYKRYGRRFETF-NIQQDIEKLLDE 140          
BLAST of Glutathione peroxidase vs. Ensembl Xenopus
Match: plekho2 (pleckstrin homology domain containing O2 [Source:Xenbase;Acc:XB-GENE-6456595])

HSP 1 Score: 74.3294 bits (181), Expect = 1.216e-15
Identity = 49/135 (36.30%), Postives = 68/135 (50.37%), Query Frame = 3
Query:  312 YNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEI---KEFVK--SKFNVEFDMFSKIDVNGDTAHPLFKYLKMK---LKGYFGDS-------------IKWNFTKFLISRKGIPVKRYGPTTSPISDCQADI 653
            Y +L  L + L      ILGFP NQFG QEPG ++EI    E+V+   KF   F +F K D+NG      + +LK     +   FG +             +KWNF KFL+   G PVKR+ P T P++  + +I
Sbjct:    3 YQELNALQEELKNNNFVILGFPSNQFGMQEPGRNDEILLGLEYVRPGGKFVPNFQLFEKGDINGRKEQKFYTFLKNSCPPVGDNFGSATNRLMWEPIKVNDVKWNFEKFLVGPDGRPVKRWLPRT-PVAQVRREI 136          
BLAST of Glutathione peroxidase vs. Ensembl Mouse
Match: Gpx4 (glutathione peroxidase 4 [Source:MGI Symbol;Acc:MGI:104767])

HSP 1 Score: 188.734 bits (478), Expect = 5.836e-59
Identity = 92/158 (58.23%), Postives = 116/158 (73.42%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLK--GYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A+ D W+ A +++EFSAK IDG  + L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS++EIKEF  + +NV+FDM+SKI VNGD AHPL+K++K++ K  G  G++IKWNFTKFLI + G  VKRYGP   P
Sbjct:   30 ASRDDWRCARSMHEFSAKDIDGHMVCLDKYRGFVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA-AGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEP 186          
BLAST of Glutathione peroxidase vs. Ensembl Mouse
Match: Gpx4 (glutathione peroxidase 4 [Source:MGI Symbol;Acc:MGI:104767])

HSP 1 Score: 188.348 bits (477), Expect = 5.359e-58
Identity = 92/158 (58.23%), Postives = 116/158 (73.42%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLK--GYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A+ D W+ A +++EFSAK IDG  + L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS++EIKEF  + +NV+FDM+SKI VNGD AHPL+K++K++ K  G  G++IKWNFTKFLI + G  VKRYGP   P
Sbjct:   86 ASRDDWRCARSMHEFSAKDIDGHMVCLDKYRGFVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA-AGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEP 242          
BLAST of Glutathione peroxidase vs. Ensembl Mouse
Match: Gpx4 (glutathione peroxidase 4 [Source:MGI Symbol;Acc:MGI:104767])

HSP 1 Score: 178.333 bits (451), Expect = 2.197e-55
Identity = 88/147 (59.86%), Postives = 109/147 (74.15%), Query Frame = 3
Query:  195 IYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLK--GYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            ++EFSAK IDG  + L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS++EIKEF  + +NV+FDM+SKI VNGD AHPL+K++K++ K  G  G++IKWNFTKFLI + G  VKRYGP   P
Sbjct:    1 MHEFSAKDIDGHMVCLDKYRGFVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA-AGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEP 146          
BLAST of Glutathione peroxidase vs. Ensembl Mouse
Match: Gpx7 (glutathione peroxidase 7 [Source:MGI Symbol;Acc:MGI:1914555])

HSP 1 Score: 131.724 bits (330), Expect = 4.820e-37
Identity = 70/160 (43.75%), Postives = 94/160 (58.75%), Query Frame = 3
Query:  198 YEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK*I 677
            Y+F A  I G+ +SL KY+G V LVVNVAS+ G T +NY  LQ+L + L      +L FPCNQFG QEP ++ EI+ F +  ++V F MFSKI V G  AHP FKYL        G    WNF K+L+   G  V  + PT  P+++ +  I  ++ K I
Sbjct:   25 YDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTS----GKEPTWNFWKYLVDPDGKVVGAWDPTV-PVAEIKPRITEQVMKLI 179          
BLAST of Glutathione peroxidase vs. Ensembl Mouse
Match: Gpx1 (glutathione peroxidase 1 [Source:MGI Symbol;Acc:MGI:104887])

HSP 1 Score: 127.487 bits (319), Expect = 3.122e-35
Identity = 74/186 (39.78%), Postives = 101/186 (54.30%), Query Frame = 3
Query:  189 STIYEFSAKTIDG-EDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVK-----SKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDS-------------------IKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            ST+Y FSA+ + G E +SL   +G V+L+ NVAS  G T ++Y ++ +L K L  +GL +LGFPCNQFG QE G +EEI   +K       F   F +F K +VNG+ AHPLF +L+  L     D                    I WNF KFL+   G+PV+RY      I D + DIE  L++
Sbjct:   12 STVYAFSARPLTGGEPVSLGSLRGKVLLIENVASLUGTTIRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPTPSDDPTALMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRRFRTI-DIEPDIETLLSQ 196          
BLAST of Glutathione peroxidase vs. UniProt/SwissProt
Match: sp|Q00277|GPX1_SCHMA (Glutathione peroxidase OS=Schistosoma mansoni OX=6183 GN=GPX1 PE=1 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 6.076e-64
Identity = 99/166 (59.64%), Postives = 123/166 (74.10%), Query Frame = 3
Query:  174 SWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            S K+ ++IYEF+ K I+G D+SL KY+G V L+VNVA K GAT KNY QLQE+H  L GKGLRIL FPCNQFGGQEP ++ EIK+FV  K+ V+FDMFSKI VNG  A  L+K+LK +  G   ++IKWNF+KFL+ R+G PVKRY PTT+P  D + DI   L K
Sbjct:    4 SHKSWNSIYEFTVKDINGVDVSLEKYRGHVCLIVNVACKUGATDKNYRQLQEMHTRLVGKGLRILAFPCNQFGGQEPWAEAEIKKFVTEKYGVQFDMFSKIKVNGSDADDLYKFLKSRQHGTLTNNIKWNFSKFLVDRQGQPVKRYSPTTAPY-DIEGDIMELLEK 168          
BLAST of Glutathione peroxidase vs. UniProt/SwissProt
Match: sp|Q32QL6|GPX4_CALJA (Phospholipid hydroperoxide glutathione peroxidase OS=Callithrix jacchus OX=9483 GN=GPX4 PE=2 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 1.693e-59
Identity = 94/158 (59.49%), Postives = 118/158 (74.68%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A+ D W++A +++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFL+ + G  VKRYGP   P
Sbjct:   30 ASQDDWRSARSMHEFSAKDIDGHTVNLDKYRGFVCIVTNVASQUGKTQVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGTLGNAIKWNFTKFLVDKNGCVVKRYGPMEEP 186          
BLAST of Glutathione peroxidase vs. UniProt/SwissProt
Match: sp|Q4AEH2|GPX4_PONPY (Phospholipid hydroperoxide glutathione peroxidase OS=Pongo pygmaeus OX=9600 GN=GPX4 PE=2 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 2.268e-59
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPI 632
            A+ D W+ A +++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFLI + G  VKRYGP   P+
Sbjct:   30 ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPL 187          
BLAST of Glutathione peroxidase vs. UniProt/SwissProt
Match: sp|P36969|GPX4_HUMAN (Phospholipid hydroperoxide glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX4 PE=1 SV=3)

HSP 1 Score: 191.815 bits (486), Expect = 2.268e-59
Identity = 95/159 (59.75%), Postives = 118/159 (74.21%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPI 632
            A+ D W+ A +++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFLI + G  VKRYGP   P+
Sbjct:   30 ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPL 187          
BLAST of Glutathione peroxidase vs. UniProt/SwissProt
Match: sp|Q4AEG9|GPX4_SAPAP (Phospholipid hydroperoxide glutathione peroxidase OS=Sapajus apella OX=9515 GN=GPX4 PE=2 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 5.335e-59
Identity = 95/158 (60.13%), Postives = 117/158 (74.05%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A+ D W+ A +++EFSAK IDG  ++L KY+G V +V NVAS+ G T  NY QL +LH   A  GLRIL FPCNQFG QEPGS+EEIKEF  + +NV+FDMFSKI VNGD AHPL+K++K+  K KG  G++IKWNFTKFLI + G  VKRYGP   P
Sbjct:   30 ASRDDWRCAGSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA-AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEP 186          
BLAST of Glutathione peroxidase vs. TrEMBL
Match: I6SBG2 (Glutathione peroxidase OS=Mytilus galloprovincialis OX=29158 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.766e-68
Identity = 108/159 (67.92%), Postives = 123/159 (77.36%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELH-KLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPIS 635
            A  D WK A++IYEFSAK IDG ++SL KYKG VVL++N ASK G T KNY QLQ LH K    KGLRILGFPCNQFG QEPG++ EIK FV  KFNV+FDMFSKI+VNG+  HPLFKYLK K  G  GD IKWNFTKFL++++GIPVKRY P T P S
Sbjct:    3 AEKDWWKKAASIYEFSAKDIDGNEVSLEKYKGHVVLILNCASKUGFTEKNYTQLQALHAKYAESKGLRILGFPCNQFGSQEPGTEAEIKTFVTDKFNVQFDMFSKINVNGNDGHPLFKYLKHKQGGTLGDFIKWNFTKFLVNKEGIPVKRYAPNTEPNS 161          
BLAST of Glutathione peroxidase vs. TrEMBL
Match: Q2XW13 (Glutathione peroxidase OS=Rhipicephalus microplus OX=6941 GN=PHGPX PE=3 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 5.069e-68
Identity = 109/169 (64.50%), Postives = 133/169 (78.70%), Query Frame = 3
Query:  168 GDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLA-GKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            GDSWK+AS+IY+FSA  IDG ++SL KYKG V L+VNVASK G T KNY QL ELHK  A  KGLRIL FPCNQFGGQEPG++ +IK+FV+ K+NV+FDMFSK++VNGD AHPL+KYLK K  G+  D+IKWNFTKF++ ++G PV RY PTT P+     DIE +L K
Sbjct:    5 GDSWKDASSIYDFSAVDIDGNEVSLDKYKGHVALIVNVASKUGKTNKNYTQLVELHKKYAESKGLRILAFPCNQFGGQEPGTEADIKKFVE-KYNVKFDMFSKVNVNGDKAHPLWKYLKQKQSGFLTDAIKWNFTKFVVDKEGQPVHRYAPTTDPL-----DIEPDLLK 167          
BLAST of Glutathione peroxidase vs. TrEMBL
Match: Q2XW14 (Glutathione peroxidase OS=Rhipicephalus microplus OX=6941 GN=PHGPX PE=3 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 3.185e-67
Identity = 108/168 (64.29%), Postives = 132/168 (78.57%), Query Frame = 3
Query:  171 DSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLA-GKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            DSWK+AS+IY+FSA  IDG ++SL KYKG V L+VNVASK G T KNY QL ELHK  A  KGLRIL FPCNQFGGQEPG++ +IK+FV+ K+NV+FDMFSK++VNGD AHPL+KYLK K  G+  D+IKWNFTKF++ ++G PV RY PTT P+     DIE +L K
Sbjct:    6 DSWKDASSIYDFSAVDIDGNEVSLDKYKGHVALIVNVASKUGKTNKNYTQLVELHKKYAESKGLRILAFPCNQFGGQEPGTETDIKKFVE-KYNVKFDMFSKVNVNGDKAHPLWKYLKQKQSGFLTDAIKWNFTKFVVDKEGQPVHRYAPTTDPL-----DIEPDLLK 167          
BLAST of Glutathione peroxidase vs. TrEMBL
Match: Q2XW19 (Glutathione peroxidase OS=Rhipicephalus microplus OX=6941 GN=PHGPX PE=2 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 9.657e-67
Identity = 107/168 (63.69%), Postives = 132/168 (78.57%), Query Frame = 3
Query:  171 DSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLA-GKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            DSWK+AS+IY+FSA  IDG ++SL KYKG V L+VNVASK G T KNY QL ELH+  A  KGLRIL FPCNQFGGQEPG++ +IK+FV+ K+NV+FDMFSK++VNGD AHPL+KYLK K  G+  D+IKWNFTKF++ ++G PV RY PTT P+     DIE +L K
Sbjct:    6 DSWKDASSIYDFSAVDIDGNEVSLDKYKGHVALIVNVASKUGKTNKNYTQLVELHEKYAESKGLRILAFPCNQFGGQEPGTETDIKKFVE-KYNVKFDMFSKVNVNGDKAHPLWKYLKQKQSGFLTDAIKWNFTKFVVDKEGQPVHRYAPTTDPL-----DIEPDLLK 167          
BLAST of Glutathione peroxidase vs. TrEMBL
Match: Q2XW18 (Glutathione peroxidase OS=Rhipicephalus microplus OX=6941 GN=PHGPX PE=3 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 1.112e-66
Identity = 107/168 (63.69%), Postives = 132/168 (78.57%), Query Frame = 3
Query:  171 DSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLA-GKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            DSWK+AS+IY+FSA  IDG ++SL KYKG V L+VNVASK G T KNY QL ELH+  A  KGLRIL FPCNQFGGQEPG++ +IK+FV+ K+NV+FDMFSK++VNGD AHPL+KYLK K  G+  D+IKWNFTKF++ ++G PV RY PTT P+     DIE +L K
Sbjct:    6 DSWKDASSIYDFSAVDIDGNEVSLDKYKGHVALIVNVASKUGKTNKNYTQLVELHEKYAESKGLRILAFPCNQFGGQEPGTEADIKKFVE-KYNVKFDMFSKVNVNGDKAHPLWKYLKQKQSGFLTDAIKWNFTKFVVDKEGQPVHRYAPTTDPL-----DIEPDLLK 167          
BLAST of Glutathione peroxidase vs. Ensembl Cavefish
Match: gpx4b (glutathione peroxidase 4b [Source:ZFIN;Acc:ZDB-GENE-030410-3])

HSP 1 Score: 174.866 bits (442), Expect = 1.507e-53
Identity = 89/158 (56.33%), Postives = 110/158 (69.62%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLK--MKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A  + WK+A +IYEFSAK IDG ++SL KY+G V ++ NV                +H   A KGLRILGFPCNQFG QEPG++ EIKEF K  +N EFD+FSKIDVNGD AHPL+K+LK   K +G  G++IKWNFTKFLI+++G  VKRYGP   P
Sbjct:   47 AQANDWKSAKSIYEFSAKDIDGNEVSLEKYRGFVCIITNV-------------FAAMHATYAEKGLRILGFPCNQFGKQEPGTEAEIKEFAKG-YNAEFDLFSKIDVNGDNAHPLWKWLKDQPKGRGTLGNNIKWNFTKFLINKEGQVVKRYGPMDDP 190          
BLAST of Glutathione peroxidase vs. Ensembl Cavefish
Match: gpx4a (glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GENE-030410-2])

HSP 1 Score: 162.155 bits (409), Expect = 6.628e-49
Identity = 84/158 (53.16%), Postives = 107/158 (67.72%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKL--KGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A  + W+ A++IY+FSA  IDG ++SL KY+       N+  K   T  NY+Q  E+H   A KGL IL FP NQFG QEPGS  +IKEF KS +N +FDMF KIDVNG  AHPL+K+LK +   KG+ G+ IKWNFTKFLI+R+G  +KRY P + P
Sbjct:   19 AQLEDWQTATSIYDFSAIDIDGNEVSLDKYRSVNPHKENIYCK---TPINYSQFAEMHAKYAEKGLAILAFPSNQFGNQEPGSSAQIKEFAKS-YNAQFDMFGKIDVNGADAHPLWKWLKSQPNGKGFLGNGIKWNFTKFLINREGQVMKRYSPMSDP 172          
BLAST of Glutathione peroxidase vs. Ensembl Cavefish
Match: gpx4b (glutathione peroxidase 4b [Source:ZFIN;Acc:ZDB-GENE-030410-3])

HSP 1 Score: 135.576 bits (340), Expect = 1.514e-39
Identity = 67/102 (65.69%), Postives = 80/102 (78.43%), Query Frame = 3
Query:  330 LHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLK--MKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            +H   A KGLRILGFPCNQFG QEPG++ EIKEF K  +N EFD+FSKIDVNGD AHPL+K+LK   K +G  G++IKWNFTKFLI+++G  VKRYGP   P
Sbjct:    1 MHATYAEKGLRILGFPCNQFGKQEPGTEAEIKEFAKG-YNAEFDLFSKIDVNGDNAHPLWKWLKDQPKGRGTLGNNIKWNFTKFLINKEGQVVKRYGPMDDP 101          
BLAST of Glutathione peroxidase vs. Ensembl Cavefish
Match: gpx7 (glutathione peroxidase 7 [Source:ZFIN;Acc:ZDB-GENE-050522-419])

HSP 1 Score: 114.005 bits (284), Expect = 3.103e-30
Identity = 63/144 (43.75%), Postives = 78/144 (54.17%), Query Frame = 3
Query:  195 IYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTS 626
             Y F      G  +SL KY+G V L VNVAS+ G T ++Y  LQ+L +        +L FPCNQFG QEPGSD+EI  FV+  +   F +FSKI V G  A+  FKYL        G    WNF K+LI   G  V  +GP  S
Sbjct:   25 FYTFKVVNSRGRLVSLEKYRGSVSLAVNVASECGFTEEHYTDLQQLQRDFGPYHFNVLAFPCNQFGQQEPGSDKEIDSFVRRVYGASFPLFSKIAVVGTGANNAFKYLAEAS----GKEPDWNFWKYLIDVDGKVVGAWGPRVS 164          
BLAST of Glutathione peroxidase vs. Ensembl Cavefish
Match: gpx8 (glutathione peroxidase 8 (putative) [Source:NCBI gene;Acc:103033499])

HSP 1 Score: 113.235 bits (282), Expect = 8.107e-30
Identity = 60/158 (37.97%), Postives = 88/158 (55.70%), Query Frame = 3
Query:  198 YEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSI----KWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEA 659
            Y F  K   G  ISL KY+G + LVVNVAS+   T +NY  LQE+H+ L      +L FPC Q+G  EPG+  +++   K+ + V F +F+KI + G  A P FKY+         DS+    KWNF KFL++ +G  V+ + P   P+ + + +  A
Sbjct:   48 YSFEVKDARGRSISLEKYRGKISLVVNVASQSEQTEENYRFLQEIHRELGTAHFNVLAFPCGQYGQTEPGTGRDVEAHAKANYGVTFPIFNKIKIMGSEAEPAFKYIT--------DSVQRIPKWNFWKFLVNSEGQVVRFWRP-EEPMVEVRQEATA 196          
BLAST of Glutathione peroxidase vs. Ensembl Sea Lamprey
Match: gpx4a (glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GENE-030410-2])

HSP 1 Score: 126.331 bits (316), Expect = 1.409e-36
Identity = 63/104 (60.58%), Postives = 80/104 (76.92%), Query Frame = 3
Query:  330 LHKLLA-GKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKL--KGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPI 632
            LHK  A   GL IL FPCNQFG QEPG+D EIKEFV+ ++NV+FDMFSKIDVN D+AHPL+K++K +   +G   ++IKWNFTKFLI+++G  VKRY P   P+
Sbjct:    1 LHKQYAESHGLCILAFPCNQFGKQEPGTDAEIKEFVQ-QYNVKFDMFSKIDVNSDSAHPLWKWMKSQPNGRGTLYNAIKWNFTKFLINKQGQVVKRYSPVDDPV 103          
BLAST of Glutathione peroxidase vs. Ensembl Sea Lamprey
Match: GPX2 (glutathione peroxidase 2 [Source:HGNC Symbol;Acc:HGNC:4554])

HSP 1 Score: 118.627 bits (296), Expect = 1.070e-32
Identity = 68/164 (41.46%), Postives = 88/164 (53.66%), Query Frame = 3
Query:  192 TIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVK-----SKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIK-------------------WNFTKFLISRKGIPVKRY 611
            + YE SAKT+ GE +S S+Y+G VVL+ NV    G T +++ QL EL      +GL +LGFPCNQFG QE   +EEI   +K     S +   F MF+K +VNG   HP+F++LK KL     D I                    WNF KFL+   G P KRY
Sbjct:    4 SFYELSAKTLGGELVSFSRYRGKVVLIENV----GTTTRDFTQLNELQGRYGAQGLAVLGFPCNQFGHQENSQNEEILNTLKYVRPGSGYEPNFTMFAKCEVNGKDTHPVFEFLKEKLPLPSDDPISFLQDPKHIIWSPVSRSDIAWNFEKFLVGPDGQPFKRY 163          
BLAST of Glutathione peroxidase vs. Ensembl Sea Lamprey
Match: gpx3 (glutathione peroxidase 3 [Source:ZFIN;Acc:ZDB-GENE-070222-3])

HSP 1 Score: 103.99 bits (258), Expect = 1.139e-26
Identity = 62/160 (38.75%), Postives = 83/160 (51.88%), Query Frame = 3
Query:  195 IYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSD-EEI---KEFVKS--KFNVEFDMFSKIDVNGDTAHPLFKYLKMKL----------KGYFGDSIK-----WNFTKFLISRKGIPVKRY 611
            ++ F   ++DG  + L +Y+G   LVVNVA+        Y  L  L +  +  GL ILGFPCNQFG QEPG+D  EI     +V+    F   F +F +IDVNGD+  PLF +LK             K  F + +K     WNF KFL+  +G P  RY
Sbjct:   40 VFSFCPLSMDGRPVPLERYRGRATLVVNVATLFCRLTGQYPLLNALMEEFSQHGLVILGFPCNQFGLQEPGTDAAEILNGLRYVRPGGGFVPNFPLFKRIDVNGDSEAPLFTFLKASCPSPVERFENTKSLFYEPLKSSDLRWNFDKFLVDAQGRPYMRY 199          
BLAST of Glutathione peroxidase vs. Ensembl Sea Lamprey
Match: gpx9 (glutathione peroxidase 9 [Source:ZFIN;Acc:ZDB-GENE-130603-13])

HSP 1 Score: 79.337 bits (194), Expect = 1.881e-18
Identity = 48/122 (39.34%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  321 LQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVK-----SKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIK-------------------WNFTKFLISRKGIPVKRYG 614
            L EL      +GL +LGFPCNQFG QE   +EEI   +K     S +   F MF+K +VNG   HP+F+++K KL     D I                    WNF KFLI   G P KRY 
Sbjct:    1 LNELQGRYGAQGLAVLGFPCNQFGHQENTQNEEILNILKYVRPGSGYEPNFTMFAKCEVNGKDTHPVFEFIKEKLPLPSDDPISFLQDPKSIIWSPVSRSDIAWNFEKFLIGPDGQPFKRYS 122          
BLAST of Glutathione peroxidase vs. Ensembl Sea Lamprey
Match: gpx9 (glutathione peroxidase 9 [Source:ZFIN;Acc:ZDB-GENE-130603-13])

HSP 1 Score: 78.9518 bits (193), Expect = 2.057e-18
Identity = 48/122 (39.34%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  321 LQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVK-----SKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIK-------------------WNFTKFLISRKGIPVKRYG 614
            L EL      +GL +LGFPCNQFG QE   +EEI   +K     S +   F MF+K +VNG   HP+F+++K KL     D I                    WNF KFLI   G P KRY 
Sbjct:    1 LNELQGRYGAQGLAVLGFPCNQFGHQENTQNEEILNILKYVRPGSGYEPNFTMFAKCEVNGKDTHPVFEFIKEKLPLPSDDPISFLQDPKSIIWSPVSRSDIAWNFEKFLIGPDGQPFKRYS 122          
BLAST of Glutathione peroxidase vs. Ensembl Yeast
Match: GPX2 (Phospholipid hydroperoxide glutathione peroxidase; protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress; induced by glucose starvation; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000448])

HSP 1 Score: 135.576 bits (340), Expect = 8.304e-40
Identity = 75/163 (46.01%), Postives = 98/163 (60.12%), Query Frame = 3
Query:  186 ASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFG-DSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
             ++ Y+   K   GE     + KG VVL+VNVASK G T + Y +L+EL+K    KG  ILGFPCNQFG QEPGSDE+I EF +  + V F +  KIDVNG  A  ++ YLK +  G  G   IKWNF KFL+   G  V+R+   T P S    +I++ L+K
Sbjct:    2 TTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQ-YKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKP-SSLDQEIQSLLSK 162          
BLAST of Glutathione peroxidase vs. Ensembl Yeast
Match: HYR1 (Thiol peroxidase; functions as a hydroperoxide receptor to sense intracellular hydroperoxide levels and transduce a redox signal to the Yap1p transcription factor; HYR1 has a paralog, GPX1, that arose from the whole genome duplication [Source:SGD;Acc:S000001476])

HSP 1 Score: 129.028 bits (323), Expect = 3.634e-37
Identity = 69/150 (46.00%), Postives = 91/150 (60.67%), Query Frame = 3
Query:  189 STIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFG-DSIKWNFTKFLISRKGIPVKRYGPTTSPIS 635
            S  Y+ +     G+     + KG VVL+VNVASK G T + Y +L+ L+K    +G  I+GFPCNQFG QEPGSDEEI +F +  + V F +  KIDVNG    P++K+LK +  G  G   IKWNF KFL+ +KG   +RY   T P S
Sbjct:    2 SEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQ-YKELEALYKRYKDEGFTIIGFPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLRGIKWNFEKFLVDKKGKVYERYSSLTKPSS 150          
BLAST of Glutathione peroxidase vs. Ensembl Yeast
Match: GPX1 (Phospholipid hydroperoxide glutathione peroxidase; induced by glucose starvation that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress; GPX1 has a paralog, HYR1, that arose from the whole genome duplication [Source:SGD;Acc:S000001509])

HSP 1 Score: 108.227 bits (269), Expect = 3.205e-29
Identity = 63/159 (39.62%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  198 YEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFG-DSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            Y FS    +G     +  +  VVL+VNVAS   A    Y +L+ L++     GL I+ FPC QFG QE   D+EI +F + K+ V F +  KI  NG    P++K+LK  + G  G   IKWNF KF++ R G  VKR+   T P+  C   IE  LN+
Sbjct:    5 YSFSPIDENGNPFPFNSLRNKVVLIVNVASH-CAFTPQYKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPI-IEELLNQ 161          
BLAST of Glutathione peroxidase vs. Ensembl Nematostella
Match: EDO33712 (Glutathione peroxidase [Source:UniProtKB/TrEMBL;Acc:A7SRF0])

HSP 1 Score: 134.42 bits (337), Expect = 5.914e-39
Identity = 69/149 (46.31%), Postives = 92/149 (61.74%), Query Frame = 3
Query:  189 STIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPIS 635
            S  Y F+AK I G+D+S+ KY+G VVL+VNVAS+ G T  NY +L  LH   + +GL IL FPCNQFG QEP  +  I  F    + V+FDMFSKI   GD +HPL+ +L        G    WNF K+L++R G+ VK +  + +P S
Sbjct:    1 SQFYSFTAKDIHGQDVSMEKYRGKVVLIVNVASECGFTDVNYRELVALHNKYSKEGLAILAFPCNQFGKQEPKRNYGIYRFAVDYYGVQFDMFSKIKTVGDGSHPLYNFLVEST----GFPPIWNFNKYLVNRAGVVVKYFNHSFNPSS 145          
BLAST of Glutathione peroxidase vs. Ensembl Nematostella
Match: EDO25595 (Glutathione peroxidase [Source:UniProtKB/TrEMBL;Acc:A8DW14])

HSP 1 Score: 120.168 bits (300), Expect = 2.121e-33
Identity = 64/152 (42.11%), Postives = 95/152 (62.50%), Query Frame = 3
Query:  183 NASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYL-KMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPIS 635
            + +++Y    K+IDG++I+LS YKG  +++VNVASK G T + Y  LQ+L+     K L ++G PCNQFG QEPG+ E+I+ F +  + V F +  K+ V G   HPL+ +L K +L G    S+KWNF K+LI  +G  +  Y   T P+S
Sbjct:    2 DTNSLYHIQIKSIDGKEINLSDYKGKKIVIVNVASKCGFTPQ-YEGLQKLYDTYKDK-LMVIGVPCNQFGTQEPGTSEQIQSFCQLNYGVTFLITEKVAVKGAQQHPLYAWLTKKELNGKKNSSVKWNFQKYLIDEEGKFIDYYYSLTKPMS 151          
BLAST of Glutathione peroxidase vs. Ensembl Nematostella
Match: EDO33021 (Glutathione peroxidase [Source:UniProtKB/TrEMBL;Acc:A7STH1])

HSP 1 Score: 101.679 bits (252), Expect = 3.506e-27
Identity = 50/95 (52.63%), Postives = 63/95 (66.32%), Query Frame = 3
Query:  189 STIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSK 473
            S  Y F+AK I G+D+S+ KY+G VVL+VNVAS+ G T  NY +L  LH   + +GL IL FPCNQFG QEP  +  I  F    + V+FDMFSK
Sbjct:    1 SQFYSFTAKDIHGQDVSMEKYRGKVVLIVNVASECGFTDVNYRELVALHNKYSKEGLAILAFPCNQFGKQEPKRNYGIYRFAVDYYGVQFDMFSK 95          
BLAST of Glutathione peroxidase vs. Ensembl Nematostella
Match: EDO49260 (Glutathione peroxidase [Source:UniProtKB/TrEMBL;Acc:A7RGZ3])

HSP 1 Score: 74.3294 bits (181), Expect = 2.557e-16
Identity = 50/142 (35.21%), Postives = 75/142 (52.82%), Query Frame = 3
Query:  297 ATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSD-EEIK---EFVK--SKFNVEFDMFSKIDVNGDTAHPLFKYLKMK-------LKGYFGD---------SIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIE 656
            A A NY +++++  L      ++ GFPCNQFG QEPG + +EI+    FV+  + F  +F + ++ DVNG+  HP + +LK +       + G   D          I WNF KFLI   G PV R+ P+ +P  D   +IE
Sbjct:   12 ALAVNYGKVEDVCSL------KVFGFPCNQFGKQEPGDNADEIRNSLRFVRPGNGFVPKFPLMNRTDVNGNKQHPAYTFLKAQCPSPDGMIMGNHDDIIWSPVKSGDISWNFEKFLIDHHGKPVLRFKPSVNP-KDLGQEIE 146          
BLAST of Glutathione peroxidase vs. Ensembl Nematostella
Match: EDO49156 (Glutathione peroxidase [Source:UniProtKB/TrEMBL;Acc:A7RH41])

HSP 1 Score: 73.1738 bits (178), Expect = 1.667e-15
Identity = 49/130 (37.69%), Postives = 61/130 (46.92%), Query Frame = 3
Query:  354 GLRILGFPCNQFGGQEPG-SDEEIKEFVK-----SKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFG-------------------DSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELN 668
            GL I+GFPCNQF   EPG +  EI+  VK       F   F +  K +VNG   HPL+ +LK       G                   D I WNF KFLI  +G PV+RY P   P    Q DI++ +N
Sbjct:   62 GLEIVGFPCNQFKLHEPGDTATEIRNCVKYVRPGGGFEPNFPLMKKTEVNGIKEHPLYTFLKTSCPSPDGVIREDRYKDVRVLWSPIKSDDISWNFEKFLIDHRGKPVRRYKPRLFPERMVQ-DIDSVIN 190          
BLAST of Glutathione peroxidase vs. Ensembl Medaka
Match: GPX4 (phospholipid hydroperoxide glutathione peroxidase, mitochondrial-like [Source:NCBI gene;Acc:111946273])

HSP 1 Score: 187.963 bits (476), Expect = 1.219e-58
Identity = 92/158 (58.23%), Postives = 114/158 (72.15%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKL--KGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            A  + WK A++IYEFSA  IDG D+SL KY+G V ++VNV+S+   T  NY QL  +H   A +GLRIL FPCNQFG QEPG++ EIKEF K  +N EFD+FSKIDVN DTAHPL+K++K +   KG+ G+ IKWNFTKFLI + G  VKRY P   P
Sbjct:   29 AQKEDWKKAASIYEFSAIDIDGNDVSLEKYRGYVCIIVNVSSECKLTDVNYTQLTAMHTQYAEQGLRILAFPCNQFGSQEPGTEAEIKEFAKG-YNAEFDLFSKIDVNNDTAHPLWKWMKEQPEGKGFMGNFIKWNFTKFLIDKNGQVVKRYAPKDEP 185          
BLAST of Glutathione peroxidase vs. Ensembl Medaka
Match: ENSORLT00000018493.2 (phospholipid hydroperoxide glutathione peroxidase, mitochondrial-like [Source:NCBI gene;Acc:101160762])

HSP 1 Score: 175.252 bits (443), Expect = 3.927e-54
Identity = 90/160 (56.25%), Postives = 109/160 (68.12%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKM--KLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPIS 635
            A  + WK A++IYEFSA  IDG D+SL KY+G V ++VNV             L  +H   A +GLRIL FPCNQFG QEPG++ EIKEF K  +N EFD+FSKIDVN DTAHPL+K++K   K KG+ G+ IKWNFTKFLI + G  VKRYGP   P S
Sbjct:   22 AQKEDWKKAASIYEFSAIDIDGNDVSLEKYRGYVCIIVNV-------------LTAMHTQYAEQGLRILAFPCNQFGSQEPGTEAEIKEFAKG-YNAEFDLFSKIDVNNDTAHPLWKWMKEQPKGKGFMGNYIKWNFTKFLIDKNGQVVKRYGPKDEPFS 167          
BLAST of Glutathione peroxidase vs. Ensembl Medaka
Match: ENSORLT00000019207.2 (phospholipid hydroperoxide glutathione peroxidase, mitochondrial [Source:NCBI gene;Acc:101160642])

HSP 1 Score: 162.155 bits (409), Expect = 4.179e-49
Identity = 82/166 (49.40%), Postives = 112/166 (67.47%), Query Frame = 3
Query:  138 LLNFN*FKANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKL--KGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSP 629
            +  FN      + W+ A++IY+F+A  IDG  +SL KY+G+VV++ NV +K             +H   A +GLRIL FP NQFG QEPG++ +IK F +S F+  FD+FSKIDVNG +AHPL+K+LK +   +G FG+SIKWNFTKFLI+++G  VKRYGP   P
Sbjct:    1 MFTFNQQSTPTEDWQRATSIYDFNATDIDGNLVSLEKYRGNVVIITNVFAK-------------MHAAYAERGLRILAFPSNQFGNQEPGNETQIKSFAES-FDAHFDLFSKIDVNGPSAHPLWKWLKEQPHGRGLFGNSIKWNFTKFLINKEGQVVKRYGPMDDP 152          
BLAST of Glutathione peroxidase vs. Ensembl Medaka
Match: gpx7 (glutathione peroxidase 7 [Source:NCBI gene;Acc:101164048])

HSP 1 Score: 121.709 bits (304), Expect = 2.629e-33
Identity = 66/143 (46.15%), Postives = 83/143 (58.04%), Query Frame = 3
Query:  198 YEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTS 626
            Y F      G+ +SL KY+G V LVVNVAS+ G T ++Y  LQ+L +        +LGFPCNQFG QEPGSD+EI  FV+  + V F +FSKI V G  AH ++KY    L    G    WNF K+LI   G  V  +GP  S
Sbjct:   24 YTFKVVNSRGKLVSLEKYRGSVSLVVNVASECGFTEEHYKDLQQLQRDFGSSHFNVLGFPCNQFGQQEPGSDKEIDSFVRRVYGVSFPLFSKIAVVGTGAHNVYKY----LADSSGKEPDWNFWKYLIDVNGKVVDAWGPKVS 162          
BLAST of Glutathione peroxidase vs. Ensembl Medaka
Match: GPX1 (glutathione peroxidase 1 [Source:NCBI gene;Acc:101172806])

HSP 1 Score: 114.39 bits (285), Expect = 1.497e-30
Identity = 71/182 (39.01%), Postives = 95/182 (52.20%), Query Frame = 3
Query:  198 YEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPGSDEEIKEFVK-----SKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDS-------------------IKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            Y  +AK + GE  + S  +G VVL+ NVAS  G T ++Y Q+ ELH+  A KGL ILG PCNQFG QE   +EEI   +K     + F  +F +  K+DVNG  AHPLF +L+ +L     D                    + WNF KFL+   G P KRY       SD + DI+  L++
Sbjct:    3 YSLTAKLLSGEIFNFSVLQGKVVLIENVASL-GTTTRDYTQMNELHERYASKGLVILGVPCNQFGHQENCKNEEILLSLKHVRPGNGFEPKFQLLEKVDVNGKDAHPLFAFLREQLPTPSDDPAPLMTDPKFIIWSPVCRNDVAWNFEKFLVGPDGTPFKRYS-RRFLTSDVEGDIKKLLSQ 182          
BLAST of Glutathione peroxidase vs. Planmine SMEST
Match: SMESG000077750.1 (SMESG000077750.1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.072e-34
Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK 290
            ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK
Sbjct:   40 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK 82          

HSP 2 Score: 76.6406 bits (187), Expect = 4.072e-34
Identity = 38/39 (97.44%), Postives = 38/39 (97.44%), Query Frame = 1
Query:    1 IRNLSLFIKAAGSFRIQSNLFSQMVWIYLIFNLLIFQMV 117
            IRNLSLFIKAAGSFRIQSNLFSQMVWIYLIFNLLIFQM 
Sbjct:    2 IRNLSLFIKAAGSFRIQSNLFSQMVWIYLIFNLLIFQMA 40          
BLAST of Glutathione peroxidase vs. Planmine SMEST
Match: SMESG000022914.1 (SMESG000022914.1)

HSP 1 Score: 117.472 bits (293), Expect = 6.886e-32
Identity = 69/168 (41.07%), Postives = 94/168 (55.95%), Query Frame = 3
Query:  171 DSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEP--GSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELN 668
            D  KN S  Y+F+A  ID + +  +KY+G VVLV               Q+Q+LH     +GL IL FPC QFG ++     D+EI++FV S+FN +F++F  +DV G+ AHP+F +L  KL       + WNF K+LI RKG P K Y     P +D   DIE  LN
Sbjct:   28 DDIKNKS-FYDFTAIDIDSKQVEFTKYRGKVVLV---------------QMQQLHSQYFHRGLCILAFPCAQFGREKNLNWDDQEIRKFVVSQFNAQFELFKTVDVIGNNAHPVFVFLHAKLLR----KVSWNFNKYLIDRKGNPYKYYDDEIEP-NDLINDIEHLLN 174          
BLAST of Glutathione peroxidase vs. Planmine SMEST
Match: SMESG000022914.1 (SMESG000022914.1)

HSP 1 Score: 109.383 bits (272), Expect = 8.112e-29
Identity = 65/168 (38.69%), Postives = 90/168 (53.57%), Query Frame = 3
Query:  171 DSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEP--GSDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELN 668
            D  KN S  Y+F+A  ID + +  +KY+G                    Q+Q+LH     +GL IL FPC QFG ++     D+EI++FV S+FN +F++F  +DV G+ AHP+F +L  KL       + WNF K+LI RKG P K Y     P +D   DIE  LN
Sbjct:   28 DDIKNKS-FYDFTAIDIDSKQVEFTKYRG-------------------KQMQQLHSQYFHRGLCILAFPCAQFGREKNLNWDDQEIRKFVVSQFNAQFELFKTVDVIGNNAHPVFVFLHAKLLR----KVSWNFNKYLIDRKGNPYKYYDDEIEP-NDLINDIEHLLN 170          
BLAST of Glutathione peroxidase vs. Planmine SMEST
Match: SMESG000077750.1 (SMESG000077750.1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.295e-26
Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 3
Query:  162 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK 290
            ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK
Sbjct:   26 ANGDSWKNASTIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK 68          

HSP 2 Score: 49.6766 bits (117), Expect = 4.295e-26
Identity = 24/24 (100.00%), Postives = 24/24 (100.00%), Query Frame = 1
Query:    1 IRNLSLFIKAAGSFRIQSNLFSQM 72
            IRNLSLFIKAAGSFRIQSNLFSQM
Sbjct:    2 IRNLSLFIKAAGSFRIQSNLFSQM 25          
BLAST of Glutathione peroxidase vs. Planmine SMEST
Match: SMESG000002408.1 (SMESG000002408.1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.787e-24
Identity = 60/162 (37.04%), Postives = 85/162 (52.47%), Query Frame = 3
Query:  192 TIYEFSAKTIDGEDISLSKYKGDVVLVVNVASK*GATAKNYNQLQELHKLLAGKGLRILGFPCNQFGGQEPG--SDEEIKEFVKSKFNVEFDMFSKIDVNGDTAHPLFKYLKMKLKGYFGDSIKWNFTKFLISRKGIPVKRYGPTTSPISDCQADIEAELNK 671
            T+Y+FSA  IDG  ++  KYK                       Q+L    A +G R+LGF  +QFG ++    +D++IK FV+  F+  F MF  +D+ G +AHPLFK+L+     +    I WNF KFLI+R G+P K Y     PI D   +IE  LN+
Sbjct:   69 TVYKFSAFDIDGNFVNFEKYKN----------------------QDLQAKYAHRGFRVLGFANSQFGREKDTKFTDKDIKNFVEDGFSSTFVMFRNVDIVGPSAHPLFKFLERSTNSH----IIWNFNKFLITRNGVPYKFYDNKIEPI-DLIPEIEMLLNQ 203          
The following BLAST results are available for this feature:
BLAST of Glutathione peroxidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPX42.505e-6059.75glutathione peroxidase 4 [Source:HGNC Symbol;Acc:H... [more]
GPX44.723e-6059.75glutathione peroxidase 4 [Source:HGNC Symbol;Acc:H... [more]
GPX46.352e-5959.75glutathione peroxidase 4 [Source:HGNC Symbol;Acc:H... [more]
GPX41.899e-5859.75glutathione peroxidase 4 [Source:HGNC Symbol;Acc:H... [more]
GPX41.433e-5661.49glutathione peroxidase 4 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpx-11.981e-5352.83Glutathione peroxidase 1 [Source:UniProtKB/Swiss-... [more]
gpx-11.981e-5352.83Glutathione peroxidase 1 [Source:UniProtKB/Swiss-... [more]
gpx-21.518e-5050.31Glutathione peroxidase 2 [Source:UniProtKB/Swiss-... [more]
gpx-21.518e-5050.31Glutathione peroxidase 2 [Source:UniProtKB/Swiss-... [more]
gpx-21.745e-5050.31Glutathione peroxidase 2 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PHGPx6.336e-5452.91gene:FBgn0035438 transcript:FBtr0073067[more]
PHGPx1.099e-5352.91gene:FBgn0035438 transcript:FBtr0073068[more]
PHGPx1.688e-5353.53gene:FBgn0035438 transcript:FBtr0073066[more]
CG151161.831e-3040.99gene:FBgn0034415 transcript:FBtr0086596[more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpx4b2.651e-6362.03glutathione peroxidase 4b [Source:ZFIN;Acc:ZDB-GEN... [more]
gpx4a3.662e-6058.86glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GEN... [more]
gpx4a3.681e-6058.86glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GEN... [more]
gpx4b5.793e-4066.67glutathione peroxidase 4b [Source:ZFIN;Acc:ZDB-GEN... [more]
gpx4a2.215e-3762.75glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
acvr1b1.142e-3141.25activin A receptor type 1B [Source:Xenbase;Acc:XB-... [more]
gpx82.377e-2941.43glutathione peroxidase 8 (putative) [Source:NCBI g... [more]
gpx16.142e-2137.59glutathione peroxidase 1 [Source:NCBI gene;Acc:548... [more]
plekho21.216e-1536.30pleckstrin homology domain containing O2 [Source:X... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpx45.836e-5958.23glutathione peroxidase 4 [Source:MGI Symbol;Acc:MG... [more]
Gpx45.359e-5858.23glutathione peroxidase 4 [Source:MGI Symbol;Acc:MG... [more]
Gpx42.197e-5559.86glutathione peroxidase 4 [Source:MGI Symbol;Acc:MG... [more]
Gpx74.820e-3743.75glutathione peroxidase 7 [Source:MGI Symbol;Acc:MG... [more]
Gpx13.122e-3539.78glutathione peroxidase 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Glutathione peroxidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00277|GPX1_SCHMA6.076e-6459.64Glutathione peroxidase OS=Schistosoma mansoni OX=6... [more]
sp|Q32QL6|GPX4_CALJA1.693e-5959.49Phospholipid hydroperoxide glutathione peroxidase ... [more]
sp|Q4AEH2|GPX4_PONPY2.268e-5959.75Phospholipid hydroperoxide glutathione peroxidase ... [more]
sp|P36969|GPX4_HUMAN2.268e-5959.75Phospholipid hydroperoxide glutathione peroxidase ... [more]
sp|Q4AEG9|GPX4_SAPAP5.335e-5960.13Phospholipid hydroperoxide glutathione peroxidase ... [more]
back to top
BLAST of Glutathione peroxidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I6SBG21.766e-6867.92Glutathione peroxidase OS=Mytilus galloprovinciali... [more]
Q2XW135.069e-6864.50Glutathione peroxidase OS=Rhipicephalus microplus ... [more]
Q2XW143.185e-6764.29Glutathione peroxidase OS=Rhipicephalus microplus ... [more]
Q2XW199.657e-6763.69Glutathione peroxidase OS=Rhipicephalus microplus ... [more]
Q2XW181.112e-6663.69Glutathione peroxidase OS=Rhipicephalus microplus ... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpx4b1.507e-5356.33glutathione peroxidase 4b [Source:ZFIN;Acc:ZDB-GEN... [more]
gpx4a6.628e-4953.16glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GEN... [more]
gpx4b1.514e-3965.69glutathione peroxidase 4b [Source:ZFIN;Acc:ZDB-GEN... [more]
gpx73.103e-3043.75glutathione peroxidase 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
gpx88.107e-3037.97glutathione peroxidase 8 (putative) [Source:NCBI g... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpx4a1.409e-3660.58glutathione peroxidase 4a [Source:ZFIN;Acc:ZDB-GEN... [more]
GPX21.070e-3241.46glutathione peroxidase 2 [Source:HGNC Symbol;Acc:H... [more]
gpx31.139e-2638.75glutathione peroxidase 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
gpx91.881e-1839.34glutathione peroxidase 9 [Source:ZFIN;Acc:ZDB-GENE... [more]
gpx92.057e-1839.34glutathione peroxidase 9 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
GPX28.304e-4046.01Phospholipid hydroperoxide glutathione peroxidase;... [more]
HYR13.634e-3746.00Thiol peroxidase; functions as a hydroperoxide rec... [more]
GPX13.205e-2939.62Phospholipid hydroperoxide glutathione peroxidase;... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO337125.914e-3946.31Glutathione peroxidase [Source:UniProtKB/TrEMBL;A... [more]
EDO255952.121e-3342.11Glutathione peroxidase [Source:UniProtKB/TrEMBL;A... [more]
EDO330213.506e-2752.63Glutathione peroxidase [Source:UniProtKB/TrEMBL;A... [more]
EDO492602.557e-1635.21Glutathione peroxidase [Source:UniProtKB/TrEMBL;A... [more]
EDO491561.667e-1537.69Glutathione peroxidase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Glutathione peroxidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPX41.219e-5858.23phospholipid hydroperoxide glutathione peroxidase,... [more]
ENSORLT00000018493.23.927e-5456.25phospholipid hydroperoxide glutathione peroxidase,... [more]
ENSORLT00000019207.24.179e-4949.40phospholipid hydroperoxide glutathione peroxidase,... [more]
gpx72.629e-3346.15glutathione peroxidase 7 [Source:NCBI gene;Acc:101... [more]
GPX11.497e-3039.01glutathione peroxidase 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Glutathione peroxidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077750.14.072e-34100.00SMESG000077750.1[more]
SMESG000022914.16.886e-3241.07SMESG000022914.1[more]
SMESG000022914.18.112e-2938.69SMESG000022914.1[more]
SMESG000077750.14.295e-26100.00SMESG000077750.1[more]
SMESG000002408.15.787e-2437.04SMESG000002408.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013334 ID=SMED30013334|Name=Glutathione peroxidase|organism=Schmidtea mediterranea sexual|type=transcript|length=948bp
ATAAGGAACTTATCATTATTTATAAAAGCAGCAGGTTCTTTCCGAATTCA
ATCAAATCTATTTTCACAAATGGTTTGGATTTATTTAATTTTTAATTTAT
TAATCTTTCAAATGGTTTTTAAATTTTTTGCATTTGATTATTGAATTTTA
ATTAATTTAAGGCAAACGGCGACTCGTGGAAAAACGCATCAACTATTTAT
GAATTTTCAGCTAAAACTATTGATGGAGAAGATATTTCTTTAAGCAAATA
TAAAGGCGATGTTGTACTCGTTGTTAATGTTGCATCTAAATGAGGAGCAA
CAGCCAAGAATTACAACCAGTTGCAGGAGTTGCATAAGCTTCTGGCTGGT
AAAGGGCTCCGAATTCTTGGTTTTCCCTGTAATCAGTTTGGGGGTCAGGA
GCCTGGTAGTGATGAAGAAATTAAAGAATTTGTTAAATCTAAATTCAATG
TTGAATTTGATATGTTTAGTAAAATTGATGTTAATGGAGATACCGCGCAT
CCGTTATTTAAATATTTAAAAATGAAATTGAAAGGATATTTTGGAGATTC
TATCAAATGGAATTTCACAAAATTTCTTATCAGTCGAAAAGGAATACCCG
TTAAACGGTATGGTCCAACTACATCTCCAATTAGTGATTGTCAAGCCGAC
ATCGAAGCAGAACTTAATAAATAAATCGAGATTTCTTCACGAAAAGCCAT
GCCTATGATGAAATTGTTCAAAATTAAGAATAATTTTTGATGGAAATTTG
GTTATGCACAAATTTCACGTGGTTTTTCGTTAAATATATTTCATTTATTT
AATTTTATTTTAATCAGATTATTATCATCATAAATTGTGATACAGTTTTA
AATAATTTATGTGTTAAATCAGTAGTATTTCGATAGAATTTGTAACGATT
TTTTAATTGGGAAATAAATGTAAAGTTCCAGTAGTTTGCTTAATTTTA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000889Glutathione_peroxidase
IPR012336Thioredoxin-like_fold
IPR029760GPX_CS
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006979response to oxidative stress
GO:0098869cellular oxidant detoxification
Vocabulary: molecular function
TermDefinition
GO:0004602glutathione peroxidase activity
GO:0004601peroxidase activity
GO:0016491oxidoreductase activity