Long-chain-fatty-acid--CoA ligase ACSBG2

Overview
NameLong-chain-fatty-acid--CoA ligase ACSBG2
Smed IDSMED30013319
Length (bp)2136
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30013319) t-SNE clustered cells

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30013319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30013319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30013319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013319SMESG000027204.1 dd_Smed_v4_1026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30013319SMESG000027204.1 dd_Smed_v4_1026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013319SMESG000027204.1 dd_Smed_v4_1026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30013319SMESG000027204.1 SMED30013319smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30013319SMESG000027204.1 SMED30013319smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30013319SMESG000027204.1 SMED30013319smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30013319SMESG000027204.1 dd_Smed_v4_1026_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013319SMESG000027204.1 dd_Smed_v4_1026_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 529.635 bits (1363), Expect = 1.481e-180
Identity = 280/626 (44.73%), Postives = 408/626 (65.18%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEV-TMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSI-LPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK---PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            TIP+  ++ V     +P L      KNG   E+    QY E  +KAA + IKLGL+    VGILGFN   WFI+ +G I AGG+  GIY TN+ ++C++++      I++VEND QL KILSI    +  LKAII+Y       L  K + ++Y+W +FM L ++    +L++ +   + + CA+LIYTSGTTG PKGVMLSHDN+ +      +  K+     +V+SYLPLSHIAA + DI   + +G   YFAQ DALKG+L  TLKEV+PTVFIGVP+++EKI E +++  +K+  +KK    WA+N+G + +  K+ GK   PV  SY +AK LVF K+K +LGLD C    S  APL Q++ ++FLSLD+PI ++YGLSE +GPHT+   +  R+ S G IL G +  + + N++ IGEIC+ GRH+F+GY  +  +T E+ID +GWLHSGDLG+++    LY+TG IKE++ITAGGEN+ P+P+E  +K++IP IS+ MLVGD+ KF+S LLTLK  ++  +  P ++L   AI   + +G +A TV E+++ +D  + K I + I  VN  +++ A  ++KW +L +DFSI GGELGP MK+KR  + + Y + +  MY
Sbjct:    2 TIPEFFRESVNRFGTYPALA----SKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQY------RLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPV--SYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 615          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 529.25 bits (1362), Expect = 1.103e-179
Identity = 280/626 (44.73%), Postives = 408/626 (65.18%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEV-TMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSI-LPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK---PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            TIP+  ++ V     +P L      KNG   E+    QY E  +KAA + IKLGL+    VGILGFN   WFI+ +G I AGG+  GIY TN+ ++C++++      I++VEND QL KILSI    +  LKAII+Y       L  K + ++Y+W +FM L ++    +L++ +   + + CA+LIYTSGTTG PKGVMLSHDN+ +      +  K+     +V+SYLPLSHIAA + DI   + +G   YFAQ DALKG+L  TLKEV+PTVFIGVP+++EKI E +++  +K+  +KK    WA+N+G + +  K+ GK   PV  SY +AK LVF K+K +LGLD C    S  APL Q++ ++FLSLD+PI ++YGLSE +GPHT+   +  R+ S G IL G +  + + N++ IGEIC+ GRH+F+GY  +  +T E+ID +GWLHSGDLG+++    LY+TG IKE++ITAGGEN+ P+P+E  +K++IP IS+ MLVGD+ KF+S LLTLK  ++  +  P ++L   AI   + +G +A TV E+++ +D  + K I + I  VN  +++ A  ++KW +L +DFSI GGELGP MK+KR  + + Y + +  MY
Sbjct:   52 TIPEFFRESVNRFGTYPALA----SKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQY------RLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPV--SYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 529.25 bits (1362), Expect = 1.103e-179
Identity = 280/626 (44.73%), Postives = 408/626 (65.18%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEV-TMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSI-LPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK---PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            TIP+  ++ V     +P L      KNG   E+    QY E  +KAA + IKLGL+    VGILGFN   WFI+ +G I AGG+  GIY TN+ ++C++++      I++VEND QL KILSI    +  LKAII+Y       L  K + ++Y+W +FM L ++    +L++ +   + + CA+LIYTSGTTG PKGVMLSHDN+ +      +  K+     +V+SYLPLSHIAA + DI   + +G   YFAQ DALKG+L  TLKEV+PTVFIGVP+++EKI E +++  +K+  +KK    WA+N+G + +  K+ GK   PV  SY +AK LVF K+K +LGLD C    S  APL Q++ ++FLSLD+PI ++YGLSE +GPHT+   +  R+ S G IL G +  + + N++ IGEIC+ GRH+F+GY  +  +T E+ID +GWLHSGDLG+++    LY+TG IKE++ITAGGEN+ P+P+E  +K++IP IS+ MLVGD+ KF+S LLTLK  ++  +  P ++L   AI   + +G +A TV E+++ +D  + K I + I  VN  +++ A  ++KW +L +DFSI GGELGP MK+KR  + + Y + +  MY
Sbjct:   52 TIPEFFRESVNRFGTYPALA----SKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQY------RLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPV--SYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG1 (acyl-CoA synthetase bubblegum family member 1 [Source:HGNC Symbol;Acc:HGNC:29567])

HSP 1 Score: 515.768 bits (1327), Expect = 1.183e-173
Identity = 269/592 (45.44%), Postives = 385/592 (65.03%), Query Frame = 3
Query:  309 VTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPF---KNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            ++  QY  L ++AA  F+KLGL    +V ILGFN P WF S +G +FAGGI+ GIYTT++P+ C++I  DC   +I+V+   QL KIL I   +P LKA++ Y      E       ++YT  EFM L      + LD  +   QP+ C +L+YTSGTTG PKGVMLS DN+ +T +   +   I+P    +  V+SYLPLSHIAA + D+ T +  G  V FA+PDALKGSL  TL+EV PT  +GVPRV+EKI E++QE+ +++G I++ +  WA +V    +L          +  LA YLV  K+++ALG  +C      AAP+  ++  +FL L++ +   YGLSE +GPH M      R+ S+G ++ G  +K+   +   IGEIC+ GR +F+GY N  +KT E+ID +GWLH+GD G+++ +  LYITGR+KELIITAGGEN+ PVPIE+ +K  +P IS+ ML+GD++KF+S LLTLK T+D DT   T+ LT  A+   + +G  A TV E++E KD A+ + I+E I++VN  + +R  ++QKW++L RDFSISGGELGPTMK+KR+ ++E Y  I+ S Y
Sbjct:  133 ISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIYK-----EPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFY 719          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 449.129 bits (1154), Expect = 4.593e-151
Identity = 218/475 (45.89%), Postives = 323/475 (68.00%), Query Frame = 3
Query:  660 SIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK---PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            ++Y+W +FM L ++    +L++ +   + + CA+LIYTSGTTG PKGVMLSHDN+ +      +  K+     +V+SYLPLSHIAA + DI   + +G   YFAQ DALKG+L  TLKEV+PTVFIGVP+++EKI E +++  +K+  +KK    WA+N+G + +  K+ GK   PV  SY +AK LVF K+K +LGLD C    S  APL Q++ ++FLSLD+PI ++YGLSE +GPHT+   +  R+ S G IL G +  + + N++ IGEIC+ GRH+F+GY  +  +T E+ID +GWLHSGDLG+++    LY+TG IKE++ITAGGEN+ P+P+E  +K++IP IS+ MLVGD+ KF+S LLTLK  ++  +  P ++L   AI   + +G +A TV E+++ +D  + K I + I  VN  +++ A  ++KW +L +DFSI GGELGP MK+KR  + + Y + +  MY
Sbjct:    6 NLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPV--SYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 478          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 179.489 bits (454), Expect = 1.245e-47
Identity = 181/649 (27.89%), Postives = 310/649 (47.77%), Query Frame = 3
Query:  210 ETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKA---ASNFIKLGLDVKAA--VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYS---ISIYTWTEFMNLNQADSADELDRRLSEI--QPDDCALLIYTSGTTGFPKGVMLSHDNMIF--TVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVS--VGVTVYFAQPDALKGSLGKTLKEVRPTVFIG----VPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPNEN-----NIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFI-DEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
             T+   +++  + +++ P+L  +    +G  I    E Y  ++++A   +  F +LG+    A  +GI   N   W I++        +I  IY T   +   FI+N    +I+V ++  +   +L      P L  ++     V+ ELKT  S   + + T+ +   + +         R + I   P+D A + YTSGTTG PKGVML+H N+I         +H  I    +S+IS+LPL+H+   L  ++ +V   VG  V F + D     L + +KE++PTV       + R+++K+  ++ +      T+KK +  +A +   R+    +    +    F    LVF KI+E  G  R   + + +APL+   L +   ++   + + YG +EC    T+ +      G  G ++   ++K +D P  N       GE+C++G  +F GYY N ++TKE+ID DGWLH+GD+G+      L I  R K +   + GE +AP  IE+ I  R  +++   + G+  K  +CL+ +   V  D +     L PA    + D GI+  T EE+  C + A+KK I D+ +       +     V+  SL    FS+    L PT+K KR  +   YS+ + +MYS
Sbjct:   66 RTLYQGVRRGARLSNNGPMLGRRVKQSDG-SIPYVWESYNTILERADNVSVAFRELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLV-VMEPVTDELKTTASSLGVEVLTFEDLEKIGK-----NAKTRPAHIPPTPEDLATICYTSGTTGTPKGVMLTHANVIADGVCMDFFKHSGIAA-TDSMISFLPLAHM---LERVIESVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNK-----STLKKMLFDFAISYKARD----MANFNIRNDGFFDN-LVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIEN-IYVRSKYVAQSFVHGESLK--TCLIAI---VVPDAE----VLVPA----MADQGIKG-TFEEL--CNNDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMYS 673          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 179.874 bits (455), Expect = 1.416e-47
Identity = 181/649 (27.89%), Postives = 310/649 (47.77%), Query Frame = 3
Query:  210 ETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKA---ASNFIKLGLDVKAA--VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYS---ISIYTWTEFMNLNQADSADELDRRLSEI--QPDDCALLIYTSGTTGFPKGVMLSHDNMIF--TVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVS--VGVTVYFAQPDALKGSLGKTLKEVRPTVFIG----VPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPNEN-----NIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFI-DEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
             T+   +++  + +++ P+L  +    +G  I    E Y  ++++A   +  F +LG+    A  +GI   N   W I++        +I  IY T   +   FI+N    +I+V ++  +   +L      P L  ++     V+ ELKT  S   + + T+ +   + +         R + I   P+D A + YTSGTTG PKGVML+H N+I         +H  I    +S+IS+LPL+H+   L  ++ +V   VG  V F + D     L + +KE++PTV       + R+++K+  ++ +      T+KK +  +A +   R+    +    +    F    LVF KI+E  G  R   + + +APL+   L +   ++   + + YG +EC    T+ +      G  G ++   ++K +D P  N       GE+C++G  +F GYY N ++TKE+ID DGWLH+GD+G+      L I  R K +   + GE +AP  IE+ I  R  +++   + G+  K  +CL+ +   V  D +     L PA    + D GI+  T EE+  C + A+KK I D+ +       +     V+  SL    FS+    L PT+K KR  +   YS+ + +MYS
Sbjct:  109 RTLYQGVRRGARLSNNGPMLGRRVKQSDG-SIPYVWESYNTILERADNVSVAFRELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLV-VMEPVTDELKTTASSLGVEVLTFEDLEKIGK-----NAKTRPAHIPPTPEDLATICYTSGTTGTPKGVMLTHANVIADGVCMDFFKHSGIAA-TDSMISFLPLAHM---LERVIESVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNK-----STLKKMLFDFAISYKARD----MANFNIRNDGFFDN-LVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIEN-IYVRSKYVAQSFVHGESLK--TCLIAI---VVPDAE----VLVPA----MADQGIKG-TFEEL--CNNDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMYS 716          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 179.489 bits (454), Expect = 2.323e-47
Identity = 182/649 (28.04%), Postives = 311/649 (47.92%), Query Frame = 3
Query:  210 ETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKA---ASNFIKLGLDVKAA--VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYS---ISIYTWTEFMNLNQADSADELDRRLSEI--QPDDCALLIYTSGTTGFPKGVMLSHDNMIF--TVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVS--VGVTVYFAQPDALKGSLGKTLKEVRPTVFIG----VPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPNEN-----NIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFI-DEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
             T+   +++  + +++ P+L  +    +G  I    E Y  ++++A   +  F +LG+    A  +GI   N   W I++        +I  IY T   +   FI+N    +I+V ++  +   +L      P L  ++     V+ ELKT  S   + + T+ +   + +         R + I   P+D A + YTSGTTG PKGVML+H N+I         +H  I    +S+IS+LPL+H+   L  ++ +V   VG  V F + D     L + +KE++PTV       + R+++K+  ++ +      T+KK +  +A +   R+ +A      +    F    LVF KI+E  G  R   + + +APL+   L +   ++   + + YG +EC    T+ +      G  G ++   ++K +D P  N       GE+C++G  +F GYY N ++TKE+ID DGWLH+GD+G+      L I  R K +   + GE +AP  IE+ I  R  +++   + G+  K  +CL+ +   V  D +     L PA    + D GI+  T EE+  C + A+KK I D+ +       +     V+  SL    FS+    L PT+K KR  +   YS+ + +MYS
Sbjct:  116 RTLYQGVRRGARLSNNGPMLGRRVKQSDG-SIPYVWESYNTILERADNVSVAFRELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLV-VMEPVTDELKTTASSLGVEVLTFEDLEKIGK-----NAKTRPAHIPPTPEDLATICYTSGTTGTPKGVMLTHANVIADGVCMDFFKHSGIAA-TDSMISFLPLAHM---LERVIESVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNK-----STLKKMLFDFAISYKARD-MANFN---IRNDGFFDN-LVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIEN-IYVRSKYVAQSFVHGESLK--TCLIAI---VVPDAE----VLVPA----MADQGIKG-TFEEL--CNNDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMYS 723          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-18 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q21872])

HSP 1 Score: 167.162 bits (422), Expect = 2.306e-43
Identity = 159/606 (26.24%), Postives = 279/606 (46.04%), Query Frame = 3
Query:  309 VTMEQYLELIQKAASNFIKLGLDV--KAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYT--GDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQ-MQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLD-RCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPN-----ENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLE---CKDIALKKFID--EAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            ++ +Q  E    A+    KLG+++  ++ +GI   N P W +S++       +   +Y T T D   +I N C   ++ V+ + +  +++     +  LK I+++    D   E+  +    ++++ EF+ + +        R      P+  A + +TSGTTG PKGVML+H NM        E       +++ +SYLPL+HI   L  +++   +G  + F++ D     L   ++ + P  F  VPRV +KI +  M+++  K   +KK I   A  + ++    K+TGK   K++ + KY V  KI+  LG + R + L +A + ++        +  + + + YG +E +GP T+ +    RIG  G  +    +K ID P      + N GE+ ++G +V  GYY N E T  S   DG++ +GD+G+      L I  R K +     G+ +AP  + + +     F+  + + GD +K       L + V  D +         A  +L    I  KT E++       D  L++F++  E  K+       R   V    L P  FS   G   PT+K KR AI + +   +  MY
Sbjct:  115 ISYDQAFETSDHASQAIRKLGIEIGEESKIGIYSNNRPEWILSEMAIHNFSNVSVPLYDTITNDDMHYITNLCEISLMFVDAEIKTKQLIRDKSYLSSLKYIVQFNECSDDIKEMARENDFRLWSFNEFVEMGKKQK----HRPHVPPTPETLATISFTSGTTGRPKGVMLTHLNMCSATMSCEEFENEAGVQDAYLSYLPLAHIYERLC-LLSNFMIGSRIGFSRGDP--KLLVDDVQALAPRSFATVPRVIDKIHKAVMKQVQDKP--LKKMILNAA--IAYKLYHYKMTGKATRKTW-VDKY-VLHKIQMLLGPNIRQLILGAAKSDVSAMRFARG-AFGVEVLEGYGQTETSGPTTLQLVGDTRIGCVGPPMACAMIKLIDVPELGYSVDKNGGEVLVKGHNVTSGYYKNPEATASSFTEDGYMKTGDIGRFTAEGSLQIIDRRKNVFKMPQGKFVAP-DLTESLYTSSSFVQQIYVHGDMEK-----PWLVAIVVPDPEY-------LASYALTKHNINGKTYEQLCNIPILADDVLRQFVELTEEDKR------PRYEGVYGVHLTPVAFSAENGLTTPTLKNKRNAIAQFFKAEIDGMY 687          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-5 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q9XWD1])

HSP 1 Score: 159.458 bits (402), Expect = 8.869e-41
Identity = 167/639 (26.13%), Postives = 293/639 (45.85%), Query Frame = 3
Query:  225 CLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSI----SIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHV-KIQP----FKNSVISYLPLSHIAANLNDIMTTVSVGVTV-YFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKI-DEPNENNI-----GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDR-QKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKD-IGIEAKTVEEVLECKDIALKKFI---DEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            C+      ++D+  L Y    +   ++ +T+     L     +N           +GI   N P W +S +  +    ++  +Y T   +   FI++     +++V++  +   ++    ++P LK II    D + ELK   +I     + + T  +NL    S       L   +PDD  ++ YTSGTTG PKGVML+H N++  +   ++ +   QP         ISYLPLSH+   L    T +  G  + YF    +++G L   +K ++PTVF  VPR+  ++ + +     + G + K +  +A     + SL K  GK    + +    LVF+KI++ +G  +   + + +AP++   L+   ++L   I + YG +ECT   T         G  G       +K+ D P+ N       GEI I+G  V  GYY + E+T E  D +G+L +GD+G++  N  + I  R K +   A GE +AP  IE ++  R P +  V + GD  ++++  ++  +               P  ++   D  G  ++ +EE+  C D   K+F+     AI K N   ++    V+K  L    F++  G L PT+K KR  +   Y + ++ +Y
Sbjct:   91 CVGTRSSGDADYEFLTYDDVHEQAKNLSMTLVHEFGLTPANTTN-----------IGIYARNSPQWLVSAVACVEQSMVVVPLYDTLGAEAATFIISQAEISVVIVDSFKKAESLIKNRENMPTLKNIIVI--DSADELKDGTAIIDTIRVESLTNALNLG---SRYPFTNNLP--KPDDNYIICYTSGTTGTPKGVMLTHSNIVANISGFLKILFAFQPSMIDATQVHISYLPLSHMMEQLTH-WTLLGFGSKIGYFR--GSIQG-LTDDIKTLKPTVFPVVPRLLNRLYDAITSKVQQQGFMAKLVYNFA--FARKLSLVK-AGKVGRDTIW--DRLVFNKIQQQIG-GKVDLMVTGSAPISSTVLETCRVTLGTTIVEGYGQTECTALATFTWMGDPSTGHCGAPAPCALVKLGDVPDLNYFAKDGKGEIRIKGPCVTKGYYKDPERTAELFDEEGFLQTGDIGEMLPNGTIRIIDRKKHIFKLAQGEYVAPEKIE-QVYIRTPVVQQVYVDGDSLERWLIAVVVPE---------------PDVLKEWNDKQGSGSRKIEEI--CNDEKAKEFVLSELHAIGKAN--KLNSIEQVKKVILTSDTFTVENGLLTPTLKAKRPQLRLKYKDGMAKVY 681          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: bgm (gene:FBgn0027348 transcript:FBtr0080590)

HSP 1 Score: 518.85 bits (1335), Expect = 5.993e-176
Identity = 279/628 (44.43%), Postives = 409/628 (65.13%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVK---KAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLE---CKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            ++P  LK+ V    D+P L+ K + KNGY   VT +QY + + + A  FIKLGL+   +VG+L FN   WF S +G I A GII GIYTTN+ D  + ++   + QI+VV++  Q++KI +I   +P+LKA I+     S  LK +     Y W+E  ++N +D  D+   RL  +  ++C  L+YTSGT G PKGVMLSHDN+ F V+   KAM+ V +     S++SYLPLSH+AA   DI T   V   ++FA  DALKG+L K+L++ RPT F+GVPRV+EK QE+M  + S +G++KK +A WAK +  ++ +           Y +AK L+  K+K+ALG DR + LASAAAP++ ++  YFLSLD+ I   +G+SE  G HT+ + D + + + G  L G E K    + N  GE+CIRGRHVF+GY +N EKT+ES+D D WLHSGDLG V+D  ++ +TGR KE+IITAGGENI PV IE+ IK+ +  IS+  LVG+++K+++ L+TLK+ VD D+  P ++L+  +   +K +G+E KTV ++L    C  +   K I++AIK+ N  S+S A  VQK+++LP DFSI  GELGPT+K+KR  + +MY++ +  +Y+
Sbjct:   47 SVPGLLKRTVNNYGDYPALRTK-NGKNGYHT-VTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKE--DGYYRWSEIESMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVVVGA--ESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVW--KSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLYA 666          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: bgm (gene:FBgn0027348 transcript:FBtr0346624)

HSP 1 Score: 518.85 bits (1335), Expect = 5.993e-176
Identity = 279/628 (44.43%), Postives = 409/628 (65.13%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVK---KAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLE---CKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            ++P  LK+ V    D+P L+ K + KNGY   VT +QY + + + A  FIKLGL+   +VG+L FN   WF S +G I A GII GIYTTN+ D  + ++   + QI+VV++  Q++KI +I   +P+LKA I+     S  LK +     Y W+E  ++N +D  D+   RL  +  ++C  L+YTSGT G PKGVMLSHDN+ F V+   KAM+ V +     S++SYLPLSH+AA   DI T   V   ++FA  DALKG+L K+L++ RPT F+GVPRV+EK QE+M  + S +G++KK +A WAK +  ++ +           Y +AK L+  K+K+ALG DR + LASAAAP++ ++  YFLSLD+ I   +G+SE  G HT+ + D + + + G  L G E K    + N  GE+CIRGRHVF+GY +N EKT+ES+D D WLHSGDLG V+D  ++ +TGR KE+IITAGGENI PV IE+ IK+ +  IS+  LVG+++K+++ L+TLK+ VD D+  P ++L+  +   +K +G+E KTV ++L    C  +   K I++AIK+ N  S+S A  VQK+++LP DFSI  GELGPT+K+KR  + +MY++ +  +Y+
Sbjct:   47 SVPGLLKRTVNNYGDYPALRTK-NGKNGYHT-VTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKE--DGYYRWSEIESMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVVVGA--ESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVW--KSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLYA 666          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: hll (gene:FBgn0286723 transcript:FBtr0080591)

HSP 1 Score: 419.853 bits (1078), Expect = 2.447e-137
Identity = 241/656 (36.74%), Postives = 387/656 (58.99%), Query Frame = 3
Query:  192 TANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYD--IEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLN-QADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVK-IQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVE----KSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLEC-------KDIA-------------LKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            +   P +TIP+  K+  +  SD P L +++ P +G D    +T  +Y E +++AA   + +G++ +++VGIL FN P WF ++ G + AG ++ G+Y +N+ +    ++      + VV++  Q+ K+ +I   +P+LKA+I+  G   A +   +    ++W +       ++  +EL  R S I+ ++CA+LI+TSGT G PK VMLSHDN++F  K A  H++ IQ  K S +SYLPLSH+AA + D+   +S    V FA  DALKG+L KT ++ RPT   GVPRVFEK+QE++    +KA    + +   A+     +    + GK         Y+LA  +V   I+E +G+D C    +  AP +++   +FL LD+ + + YG+SE +G  T+ + D   + SAG   +GV +KI EP+ N  GEI +RGR VF+GY    +KT+E++  DGWLHSGDLG ++   +L I+GR+KELIITAGGENI PV IE+ IK+ +P +S+V+L+GD +K+++ LL+LK+  D  T  P + L    I  L+D+ I    + E+L          D A             L + I+E IK+ N  ++S A  VQK++L+  +FS++ GELGPT+K++R  +   Y++++  +Y
Sbjct:   30 SQTVPPQTIPEFFKESCEKYSDLPALVWET-PGSGNDGWTTLTFGEYQERVEQAALMLLSVGVEERSSVGILAFNCPEWFFAEFGALRAGAVVAGVYPSNSAEAVHHVLATGESSVCVVDDAQQMAKLRAIKERLPRLKAVIQLHGPFEAFVD--HEPGYFSWQKLQEQTFSSELKEELLARESRIRANECAMLIFTSGTVGMPKAVMLSHDNLVFDTKSAAAHMQDIQVGKESFVSYLPLSHVAAQIFDVFLGLSHAGCVTFADKDALKGTLIKTFRKARPTKMFGVPRVFEKLQERLVAAEAKARPYSRLLLARARAAVAEHQTTLMAGKSPSIYGNAKYWLACRVV-KPIREMIGVDNCRVFFTGGAPTSEELKQFFLGLDIALGECYGMSETSGAITLNV-DISNLYSAGQACEGVTLKIHEPDCNGQGEILMRGRLVFMGYLGLPDKTEETVKEDGWLHSGDLGYIDPKGNLIISGRLKELIITAGGENIPPVHIEELIKKELPCVSNVLLIGDHRKYLTVLLSLKTKCDAKTGIPLDALREETIEWLRDLDIHETRLSELLNIPADLQLPNDTAALAATLEITAKPKLLEAIEEGIKRANKYAISNAQKVQKFALIAHEFSVATGELGPTLKIRRNIVHAKYAKVIERLY 680          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0302322)

HSP 1 Score: 180.259 bits (456), Expect = 6.091e-48
Identity = 166/635 (26.14%), Postives = 280/635 (44.09%), Query Frame = 3
Query:  210 ETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFK--NSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPR----VFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPN-----ENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
             T+    ++    +++ P L ++    + Y   +  ++ L   +   +  + LG   K  +GI   N P W + + G      ++  +Y T  PD C FI+   + Q+++VE+D +   +L   P   ++   IK     + E      I I+++ +   L    +  E+         +D   + YTSGTTG PKGVML+H N++  V   +  +     +  + ++S+LPL+H+     +      VG  V F   D  +  L   LK ++PTV   VPR    V++KIQ  +   G K G           N+  R    +I    + ++    K LVF K+ +A G +  + +   +APL    L +   +L   + + YG +ECTG  T+ +         G  +    +K +D P        N GE+C+RG +VF GYY + EKT E+IDS+GW H+GD+G    N  L I  R K +   + GE I P  IE+ I     +++ V + G+  K  SC++   + V  DT       T   +R    +    K V+E++          +++ +       +     V+   L P  FS+  G L PT K KR  +   +   +  MY
Sbjct:   52 RTLYQTFREGAYASNNGPCLGWRETLTSPYQW-INYDEALLRAKNFGAGMLALGARPKQLIGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAAMLLEKAPRSLKIIVAIKPIRQTTLERARSRGIQIFSFIDVEKLGAKGNHPEVPP-----TAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSVILQMGDHRIRAGDVMVSFLPLAHMFERCCE-NGMYYVGGCVGFYSGDIKE--LTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLF---------NMAMRAKEKEIARGVLRRNGCWDK-LVFKKVHQAFGGNLRL-MVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIEN-IYTLSQYVNQVYVYGESLK--SCII---AVVVPDTDVLKQWATENNVRGTLSVLCNNKNVKELI----------MNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMY 650          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0333712)

HSP 1 Score: 179.874 bits (455), Expect = 9.047e-48
Identity = 166/635 (26.14%), Postives = 280/635 (44.09%), Query Frame = 3
Query:  210 ETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFK--NSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPR----VFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPN-----ENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
             T+    ++    +++ P L ++    + Y   +  ++ L   +   +  + LG   K  +GI   N P W + + G      ++  +Y T  PD C FI+   + Q+++VE+D +   +L   P   ++   IK     + E      I I+++ +   L    +  E+         +D   + YTSGTTG PKGVML+H N++  V   +  +     +  + ++S+LPL+H+     +      VG  V F   D  +  L   LK ++PTV   VPR    V++KIQ  +   G K G           N+  R    +I    + ++    K LVF K+ +A G +  + +   +APL    L +   +L   + + YG +ECTG  T+ +         G  +    +K +D P        N GE+C+RG +VF GYY + EKT E+IDS+GW H+GD+G    N  L I  R K +   + GE I P  IE+ I     +++ V + G+  K  SC++   + V  DT       T   +R    +    K V+E++          +++ +       +     V+   L P  FS+  G L PT K KR  +   +   +  MY
Sbjct:   64 RTLYQTFREGAYASNNGPCLGWRETLTSPYQW-INYDEALLRAKNFGAGMLALGARPKQLIGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAAMLLEKAPRSLKIIVAIKPIRQTTLERARSRGIQIFSFIDVEKLGAKGNHPEVPP-----TAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSVILQMGDHRIRAGDVMVSFLPLAHMFERCCE-NGMYYVGGCVGFYSGDIKE--LTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLF---------NMAMRAKEKEIARGVLRRNGCWDK-LVFKKVHQAFGGNLRL-MVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIEN-IYTLSQYVNQVYVYGESLK--SCII---AVVVPDTDVLKQWATENNVRGTLSVLCNNKNVKELI----------MNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMY 662          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 302/635 (47.56%), Postives = 428/635 (67.40%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQ---PFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKI-----TGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A TP  T+       V+    +P L +K   +      +T  +Y +  + AA +F+KLGL+    VGILGFN   WFI+ +  I AGG   GIYTTN+P+ C+++  +C   I+VVEN  QL KIL I   +P LKAII+Y      ELK K   ++YTW EFM L + +   +LD  +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T     +HV +      +  V+SYLPLSHIAA + DI   +  G   YFAQPDALKGSL  TL+E+RPT F+GVPRV+EK+QE+M+ IG+K+ T+++ +A WAK+VG + +L K+     + KP+  +Y LAK+LVF K+++ALGLDRC    + AAP+T+ +L++FLSLD+P+ ++YG+SE +GPHT+   +  R+ S G ++ G + K+  P++   GEIC  GRHVF+GY N  +KT+E++D++GWLHSGDLGK+++N  L+ITGRIKELIITAGGENI PVPIED +KE IP IS+ ML+GD++KF+S LLT+K  ++ +T  P ++LTP A+   + +G     V E+   +D A++  I + I +VN  + S A  +QKW++L +DFSI GGELGPTMK+KR  +++MY E + S Y
Sbjct:  103 AETPL-TVNQMFTSTVQRFGSYPALGWKEGEQWKT---MTYSEYYKSCRTAAKSFLKLGLERYHGVGILGFNSTEWFIADIAAILAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY----KDELKEKKP-NLYTWAEFMELGRDEPDTQLDDIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAVATSQHVSLNDADKLQEVVVSYLPLSHIAAQMIDIWLPMKAGGVTYFAQPDALKGSLANTLREIRPTAFLGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLQTNLNKMELGSNSRKPL--NYRLAKHLVFRKVRKALGLDRCTRCYTGAAPITKDTLEFFLSLDIPLFELYGMSESSGPHTITQANAFRLTSCGKVIPGCKTKLSNPDDEKNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKLDENNFLFITGRIKELIITAGGENIPPVPIEDAVKEAIPLISNAMLIGDKRKFLSMLLTVKCQINGETGVPEDELTPEAVEFCRKLGSSCTRVTEIAGGRDRAVQAAIQDGINRVNEKATSNAQRIQKWTVLDQDFSIPGGELGPTMKLKRPVVMKMYKEQIESFY 726          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 302/635 (47.56%), Postives = 428/635 (67.40%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQ---PFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKI-----TGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A TP  T+       V+    +P L +K   +      +T  +Y +  + AA +F+KLGL+    VGILGFN   WFI+ +  I AGG   GIYTTN+P+ C+++  +C   I+VVEN  QL KIL I   +P LKAII+Y      ELK K   ++YTW EFM L + +   +LD  +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T     +HV +      +  V+SYLPLSHIAA + DI   +  G   YFAQPDALKGSL  TL+E+RPT F+GVPRV+EK+QE+M+ IG+K+ T+++ +A WAK+VG + +L K+     + KP+  +Y LAK+LVF K+++ALGLDRC    + AAP+T+ +L++FLSLD+P+ ++YG+SE +GPHT+   +  R+ S G ++ G + K+  P++   GEIC  GRHVF+GY N  +KT+E++D++GWLHSGDLGK+++N  L+ITGRIKELIITAGGENI PVPIED +KE IP IS+ ML+GD++KF+S LLT+K  ++ +T  P ++LTP A+   + +G     V E+   +D A++  I + I +VN  + S A  +QKW++L +DFSI GGELGPTMK+KR  +++MY E + S Y
Sbjct:  155 AETPL-TVNQMFTSTVQRFGSYPALGWKEGEQWKT---MTYSEYYKSCRTAAKSFLKLGLERYHGVGILGFNSTEWFIADIAAILAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY----KDELKEKKP-NLYTWAEFMELGRDEPDTQLDDIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAVATSQHVSLNDADKLQEVVVSYLPLSHIAAQMIDIWLPMKAGGVTYFAQPDALKGSLANTLREIRPTAFLGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLQTNLNKMELGSNSRKPL--NYRLAKHLVFRKVRKALGLDRCTRCYTGAAPITKDTLEFFLSLDIPLFELYGMSESSGPHTITQANAFRLTSCGKVIPGCKTKLSNPDDEKNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKLDENNFLFITGRIKELIITAGGENIPPVPIEDAVKEAIPLISNAMLIGDKRKFLSMLLTVKCQINGETGVPEDELTPEAVEFCRKLGSSCTRVTEIAGGRDRAVQAAIQDGINRVNEKATSNAQRIQKWTVLDQDFSIPGGELGPTMKLKRPVVMKMYKEQIESFY 778          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:ZFIN;Acc:ZDB-GENE-110914-219])

HSP 1 Score: 512.301 bits (1318), Expect = 3.800e-173
Identity = 268/596 (44.97%), Postives = 392/596 (65.77%), Query Frame = 3
Query:  306 EVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPF---KNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVG-HRNSLAKITGKPVEKSYF--LAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            + T  +Y  L + AA  F+KLGL+    V ILGFN   WFI+ +G +FAGGI+ GIYTTN+PD C  + ND    +IVVEN  QL+KI+ +   +P LKAI++Y+G +  +L      ++Y+W EFM L    S  ELD  +S+ + + C +LIYTSGTTG PKGVMLSHDN+ +T   A     +QP    + S++SYLPLSHIAA + D+ T +  G  + FAQPDALKG+L  +L+EV PT  +GVPRV+EKI E+++E  S+ G +K+ +  WA +V    N   K   K  EKS+   LA+ L+  K++  LG   C+   S AAP+ +++L +FL L++ + + YG+SE +GPH M   +  +  S G ++ G + K+   N +  GE+C  GR+VF+G+ N  +KTKE++D DGWL SGDLGKV+++  +YI GRIKELIITAGGENI P+PIED +K+ +  IS+ ML+GD +KF+S LLTLK TV+ +T  PT+ L+  A+   + IG ++  + ++   KD  + K I++ I +VNS + S A  +QKW++L +DFS++GGELGPTMK++R  +++MY   + + Y
Sbjct:   85 KATFLEYYHLCRMAAKGFLKLGLEQFHGVAILGFNSAEWFIAAVGTVFAGGIMAGIYTTNSPDACLHVANDSRANVIVVENQKQLDKIMQVKDKLPHLKAIVQYSGSLKEKLA-----NLYSWEEFMELGLEVSDHELDEVISKQRANQCCVLIYTSGTTGSPKGVMLSHDNITWTAHHASRAGDMQPAEIRQESLVSYLPLSHIAAQIYDLWTGIKWGEQISFAQPDALKGTLVDSLREVTPTAHMGVPRVWEKIMEKIKEGISRCGYMKRKMVTWAMSVSLDANQRLK---KDEEKSFLFTLAEKLILQKLRAELGFSSCVKFFSGAAPIGRETLQFFLGLNIRLYEAYGMSETSGPHFMSGPEAYQFLSCGKVVPGCQYKLININADGSGEVCFWGRNVFMGFLNLEDKTKEALDEDGWLRSGDLGKVDEDGFIYINGRIKELIITAGGENIPPLPIEDAVKQELSIISNAMLIGDERKFLSMLLTLKCTVNPETTEPTDILSLEAVEFCQRIGSQSTKLSDITGGKDKLVYKSIEDGIGQVNSKATSNAQRIQKWTILDKDFSVAGGELGPTMKLRRPVVLQMYHNEIENFY 672          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 191.045 bits (484), Expect = 1.936e-51
Identity = 169/580 (29.14%), Postives = 275/580 (47.41%), Query Frame = 3
Query:  390 VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKIL--SILPDVPQLKAIIKYTGDVSA--ELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIF---TVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTV--SVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE------NNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVN-SCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            +GI   N P W I++L       +   +Y T  P+   FI+N  N   ++ +  D+   +L  S     P LK II      SA  E  +K  + + +  +   L + +       R    +P+D +++ +TSGTTG PKG ML+H+N++     V +  E V +    +  IS+LPL+H+      ++ TV   VG  V F Q D     L   +K ++PTVF  VPR+  ++ +++Q  G+K    KK    W  N       A++    +       K L+F K++E+LG  R   + + AAP++   L +  + L   I + YG +ECT   +  I    + G  G  +    +K+ +  E      N  GEIC++G +VF GY  + EKT E++D DGWLH+GD+GK   +  L I  R K +   A GE IAP  IE+      P ++ V + G+         +L+S++ V    P  ++ P     L   G    ++EE+  C++  LKK I   + K+     +     V+   L P  F+I  G L PT+K KR  + + +   + S+Y+
Sbjct:  135 IGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGLDVLSLKDVEALGKNNH-----HRPVPPKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVFVPVPSDVSISFLPLAHM---FERVVQTVLYGVGGRVGFFQGDIR--LLPDDMKALQPTVFPVVPRLLNRVYDKVQS-GAKT-PFKK----WLLNFAIEKKCAEVKQGIIRNDSMWDK-LIFHKVQESLG-GRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYFASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAP-VAQVFVHGE---------SLQSSL-VAIVVPDPEVLPGFAEKLGLKG----SLEEL--CRNQELKKAIISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLYA 679          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 191.045 bits (484), Expect = 1.936e-51
Identity = 169/580 (29.14%), Postives = 275/580 (47.41%), Query Frame = 3
Query:  390 VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKIL--SILPDVPQLKAIIKYTGDVSA--ELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIF---TVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTV--SVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE------NNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVN-SCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            +GI   N P W I++L       +   +Y T  P+   FI+N  N   ++ +  D+   +L  S     P LK II      SA  E  +K  + + +  +   L + +       R    +P+D +++ +TSGTTG PKG ML+H+N++     V +  E V +    +  IS+LPL+H+      ++ TV   VG  V F Q D     L   +K ++PTVF  VPR+  ++ +++Q  G+K    KK    W  N       A++    +       K L+F K++E+LG  R   + + AAP++   L +  + L   I + YG +ECT   +  I    + G  G  +    +K+ +  E      N  GEIC++G +VF GY  + EKT E++D DGWLH+GD+GK   +  L I  R K +   A GE IAP  IE+      P ++ V + G+         +L+S++ V    P  ++ P     L   G    ++EE+  C++  LKK I   + K+     +     V+   L P  F+I  G L PT+K KR  + + +   + S+Y+
Sbjct:  135 IGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGLDVLSLKDVEALGKNNH-----HRPVPPKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVFVPVPSDVSISFLPLAHM---FERVVQTVLYGVGGRVGFFQGDIR--LLPDDMKALQPTVFPVVPRLLNRVYDKVQS-GAKT-PFKK----WLLNFAIEKKCAEVKQGIIRNDSMWDK-LIFHKVQESLG-GRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYFASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAP-VAQVFVHGE---------SLQSSL-VAIVVPDPEVLPGFAEKLGLKG----SLEEL--CRNQELKKAIISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLYA 679          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 315/630 (50.00%), Postives = 427/630 (67.78%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP---FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A+ P  TI    +  VK   D+  L  K   +     ++T EQY E  + AA  F+KLGL+    VGILGFN   WFI+ +G IFAGG   GIYTTN+ + C ++  +C   IIVVEN  QL KIL I   +P LKAII+Y      ELK K   ++YTW EFM L +     +LD+ +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T   A + V+++     +  V+SYLPLSHIAA + DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ +G+K+ TIK+ +A WAK VG   +L K+ G  + K Y +AK LVF K+++ALGLDRC    + AAP+T+ +L++FLSL++P+ ++YG+SE +GPHT+ + D  RI S G ++ G + KI +P+ +  GEI   GRHVF+GY N  +KT+ES+D +GWLHSGD+GK ++N  LYITGRIKELIITAGGENI PVPIED +KE++P IS+ M++GD++KF+S LLTLK  V+ DT  P ++LTP AI   + IG +A  V +++  KD A+   I + +  VN  + S A  VQKW +L +DFSI+GGELGPTMK+KR  + +MY + + S Y
Sbjct:   21 ASLPPVTIHQLFQDTVKKYGDYVALASKQGDQWH---KMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY----KDELKEKRP-NLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGTHILKRYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 642          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 315/630 (50.00%), Postives = 427/630 (67.78%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP---FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A+ P  TI    +  VK   D+  L  K   +     ++T EQY E  + AA  F+KLGL+    VGILGFN   WFI+ +G IFAGG   GIYTTN+ + C ++  +C   IIVVEN  QL KIL I   +P LKAII+Y      ELK K   ++YTW EFM L +     +LD+ +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T   A + V+++     +  V+SYLPLSHIAA + DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ +G+K+ TIK+ +A WAK VG   +L K+ G  + K Y +AK LVF K+++ALGLDRC    + AAP+T+ +L++FLSL++P+ ++YG+SE +GPHT+ + D  RI S G ++ G + KI +P+ +  GEI   GRHVF+GY N  +KT+ES+D +GWLHSGD+GK ++N  LYITGRIKELIITAGGENI PVPIED +KE++P IS+ M++GD++KF+S LLTLK  V+ DT  P ++LTP AI   + IG +A  V +++  KD A+   I + +  VN  + S A  VQKW +L +DFSI+GGELGPTMK+KR  + +MY + + S Y
Sbjct:   22 ASLPPVTIHQLFQDTVKKYGDYVALASKQGDQWH---KMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY----KDELKEKRP-NLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGTHILKRYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 643          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 315/630 (50.00%), Postives = 427/630 (67.78%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP---FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A+ P  TI    +  VK   D+  L  K   +     ++T EQY E  + AA  F+KLGL+    VGILGFN   WFI+ +G IFAGG   GIYTTN+ + C ++  +C   IIVVEN  QL KIL I   +P LKAII+Y      ELK K   ++YTW EFM L +     +LD+ +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T   A + V+++     +  V+SYLPLSHIAA + DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ +G+K+ TIK+ +A WAK VG   +L K+ G  + K Y +AK LVF K+++ALGLDRC    + AAP+T+ +L++FLSL++P+ ++YG+SE +GPHT+ + D  RI S G ++ G + KI +P+ +  GEI   GRHVF+GY N  +KT+ES+D +GWLHSGD+GK ++N  LYITGRIKELIITAGGENI PVPIED +KE++P IS+ M++GD++KF+S LLTLK  V+ DT  P ++LTP AI   + IG +A  V +++  KD A+   I + +  VN  + S A  VQKW +L +DFSI+GGELGPTMK+KR  + +MY + + S Y
Sbjct:   38 ASLPPVTIHQLFQDTVKKYGDYVALASKQGDQWH---KMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY----KDELKEKRP-NLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGTHILKRYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 659          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 315/631 (49.92%), Postives = 426/631 (67.51%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP---FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A+ P  TI    +  VK   D+  L  K   +     ++T EQY E  + AA  F+KLGL+    VGILGFN   WFI+ +G IFAGG   GIYTTN+ + C ++  +C   IIVVEN  QL KIL I   +P LKAII+Y      ELK K   ++YTW EFM L +     +LD+ +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T   A + V+++     +  V+SYLPLSHIAA + DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ +G+K+ TIK+ +A WAK VG   +L K+ G  P    Y +AK LVF K+++ALGLDRC    + AAP+T+ +L++FLSL++P+ ++YG+SE +GPHT+ + D  RI S G ++ G + KI +P+ +  GEI   GRHVF+GY N  +KT+ES+D +GWLHSGD+GK ++N  LYITGRIKELIITAGGENI PVPIED +KE++P IS+ M++GD++KF+S LLTLK  V+ DT  P ++LTP AI   + IG +A  V +++  KD A+   I + +  VN  + S A  VQKW +L +DFSI+GGELGPTMK+KR  + +MY + + S Y
Sbjct:  123 ASLPPVTIHQLFQDTVKKYGDYVALASKQGDQWH---KMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY----KDELKEKRP-NLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGSTPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 745          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 315/631 (49.92%), Postives = 426/631 (67.51%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP---FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A+ P  TI    +  VK   D+  L  K   +     ++T EQY E  + AA  F+KLGL+    VGILGFN   WFI+ +G IFAGG   GIYTTN+ + C ++  +C   IIVVEN  QL KIL I   +P LKAII+Y      ELK K   ++YTW EFM L +     +LD+ +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T   A + V+++     +  V+SYLPLSHIAA + DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ +G+K+ TIK+ +A WAK VG   +L K+ G  P    Y +AK LVF K+++ALGLDRC    + AAP+T+ +L++FLSL++P+ ++YG+SE +GPHT+ + D  RI S G ++ G + KI +P+ +  GEI   GRHVF+GY N  +KT+ES+D +GWLHSGD+GK ++N  LYITGRIKELIITAGGENI PVPIED +KE++P IS+ M++GD++KF+S LLTLK  V+ DT  P ++LTP AI   + IG +A  V +++  KD A+   I + +  VN  + S A  VQKW +L +DFSI+GGELGPTMK+KR  + +MY + + S Y
Sbjct:   64 ASLPPVTIHQLFQDTVKKYGDYVALASKQGDQWH---KMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY----KDELKEKRP-NLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGSTPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 686          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:MGI Symbol;Acc:MGI:3587728])

HSP 1 Score: 530.02 bits (1364), Expect = 3.398e-180
Identity = 273/626 (43.61%), Postives = 412/626 (65.81%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPD-VPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFT---VKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            TIP+  ++  +  S +P L  K+  K  +D  +T  QY E+ +KAA + IKLGL     VGILGFN   W ++ LG I AGG+  GIY TN+ + C++++   N  I++VEND QL KIL I PD +  +KAI++Y   +   +      ++Y+W +FM L       +LDR +   + + CA+++YTSGTTG PKGV+LSHDN+ +T   + + ME  ++   +N+++SYLPLSHIAA L DI   + +G   +FAQPDAL+G+L  TL+EV+PT+F+GVPR++EK+Q+ ++E  +++  ++K    WAK +G + +  ++ GK  +  +Y +AK LVF K++ +LGLD C    S+A+PL+Q   ++FLSLD+PI +IYG+SEC+GPHT+      R+ S G +L G +  +   N+  +GE+C+ GRHVF+GY N  E T E++D +GWLHSGD+G+++ ++ LYITGRIKE++ITAGGEN++P+PIE  +KE+IP IS  MLVGD+ KF+  LLTLK   D  +  P N+L+  A    + +G +A TV ++L+ +D  +   I   I  VN  ++S +  ++KW +L +DFSI GGELGPT K+KR  I + Y   + SMY
Sbjct:   48 TIPELFQESAERFSAYPALASKNGKK--WDT-LTFSQYYEMCRKAAKSLIKLGLQRFQCVGILGFNSVEWVVTALGTILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQLQKILLIPPDKMETVKAIVQYKLPLMESMA-----NLYSWNDFMELGNDIPNIQLDRVILSQKANQCAVILYTSGTTGTPKGVLLSHDNITWTAGAMSQEMEINRVSGKQNTIVSYLPLSHIAAQLTDIWIPIKIGALTFFAQPDALRGTLVYTLQEVKPTLFMGVPRIWEKMQDTIKENVARSSRLRKKAFAWAKMLGLKVNTKRMLGKRDIPMNYRMAKALVFAKVRTSLGLDNCHAFFSSASPLSQDVSEFFLSLDIPIGEIYGMSECSGPHTVSNKSVYRVLSCGKVLSGCKNMLYNQNKEGVGEVCMWGRHVFMGYLNKEEATLEALDENGWLHSGDIGRLDSHDFLYITGRIKEILITAGGENVSPIPIETLVKEKIPIISHAMLVGDKAKFLCMLLTLKCETDRKSGEPLNKLSVEAKSFCQMLGSQATTVSDILKSRDQVVYTAIQYGIDIVNQQAMSDSHRIRKWIILEKDFSIQGGELGPTSKLKRSVITQKYKAQIDSMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:MGI Symbol;Acc:MGI:2385656])

HSP 1 Score: 530.02 bits (1364), Expect = 1.812e-179
Identity = 271/592 (45.78%), Postives = 394/592 (66.55%), Query Frame = 3
Query:  309 VTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPF---KNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            ++  QY  + +K A  F+KLGL+   +V ILGFN P WF S +G +FAGGI+ GIYTT++P+ C++I +DC   +IVV+   QL KIL I  D+P LKA++ Y      E   K   ++YT  E + L Q    + LD  +   QP+ C +L+YTSGTTG PKGVMLS DN+ +T +   +   IQP    +  V+SYLPLSHIAA + D+ T +  G  V FA PDALKG+L  TL+EV PT  +GVPRV+EKI E++QE+ +++G I++ +  WA +V    +L   +      +  LA YLV  ++++ALG  +C      AAP+T ++  +FL L++ +   YGLSE TGPH M      R+ S+G ++ G  +K+   + + IGEIC+ GR +F+GY N  +KT E+IDS+GWLH+GD+G+++ +  LYITGR+KELIITAGGEN+ PVPIE+ +K  +P ISS ML+GD++KF+S LLTLK T+D +T  PT+ LT  A+   + +G +A TV E++  +D A+ + I E I++VN+ + +R  ++QKW++L RDFSISGGELGPTMK+KR+ ++E Y +I+ S Y
Sbjct:  130 ISYYQYYLIARKVAKGFLKLGLERAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYISHDCRANVIVVDTQKQLEKILKIWKDLPHLKAVVIYQ-----EPPPKKMANVYTMEELIELGQEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFADPDALKGTLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSNDLKPFTSRLADYLVLARVRQALGFAKCQKNFYGAAPMTAETQRFFLGLNIRLYAGYGLSESTGPHFMSSPYNYRLYSSGRVVPGCRVKLVNQDADGIGEICLWGRTIFMGYLNMEDKTCEAIDSEGWLHTGDMGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISSAMLIGDQRKFLSMLLTLKCTLDPETSEPTDSLTEQAVEFCQRVGSKASTVSEIVGQRDEAVYQAIHEGIQRVNANAAARPYHIQKWAILQRDFSISGGELGPTMKLKRLTVLEKYKDIIDSFY 716          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg3 (acyl-CoA synthetase bubblegum family member 3 [Source:MGI Symbol;Acc:MGI:1925875])

HSP 1 Score: 375.941 bits (964), Expect = 5.410e-120
Identity = 225/684 (32.89%), Postives = 371/684 (54.24%), Query Frame = 3
Query:  102 NKIGNGVNHSEKSNNFN-AKPVNQFSKITEETA-----------NTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHV--KIQPFKNSV-ISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALK----------GSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYF-LAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            NKI + ++   +++NF    P + +     E             N P  T+PD +       S +  L   S  K  + + +T  +Y E  ++AA  F+K+GL+    VGI+G N   W I+ +G I AGGI  GI ++ +P  C+ I       I VV+ND QL KI  I   +  LKAII+Y  D+      +   ++Y+W  F++L    S ++LD+ +  ++P+ C  L+Y  GTTG  K +MLSHDN+ +T    ++ +  K  P    + +SYLPL      + D+   +SV  TVYF   D+ K          G L + L+EV+PT F G+P V++++ + ++     +   ++ I  WA  +G   +   + G+  +   F LAK L F++ ++ LGL+ C    +    L   +LD+FLS+++PI ++YGLSECTG HT+      RI SAG  L     K+++ N++ IG +CI GRH+F+GY  + + T+  +D+ GWLH+ DLG ++ ++ LY+ G   +LI  + GE + P PIE++++ RIP +   MLVG    ++  LLTLK  ++ +T    + LT   +   + +  ++  + +VL  +D  + +FI++ I+ VNS + +  A + KW +L  DFS+ GGELGP  KM R  +V++Y E +  +Y
Sbjct:   25 NKIHSAISKKAQADNFEILTPGSSYWTSKREGQVQLRMGKDPLDNEPPVTVPDLIMSAATKYSHY--LAIGSKYKKSWQL-LTYIEYYEACRRAAKAFLKVGLERFHGVGIMGINSSEWVIASIGAIMAGGISVGILSSISPKACQVIAETSEMDIFVVDNDRQLQKINQIQGYLKHLKAIIQYREDIQ-----EAQPNLYSWKGFLDLADGISDEKLDKIIDTLKPNQCCALVYNQGTTGPSKAIMLSHDNITWTTAAIVQSLGFKCPPQGQEILVSYLPLCFPGIQILDVWVAISVAGTVYFPSLDSGKWSGLPRTPGTGFLMELLREVQPTTFCGIPWVWDRMLDSLKTKFLDSTAFRRRIDHWAMRMGLHTNKKLMMGEIHQPLCFGLAKRLTFERARKFLGLNHCQQFLNMGMGLPSGTLDFFLSVNIPIMELYGLSECTGLHTVSNLQAYRILSAGKALPKTHTKVEKENKDGIGNLCIWGRHIFMGYLRDKQSTERKVDTHGWLHTNDLGFLDFDKFLYVMGNNNDLIKLSSGEMVNPYPIEERVRTRIPIVRYAMLVGQDAPYLCALLTLKCQINPETGEARSNLTSEVVACCRKLRSQSTWLSDVLYDRDPLVTEFINQGIEDVNSEAPTMGAKIIKWVILDNDFSVDGGELGPMSKMNRSIVVKIYQEEIQKLY 700          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsl5 (acyl-CoA synthetase long-chain family member 5 [Source:MGI Symbol;Acc:MGI:1919129])

HSP 1 Score: 182.185 bits (461), Expect = 3.148e-48
Identity = 161/577 (27.90%), Postives = 281/577 (48.70%), Query Frame = 3
Query:  390 VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPD--VPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADS-ADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVK--IQPFKNSV-ISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGT-IKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE------NNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVN-SCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            VGI   N P W IS+L       +   +Y T   +   F++N  +  +++ +   +   ++  +     P LK II         +K      +    E ++L+ A++   E  ++    +P+D +++ +TSGTTG PKG ML+H+N++  +   ++ ++   QP  + V ISYLPL+H+   L   +   S G  + F Q D     L   +K ++PTVF  VPR+  ++ +++Q   ++A T +KK++     N+   +   ++    + +     K LVF KI+ +LG  +   + + AAP++   L +F  ++   + + YG +ECTG  ++        G  GT +    +K+++  +      NN GEICI+G +VF GY  + EKT+E +D DGWLH+GD+G+   N  L I  R K +   A GE IAP  IE+      P +         Q FV         + V    P +  + AA      IG++  + EE+  CK+  +K+ I E ++K+     +     V+   + P  F+I  G L PT+K KR+ + + +   + S+Y
Sbjct:  135 VGIFAQNRPEWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADIPVVICDTPQKATMLVENVEKGLTPGLKTIILMDPFDDDLMKRGEKCGV----EMLSLHDAENIGKENFKKPVPPKPEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLEPIFQPTSDDVTISYLPLAHMFERLVQGIL-FSCGGKIGFFQGDIR--LLPDDMKALKPTVFPTVPRLLNRVYDKVQ---NEAKTPLKKFLL----NLAIISKFNEVKNGIIRRDSLWDK-LVFSKIQGSLG-GKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTGGCSITSPGDWTAGHVGTPVACNFVKLEDVADMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIVDRKKNIFKLAQGEYIAPEKIENVYSRSRPVL---------QVFVHGESLRSFLIGVVVPDPDSLPSFAA-----KIGVKG-SFEEL--CKNQCVKEAILEDLQKIGKEGGLKSFEQVKSIFVHPEPFTIENGLLTPTLKAKRVELAKFFQTQIKSLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsl1 (acyl-CoA synthetase long-chain family member 1 [Source:MGI Symbol;Acc:MGI:102797])

HSP 1 Score: 171.4 bits (433), Expect = 1.846e-44
Identity = 164/640 (25.62%), Postives = 291/640 (45.47%), Query Frame = 3
Query:  210 ETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLD--VKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPD--VPQLKAII---KYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVK---KAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNI------GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
             T+ D  ++ ++ +++ P L  +  P   Y+  ++ ++  EL +   S  I+ G     +  +G+   N P W I + G      ++  +Y T   D   +I+N     +I  +  ++   +L  + +   P LK I+    Y  D+  E   K  + I +     +L + +       +    +P+D A++ +TSGTTG PKG M++H N+I       KA E   I    + +IS+LPL+H+   + + +     G  + F Q D     L   LK ++PT+F  VPR+  ++ +++   G    ++K+    W  +   +   A++    V  +    K L+F KI+ +LG  +   + + AAP++   L +   +L     + YG +ECT    + +      G  G  +    +K+ +  E N       GE+C++G +VF GY  +  +T E++D DGWLH+GD+GK   N  L I  R K +   A GE IAP  IE+ I  R   ++ V + G+    +   L      DV++     Q      R L+       + EE+   KDI  K  +D+ +K      +     V+  ++ P  FSI  G L PT+K KR  +   +   +  +Y+
Sbjct:   91 RTMYDGFQRGIQVSNNGPCLGSRK-PNQPYEW-ISYKEVAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPEWVIVEQGCFSYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDL-VERGKKCGVEIISLKALEDLGRVNRV-----KPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSGFIKATESAFIASTDDVLISFLPLAHMFETVVECVMLCH-GAKIGFFQGDIR--LLMDDLKVLQPTIFPVVPRLLNRMFDRI--FGQANTSLKR----WLLDFASKRKEAELRSGIVRNNSLWDK-LIFHKIQSSLG-GKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTECTAGCCLSLPGDWTAGHVGAPMPCNYVKLVDVEEMNYLASKGEGEVCVKGANVFKGYLKDPARTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIEN-IYLRSEAVAQVFVHGES---LQAFLIAVVVPDVESLPSWAQK-----RGLQG------SFEELCRNKDIN-KAILDDLLKLGKEAGLKPFEQVKGIAVHPELFSIDNGLLTPTLKAKRPELRNYFRSQIDELYA 695          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q7ZYC4|ACBG2_XENLA (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis OX=8355 GN=acsbg2 PE=2 SV=1)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 313/633 (49.45%), Postives = 425/633 (67.14%), Query Frame = 3
Query:  189 ETANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP---FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            + A+ P  TI    ++ V    D+  L  K   +     +++ +QY E  + AA  FIKLGL+    VGILGFN   WFI+ +G IFAGG   GIYTTN+ + C ++  +C   IIVVEN  QL KIL +   +P LKAII+Y      ELK K   ++YTW EFM L +     +LD+ +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T   A + V+++     +  V+SYLPLSHIAA + DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ +G+K+ TIK+ +A WAK VG   +L K+ G  P    Y +A  LVF K+++ALGLDRC    + AAP+T+ +L++FLSL++P+ ++YG+SE +GPHT+ + D  RI S G ++ G + KI +P+ +  GEI   GRHVF+GY N  +KT ES+D +GWLHSGD+GK ++N  LYITGRIKELIITAGGENI PVP ED +KE++P IS+ ML+GD++KF+S LLTLK  V+ DT  P ++LTP AI+  + IG +A  V +++  KD A+   I E +  VN  S S A  VQKW +L +DFSI+GGELGPTMK+KR  + +MY + + S Y
Sbjct:  101 DVASLPPVTIHQLFQETVNKYGDYVALASKQGDQWH---KMSYKQYYEQCRIAAKGFIKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQVQDQLPHLKAIIQY----KDELKEKRP-NLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAAAAGKTVRLREATDLQEIVVSYLPLSHIAAQMIDIWLTMKYGGATYFAQPDALKGSLAITLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKMATWAKGVGLETNLKKMNGSTPHPMKYHVANKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDSDGSGEILFWGRHVFMGYLNMEDKTHESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPTEDAVKEQVPIISNAMLIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIQFCRQIGSKATLVSDIVGGKDTAVYAAIQEGVNSVNEKSTSNAQKVQKWLILEKDFSITGGELGPTMKLKRPVVAKMYKDQIDSFY 725          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q5ZKR7|ACBG2_CHICK (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus OX=9031 GN=ACSBG2 PE=2 SV=2)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 301/670 (44.93%), Postives = 438/670 (65.37%), Query Frame = 3
Query:   96 NLNKIGNGVNHSEKSNNFNAKPVNQFS-KITEET--ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQ-LNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQ-PDDCALLIYTSGTTGFPKGVMLSHDNMIFT---VKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKP-VEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
             +NK G   +    SN +  +   +   ++ EE   +  PK T+ +  ++ V    D+  L  K   KNG  +++T + Y +   KAA +F+KL L+    V ILGFN P WFI+ +G IFAGG+  GIYTTN+P+ C ++  +C+  I+VVEN  Q   K L I   +P +KAII+Y      ELK K   + Y+W EF++L + D  D   R + E Q P+ C  LIYTSGTTG PKGVMLSHDN+ +T     +++  ++    +  V+SYLPLSH+AA + DI   V+ G  V+FAQPDALKG+L  TL+EVRPT F+GVPRV+EKI+E+M+ +G+K+ T+++ +A WAK VG + +L  + G   V  ++ LA+ LV+ K+++A+GLDRC    + AAP+++++L++FLSL++P+ ++YG+SE +GPHT+ I    R+ S G  + G    I +P+ + IGEIC  GRH+F+GY N  EKTKE+ID DGWLHSGDLGK + +  +YITGRIKELIITAGGEN+ PVPIED +KE  P IS+ MLVGD+ KF++ LLTLK  ++ ++  P + LT  AI   + +G +A  V E++  KD A+   I  A+ +VN  +VS A  +QKW +L +DFS+ GGELGPTMK+KR  + + Y +++   Y+
Sbjct:   61 QMNKTGLASSSRPASNVWTTQQDGEVKLRMDEEGMGSEAPK-TVHEVFQEAVSKYGDYYALASK---KNGQWVKLTYKMYYDKCWKAAKSFLKLVLERFHGVCILGFNSPEWFIADIGAIFAGGLAVGIYTTNSPEACHYVAENCSANILVVENHTQACRKSLEIEHKLPHMKAIIQY----GEELKEKRP-NQYSWREFLDLGE-DIPDSQLREIIESQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTSIAAGRSLMLLEATEKQELVVSYLPLSHVAAQMIDIWLPVTFGGQVFFAQPDALKGTLVDTLREVRPTAFLGVPRVWEKIEEKMKSVGAKSSTLRRKVASWAKGVGLQTNLKWMNGHSEVPMNFRLARQLVYKKVRKAIGLDRCTKCFTGAAPISRETLEFFLSLNIPVFELYGMSESSGPHTVSIPQAFRLTSCGKEMAGCRTLIHKPDADGIGEICFAGRHIFMGYLNMEEKTKEAIDKDGWLHSGDLGKCDKDGFIYITGRIKELIITAGGENVPPVPIEDAVKEACPIISNAMLVGDKAKFLAMLLTLKCIINTESGEPGDDLTAEAIEYCQKLGSKATKVSEIISSKDKAVYAAIQAAVSEVNKRAVSNAQKIQKWVVLEKDFSVGGGELGPTMKLKRPVVAQKYKDLIDEFYA 720          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|A1L1K7|ACBG2_RAT (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus OX=10116 GN=Acsbg2 PE=2 SV=1)

HSP 1 Score: 532.332 bits (1370), Expect = 2.850e-180
Identity = 280/627 (44.66%), Postives = 415/627 (66.19%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPD-VPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFT---VKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            TIP+  ++ V+    +P L  K+  K  +D  +T  QY ++ +KAA + IKLGL     VGILGFN   W ++ LG I AGG+  GIY TN+ + C++++   N  +++VEND QL KILSI PD +  +KAI++Y   +      + S ++Y+W +FM L  A    +LDR +   + + CA++IYTSGTTG PKGVMLSHDN+ +T   + + +E + +   +++++SYLPLSHIAA L DI   + VGV  +FAQPDAL+G+L  TL+EV+PT F+GVPRV+EK+Q+ ++E  +K+  ++K    WAK +G + +  K+ GK  +  +Y +AK LVF K++ +LGLD C    S A+PL+Q   ++FLSLD+PI +IYG++EC+GPHT+      R+ S G +L G +  + + N++ +GE+C+ GRHVF+GY    + T E +D DGWLHSGD+G+++ ++ LYITGRIKE++ITAGGENI P+PIE  +KE+IP IS  MLVGD+ KF+S LLTLK   D  +  P ++L   AI   + +G +A TV ++L+ +D  +   I   I  VN  +VS +  ++KW +L +DFSI GGELGPT K+KR  I + Y   + +MYS
Sbjct:   48 TIPELFQESVERFGAYPALASKNGKK--WDT-LTFSQYYDVCRKAARSLIKLGLQRFHGVGILGFNSVEWVVAALGAILAGGLCVGIYATNSAEACQYVIKQANVNVLIVENDQQLQKILSIPPDKMETVKAIVQYRLPL-----MENSTNLYSWQDFMELGNAIPNIQLDRVILSQKANQCAVIIYTSGTTGSPKGVMLSHDNITWTAGAMAREIELIHVSGKQDTIVSYLPLSHIAAQLMDIWIPIKVGVLTFFAQPDALRGTLVYTLQEVKPTYFLGVPRVWEKMQDTIKENVAKSSNLRKKAFAWAKMLGLKVNTKKMLGKRDIPMNYRMAKALVFTKVRTSLGLDNCHTFFSGASPLSQDVSEFFLSLDIPIGEIYGMTECSGPHTVSCKSIYRVLSCGKVLNGCKNMLYKQNKDGVGEVCMWGRHVFMGYLGKEDATLEVLDEDGWLHSGDIGRLDSHDFLYITGRIKEVLITAGGENIWPIPIETLVKEKIPIISHAMLVGDKAKFLSMLLTLKCETDQMSGEPLDKLNLEAISFCQMLGSQAVTVSDILKIRDPVVYTAIQYGIDIVNQQAVSDSHRIRKWIILEKDFSIQGGELGPTSKLKRDLITQKYKAQIDNMYS 666          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q924N5|ACBG1_RAT (Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus OX=10116 GN=Acsbg1 PE=1 SV=1)

HSP 1 Score: 533.102 bits (1372), Expect = 9.993e-180
Identity = 272/592 (45.95%), Postives = 395/592 (66.72%), Query Frame = 3
Query:  309 VTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPF---KNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            ++  QY  + +K A  F+KLGL+   +V ILGFN P WF S +G +FAGGI+ GIYTT++P+ C++I +DC   +IVV+   QL KIL I  D+P LKA++ Y      E   K   ++YT  E + L Q    + LD  +   QP+ C +L+YTSGTTG PKGVMLS DN+ +T +   +   IQP    +  V+SYLPLSHIAA + D+ T +  G  V FA PDALKG+L  TL+EV PT  +GVPRV+EKI E++QE+ +++G I++ +  WA +V    +L   +      +  LA YLV  ++++ALG  +C      AAP+T ++  +FL L++ +   YGLSE TGPH M      R+ S+G ++ G  +K+   + + IGEIC+ GR +F+GY N  +KT E+IDS+GWLH+GD+G+++D+  LYITGR+KELIITAGGEN+ PVPIE+ +K  +P ISS ML+GD++KF+S LLTLK T++ +T  PT+ LT  A+   + +G +A TV E++  KD A+ + I E I++VN+ + +R  ++QKW++L RDFSISGGELGPTMK+KR+ ++E Y +I+ S Y
Sbjct:  130 ISYYQYYLIARKVAKGFLKLGLERAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIAHDCRANVIVVDTQKQLEKILKIWKDLPHLKAVVIYQ-----EPPPKKMANVYTMEELIELGQEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFADPDALKGTLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSNDLKPFTSRLADYLVLARVRQALGFAKCQKNFYGAAPMTAETQRFFLGLNIRLYAGYGLSESTGPHFMSSPYNYRLYSSGRVVPGCRVKLVNQDADGIGEICLWGRTIFMGYLNMEDKTHEAIDSEGWLHTGDMGRLDDDGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISSAMLIGDQRKFLSMLLTLKCTLNPETSEPTDNLTEQAVEFCQRVGSKASTVSEIVGQKDEAVYQAIHEGIQRVNANAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKDIIDSFY 716          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q2XU92|ACBG2_MOUSE (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus OX=10090 GN=Acsbg2 PE=1 SV=1)

HSP 1 Score: 530.02 bits (1364), Expect = 2.377e-179
Identity = 273/626 (43.61%), Postives = 412/626 (65.81%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPD-VPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFT---VKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            TIP+  ++  +  S +P L  K+  K  +D  +T  QY E+ +KAA + IKLGL     VGILGFN   W ++ LG I AGG+  GIY TN+ + C++++   N  I++VEND QL KIL I PD +  +KAI++Y   +   +      ++Y+W +FM L       +LDR +   + + CA+++YTSGTTG PKGV+LSHDN+ +T   + + ME  ++   +N+++SYLPLSHIAA L DI   + +G   +FAQPDAL+G+L  TL+EV+PT+F+GVPR++EK+Q+ ++E  +++  ++K    WAK +G + +  ++ GK  +  +Y +AK LVF K++ +LGLD C    S+A+PL+Q   ++FLSLD+PI +IYG+SEC+GPHT+      R+ S G +L G +  +   N+  +GE+C+ GRHVF+GY N  E T E++D +GWLHSGD+G+++ ++ LYITGRIKE++ITAGGEN++P+PIE  +KE+IP IS  MLVGD+ KF+  LLTLK   D  +  P N+L+  A    + +G +A TV ++L+ +D  +   I   I  VN  ++S +  ++KW +L +DFSI GGELGPT K+KR  I + Y   + SMY
Sbjct:   48 TIPELFQESAERFSAYPALASKNGKK--WDT-LTFSQYYEMCRKAAKSLIKLGLQRFQCVGILGFNSVEWVVTALGTILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQLQKILLIPPDKMETVKAIVQYKLPLMESMA-----NLYSWNDFMELGNDIPNIQLDRVILSQKANQCAVILYTSGTTGTPKGVLLSHDNITWTAGAMSQEMEINRVSGKQNTIVSYLPLSHIAAQLTDIWIPIKIGALTFFAQPDALRGTLVYTLQEVKPTLFMGVPRIWEKMQDTIKENVARSSRLRKKAFAWAKMLGLKVNTKRMLGKRDIPMNYRMAKALVFAKVRTSLGLDNCHAFFSSASPLSQDVSEFFLSLDIPIGEIYGMSECSGPHTVSNKSVYRVLSCGKVLSGCKNMLYNQNKEGVGEVCMWGRHVFMGYLNKEEATLEALDENGWLHSGDIGRLDSHDFLYITGRIKEILITAGGENVSPIPIETLVKEKIPIISHAMLVGDKAKFLCMLLTLKCETDRKSGEPLNKLSVEAKSFCQMLGSQATTVSDILKSRDQVVYTAIQYGIDIVNQQAMSDSHRIRKWIILEKDFSIQGGELGPTSKLKRSVITQKYKAQIDSMY 665          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A2D0PP32 (long-chain-fatty-acid--CoA ligase ACSBG2-like OS=Ictalurus punctatus OX=7998 GN=LOC108255920 PE=4 SV=1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 316/651 (48.54%), Postives = 430/651 (66.05%), Query Frame = 3
Query:  159 PVNQFSKITEETA-----------NTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKP-VEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            P  QF   T + A           + P  TI    +  V   SD P L  K D   G  + +T +QY    + AA +F+KLGL+    VGILGFN P WFI+ +G I AGG+  GIYTTN+P+ C ++   C   ++VVEND QL KIL +   +P LKAI++Y G+V  ++      ++YTW EFM + +  S D+LD  ++  + ++C  LIYTSGTTG PKGVMLSHDN+ +    +   V +   ++SV+SYLPLSH+AA +ND+   +    T YFAQPDALKGSL  TL+EV PT F+GVPRV+EK+QE M++IGSK+  +KK IA WAK +G + S   +   P V   + LA  +VF  ++  LGLDRC    + AAP+T+ +L+YF+SL++PI ++YG+SE TGPHTM  +D   I S G ++ G + K+D+P+ +  GE+C  GRHVF+GY N  +KTKE++DS+GWLHSGDLGK + NE LYITGRIKELIITAGGENI PVPIED +KE +P IS+ MLVGD++KF+S +LTLK  VD D   PT++LTP A+   +  G+ A  V E++  K+ A+ K I E + +VN+ + S A  VQKW+LL +DFSISGGELGPTMK+KR  + +MY E +   Y
Sbjct:  120 PAEQFWCTTRDEAVKLRMSESGPGSEPPLTIHQMFQWTVDNFSDHPALCSKED---GAWVTLTYKQYQHQCRAAAKSFLKLGLERFHGVGILGFNSPEWFIADIGCIMAGGLAVGIYTTNSPEACHYVAYSCEANVLVVENDKQLAKILQVKDQLPHLKAIVQYKGEVKNKMP-----NLYTWAEFMKVGEEVSDDDLDAVINSQKANECCTLIYTSGTTGNPKGVMLSHDNITWIANASGSVVNLTKGEDSVVSYLPLSHVAAQVNDMWLCIRFAATTYFAQPDALKGSLATTLREVHPTSFLGVPRVWEKMQEAMKDIGSKSSFMKKKIADWAKGIGLQASYNTMNNNPSVPWGFMLANSIVFKTVRAGLGLDRCKLCLTGAAPITKDTLEYFMSLNIPIYEVYGMSESTGPHTMSSSDNFHIMSCGKVIPGCKTKLDKPDADGSGEVCFWGRHVFMGYLNMPDKTKEALDSEGWLHSGDLGKHDTNEFLYITGRIKELIITAGGENIPPVPIEDAVKEEVPIISNAMLVGDKKKFLSMILTLKCKVD-DNGDPTDELTPMAVEFCRQHGVMASKVSEIISNKEPAIYKVIQEGVDRVNAKAPSNAQRVQKWTLLSKDFSISGGELGPTMKLKRPVVSKMYKEEIDKFY 761          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A5N5KDU1 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00140750 PE=4 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 318/652 (48.77%), Postives = 437/652 (67.02%), Query Frame = 3
Query:  159 PVNQFSKITEETA------------NTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            P  Q+  IT + A             TP  TI    +  V    D P L  K   K+G  +++T ++Y +  + AA +F+KLGL+    VGILGFN P WFI+ +G I AGG+  GIYTTN+P+ C ++  +C   ++VVEND QL KIL +   +P LKAI++Y G    E+KTK S ++YTW EFM + +  S  ELD  +     ++C  LIYTSGTTG PKGVMLSHDN+++T   A + + +   + S++SYLPLSH+AA +NDI   +    T YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE M++IG+K+  +KK IA WAK VG + S   +     V   + LA  +VF +++ ALG+DRC +  + AAP+T+ +L+YF+SL++PI ++YG+SE TGPHTM  +D   I S G ++ G + K+D+P+ +  GE+C  GRHVF+GY N  +KTKE++DS+GWLHSGDLGK + N+ LYITGRIKELIITAGGENI PVPIED +KE +P IS+ MLVGD++KF+S LLTLK   D D   PT++LTP A+   +  G+ A  V E++  K+ A+ K I E + +VN+ + S A  VQKW+LL +DFSI+GGELGPTMK+KR  + +MY E +   Y
Sbjct:  126 PAEQYWSITRDKAVKLRMSESGPGSETPL-TIHQVFQWTVDNFGDHPALCSK---KDGVWVKLTYKEYQQQCRAAAKSFLKLGLERFHGVGILGFNSPEWFIADVGCIMAGGLAVGIYTTNSPEACHYVAYNCEANVLVVENDKQLAKILQVKDQLPHLKAIVQYKG----EVKTKMS-NVYTWAEFMKVGKDISDAELDAVIDSQSANECCTLIYTSGTTGNPKGVMLSHDNVMWTANAAGKVIGLNMGEESIVSYLPLSHVAAQVNDIWICIKFAGTTYFAQPDALKGSLATTLREVRPTSFLGVPRVWEKMQEAMKDIGAKSSLMKKKIADWAKGVGLQASYNAMNNNTSVPWGFTLANSIVFKRVRAALGMDRCKHCFTGAAPITKDTLEYFMSLNIPIYELYGMSESTGPHTMSWSDSFCIMSCGKVIPGCKTKLDKPDADGNGEVCFWGRHVFMGYLNMADKTKEALDSEGWLHSGDLGKHDMNDFLYITGRIKELIITAGGENIPPVPIEDAVKEELPIISNAMLVGDKKKFLSMLLTLKCKAD-DNGDPTDELTPLAVEFCRQHGVMASKVSEIISNKEPAIYKLIQEGVDRVNAKATSNAQKVQKWTLLSQDFSINGGELGPTMKLKRPVVSKMYKEDIDKFY 767          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A1L8HNF6 (AMP-binding domain-containing protein OS=Xenopus laevis OX=8355 GN=acsbg2 PE=4 SV=1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 316/631 (50.08%), Postives = 428/631 (67.83%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP---FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A+ P  TI    ++ V    D+  L  K   +     ++T +QY E  +KAA  FIKLGL+    VGILGFN   WFI+ +G IFAGG   GIYTTN+ + C ++  +C   IIVVEN  QL KIL +   +P LKAII+Y      ELK K   ++YTW EFM L +     +LD+ +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T   A + V+++     + +V+SYLPLSHIAA + DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ +G+K+ TIK+ +A WAK VG   +L K+ G  P    Y +AK LVF K+++ALGLDRC    + AAP+T+ +L++FLSL++P+ ++YG+SE +GPHT+ + D  RI S G ++ G + KI +P+ +  GEI   GRHVF+GY N  +KT ES+D +GWLHSGD+GK ++N  LYITGRIKELIITAGGENI PVP ED +KE++P IS+VML+GD++KF+S LLTLK  V+ DT  P ++LTP AI   + IG +A  V +++  KD+A+   I E +  +N  S S A  VQKW +L +DFSI+GGELGPTMK+KR  + +MY + + S Y
Sbjct:  101 ASLPPVTIHQLFQESVNKYGDYLALASKQGDQWH---KLTYKQYYEQCRKAAKGFIKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQVQDQLPHLKAIIQY----KDELKEKRP-NLYTWNEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAAAAGKTVRLREATDMQETVVSYLPLSHIAAQMIDIWLTMKYGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGSAPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDSDGSGEILFWGRHVFMGYLNMEDKTYESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPTEDALKEQVPIISNVMLIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIGFCRQIGSKATLVSDIVGGKDMAVYAAIQEGVNSINQKSTSNAQKVQKWLILEKDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 723          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: H3DDR2 (AMP-binding domain-containing protein OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 308/621 (49.60%), Postives = 430/621 (69.24%), Query Frame = 3
Query:  219 PDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYF-LAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            PD   + +++  D P L YK +   G  +++T  QY +  + AA +F+KLGL+    VGILGFN P WFIS +G I AGG+  GIYTTN+P+ C+++  +C   I+VVEN  QL+KIL +   +P LKAI++Y G +  +L       +YTW EF+ L +  S + L+  +  +Q ++C  LIYTSGTTG PKGVMLSHDN+ +TV+ A+  V + P +  VISYLPLSH AA + D+   +S  VT YFA+PDALKGSLG TLKEVRPT F+GVPR++EK+QE+M+ +G+KA  ++K IA WAK +G   + + + G+ V    F LA  LVF K++ ALGLDRC    + AAP+T+ +L+YF+SL++P+ +IYG+SE +GPHT+   ++ RI S G ++ G + K+D P+E+  GEIC  GRHVF+GY N  EKT E+ID +GWLHSGDLGK +     YITGRI+ELIITAGGENI PVPIED +K  +P IS+ ML+GD+ KF+S LLTLK  V+ D+  PT++L+P A+   + +G+ A  V E++  K+ A+   I E I +VN+ + S A  VQK+++L RDFSI GGELGPTMK++R  +V+MY E ++ MYS
Sbjct:    5 PDWFLETLESYGDHPALAYKEE---GQWVKLTYRQYYQQCRAAAKSFLKLGLERYHGVGILGFNAPEWFISDIGCILAGGLATGIYTTNSPEACQYVAANCEANILVVENQTQLDKILKVKDQLPHLKAIVQYKGPLKQKLPF-----LYTWAEFIRLGEDVSEERLNAVIDSLQANECCSLIYTSGTTGNPKGVMLSHDNVTWTVQSALSTVNLTPAEEVVISYLPLSHAAAQMFDMWLGISFAVTTYFAEPDALKGSLGTTLKEVRPTCFLGVPRIWEKMQEKMKAVGAKASPMRKGIANWAKAIGLEYNYSAMNGENVVPWGFGLANSLVFKKVRAALGLDRCKMCFTGAAPITKDTLEYFMSLNIPVMEIYGMSESSGPHTVSRNEEYRITSCGKVMPGCKTKLDNPDEDGNGEICFWGRHVFMGYLNMPEKTAEAIDQEGWLHSGDLGKHDQLNFTYITGRIQELIITAGGENIPPVPIEDALKAEVPIISNAMLIGDKLKFLSMLLTLKCVVN-DSGEPTDKLSPEALDVCRQLGVTATKVSEIIANKEPAIYNSIQEGIVRVNARATSNAQKVQKFTILERDFSIGGGELGPTMKLRRPIVVKMYQEKINEMYS 616          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A5G3K219 (AMP-binding domain-containing protein OS=Xenopus tropicalis OX=8364 GN=acsbg2 PE=4 SV=1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 315/630 (50.00%), Postives = 427/630 (67.78%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP---FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            A+ P  TI    +  VK   D+  L  K   +     ++T EQY E  + AA  F+KLGL+    VGILGFN   WFI+ +G IFAGG   GIYTTN+ + C ++  +C   IIVVEN  QL KIL I   +P LKAII+Y      ELK K   ++YTW EFM L +     +LD+ +S  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T   A + V+++     +  V+SYLPLSHIAA + DI  T+  G   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ +G+K+ TIK+ +A WAK VG   +L K+ G  + K Y +AK LVF K+++ALGLDRC    + AAP+T+ +L++FLSL++P+ ++YG+SE +GPHT+ + D  RI S G ++ G + KI +P+ +  GEI   GRHVF+GY N  +KT+ES+D +GWLHSGD+GK ++N  LYITGRIKELIITAGGENI PVPIED +KE++P IS+ M++GD++KF+S LLTLK  V+ DT  P ++LTP AI   + IG +A  V +++  KD A+   I + +  VN  + S A  VQKW +L +DFSI+GGELGPTMK+KR  + +MY + + S Y
Sbjct:   38 ASLPPVTIHQLFQDTVKKYGDYVALASKQGDQWH---KMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY----KDELKEKRP-NLYTWKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGTHILKRYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFY 659          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: ENSAMXT00000016625.2 (long-chain-fatty-acid--CoA ligase ACSBG2-like [Source:NCBI gene;Acc:103043523])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 295/622 (47.43%), Postives = 424/622 (68.17%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            TI    +  V    D P L++K   +NG    +T +QY +  + AA +F+KLGL+    VGILGFN P WFIS +  I AGG+  GIYTTN+ + C+++ ++C   +IVVEN+ QL KIL +   +P LKAI++Y G++  ++      ++YTW +FM L    + D+LD  ++    ++C  LIYTSGTTG PKGVMLSHDN+ +    +   +  +  + S++SYLPLSH+AA +ND+  ++    T +FA+PDALKGSL  TL++VRPT F+GVPRV+EK+QE MQ IG+K   +KK IA WAK +G + +   + G   V   + LA  L+F +++ ALGLDRC    + AAP+T+++L+YF+SL++ + ++YG+SE TGPHT+   +  RI S G +++G + K+D+P+E+  GE+C  GRHVF+GY N  EKT E++D++GWLHSGDLGK++ N+ +YITGRIKELIITAGGEN+ PVPIED +KE +  IS+ MLVGD++KF++ LLTLK  VD D   PT++LTP A+   +  G+ A  V E++  K+ A+ K I E +  +N  + S A  VQKW+LLPRDFSISGGELGPTMK+KR  + +MY + +   Y
Sbjct:  153 TIHQMFQDTVNKYGDHPALRWK---ENGAWTTLTYKQYYQHCRTAAKSFLKLGLERFHGVGILGFNSPEWFISNVACIMAGGLTTGIYTTNSAEACQYVAHNCEANVIVVENNKQLVKILQVKDQLPHLKAIVQYKGELERKIP-----NLYTWADFMKLGTDIADDQLDDLINSQNANECCSLIYTSGTTGNPKGVMLSHDNITWIANASGMMIGTKMKEESLVSYLPLSHVAAQVNDLWVSMKFAGTTHFAEPDALKGSLANTLRDVRPTSFLGVPRVWEKMQEAMQSIGAKNSAMKKRIADWAKGIGLQTNYNLMNGDTSVPWGFMLANNLIFKRVRAALGLDRCRTCFTGAAPITKETLEYFMSLNIQLYELYGMSESTGPHTLSWENNFRIMSCGKVIRGCKTKLDKPDEDGNGEVCFWGRHVFMGYLNMPEKTDEALDTEGWLHSGDLGKLDQNDFMYITGRIKELIITAGGENVPPVPIEDALKEEVSIISNAMLVGDKKKFLAMLLTLKCKVD-DNGDPTDELTPLAVEYCQQRGVTATKVSEIINNKEPAIYKAIQEGVNIINEKATSNAQRVQKWTLLPRDFSISGGELGPTMKLKRPVVSKMYKDDIDKFY 765          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:103045839])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 307/629 (48.81%), Postives = 427/629 (67.89%), Query Frame = 3
Query:  213 TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNS---VISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKI---TGKPVEKS--YFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            T+    +K VK   ++  L +K   +     +++ ++Y +    AA +F+KLGL+    VGILGFN P WFIS +G IFAGG   GIYTTN+P+ C+++  +C   I+VVEN  QL KIL I   +P LKAII+Y       LK K   ++YTW EF+ L + +   +L+  +   +P+ C  LIYTSGTTG PKGVMLSHDN+ +T      +V +     S   VISYLPLSHIAA + DI  T+ VG   YFAQPDALKGSL  TL+EVRPT F+GVPRV+EK+QE+M+ IG+K+ T+++ +A WAK+VG   +L+K+    G     S  Y LAK LVF K+++ALGLDRC    + AAP+T+++L++FLSLD+P+ ++YG+SE TGPHT+ + +  R+ S G ++ G + K+  P+    GEIC  GRHVF+GY N  EKT E++D+DGWLHSGDLGK + ++ L+ITGRIKELIITAGGENI PVPIED +KE +P IS+ ML+GD++KF+S LLT+KS V+ +T  P ++LTP A+   + +G  A  V EV   +D  ++  I E I KVN  + S A  +QK+++L +DFSI+GGELGPTMK+KR  +++MY E + + Y
Sbjct:  118 TVHQAFEKAVKRFGNYTALGWKEGEQWK---KISYKEYFDTCLIAAKSFLKLGLERCHGVGILGFNSPEWFISDIGAIFAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY----KDALKEKRP-NLYTWEEFLELGRNEPDTKLNDIIDSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAFATARNVNLDYADQSQEEVISYLPLSHIAAQMIDIWITMQVGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLHTNLSKMEQQNGSMARASLNYRLAKRLVFRKVRKALGLDRCRLCFTGAAPITKETLEFFLSLDLPVYELYGMSESTGPHTISLPNAFRLTSCGKVIPGCQTKLFSPDAEGNGEICFWGRHVFMGYLNMTEKTAEALDADGWLHSGDLGKHDKDDFLFITGRIKELIITAGGENIPPVPIEDAVKEVVPLISNAMLIGDKRKFLSMLLTIKSEVNAETGAPEDELTPEAVEFCRKLGSNATRVSEVAGGRDHLVQAAIQEGINKVNKKATSNAQRIQKFTVLEQDFSITGGELGPTMKLKRPVVMKMYKEQIENFY 738          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:NCBI gene;Acc:103040425])

HSP 1 Score: 496.123 bits (1276), Expect = 1.518e-166
Identity = 263/623 (42.22%), Postives = 392/623 (62.92%), Query Frame = 3
Query:  222 DCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPF---KNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLA--KYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            +C+KK  K     P L  K++ K      ++  QY +  +  A +F+KLGL+   +V ILG N   WF S +G +FAGG   GIY+TN+P+ C  I +D    IIVV+++ QL+KIL I  ++P LKAI++ +G +  +L      ++Y+W +FM L Q    + LD  +   +P+ C +LIYTSGTTG PKGVMLSHDN+ +T   A     +QP    + +++SYLPLSHIAA + D+ T +  G  VYFA+PDALKG+L  TLKE  P+  +GVPRV+EK+ E+++   S+A  +K+ +  WA +V    +L    GK  EK +       LV +K++  LG   C    S AAP+   +  +FL L++ + + YG+SE +GPH M      ++ S G ++ G   KI   +    GE+C+ GR++F+GY N  +KT E+ D DGWL SGDLGK++++  L+ITGR+KELIITAGGEN+ PVPIED +KE +P +S  ML+GD++KF+S LLT+K   ++DT  PT+ L+P A++  + +G +A  V ++   KD  +   I E I +VN+ + S A  +QKW++L +DFS+SGGELGPTMK++R A ++MY   + + Y
Sbjct:   90 NCVKKYGK----LPALATKTEDKL---TTISFCQYYDRCRMTAKSFLKLGLERFHSVAILGSNSEEWFFSAVGAVFAGGFATGIYSTNSPEACHHIASDSRANIIVVDSNWQLDKILLIKDNLPHLKAIVQISGCLKKKLP-----NLYSWEQFMQLGQDIPDETLDGIIKSQKPNQCCVLIYTSGTTGLPKGVMLSHDNITWTACHASRAGDMQPAEIKQETIVSYLPLSHIAAQIYDMWTGIQWGEMVYFARPDALKGTLVHTLKEATPSSHMGVPRVWEKMMEKIKHELSRAAYLKRKLVNWAMSVTLDANLT--YGKDEEKPFLFGVVNSLVIEKLRAELGFSNCEKFFSGAAPIGWDTYKFFLGLNIHLYEAYGMSESSGPHFMSGPQTYKMKSCGKVVPGCRCKIANEDAGGSGEVCLWGRNIFMGYLNMKDKTVEAFDEDGWLCSGDLGKLDEDGFLFITGRLKELIITAGGENVPPVPIEDAVKEELPIVSHAMLIGDKRKFLSMLLTVKCVFNLDTMEPTDDLSPEAVKFCQRLGSQATKVSDITGGKDKLVNHAIQEGIARVNARATSNAQRIQKWTILGKDFSVSGGELGPTMKLRRAAALKMYHNEIEAFY 698          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsl2 (long-chain-fatty-acid--CoA ligase 6 [Source:NCBI gene;Acc:103038184])

HSP 1 Score: 186.808 bits (473), Expect = 8.745e-50
Identity = 182/645 (28.22%), Postives = 303/645 (46.98%), Query Frame = 3
Query:  210 ETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGL--DVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQ-----LNKILSILPDVPQLKAIIKYTGDVSAELKTK---YSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNM---IFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKI-DEPNENNI-----GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDR-QKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVN-SCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            +T+ +  ++ ++   D P L ++  P   Y   +   +  E  Q   S  +  G   + K  VGI   N P W I++L        +  +Y T   +    I+N     +++ + +++     LNK   +    P L  ++ +   VSA L  +     + I   +E M+L + +    +  +     P D A++ +TSGTTG PKG M++H N+     +V K +E   +   ++  ISYLPL+H+   +  + +    G  V F Q D     L   +K ++PT F  VPR+  +I +++  I S    +K+ I  +A     R   A+++   V  + F  K LV +KI+  LG     ++ +A+AP++   L +   +L   I + YG +ECT   T  +      G  G  L    +K+ D P+ N       GEICI+G  VF GY N+ E+T E++DSDGWLH+GD+G+ + N  L I  R K +   + GE IAP  IE+     +P +  V + GD  Q F+  ++     V V+                KD GI   + EE+  C++  +KK + E +  V     +     V+   L    FSIS G L PT+K +R+ +  ++SE ++ MYS
Sbjct:  106 KTVYEVFQRGLRIAGDRPCLGFRK-PGEPYQW-IPYTEVAERAQVLGSGLLAKGCKPNPKQFVGIFAQNRPEWVIAELACYTFSMAVVPLYDTLGLEAMVHILNLAEISLVICDKEEKAESLLLNKEKGV---TPALSCLVLFN-PVSAALVERGKACGVEIMHLSEIMDLGRENLKTPVPPK-----PQDLAVVCFTSGTTGKPKGAMITHGNIASNTSSVIKILEGFFVIRQEDVSISYLPLAHMFERMIQV-SMFCHGARVGFYQGDI--SLLMDDIKTLKPTFFPVVPRLLNRIYDKI--ISSVTSPLKRAILHYAV----RRKQAELSCGIVRNNSFWDK-LVLNKIQANLG-GNVRFILTASAPISPTVLSFLRATLGCLIFEGYGQTECTAGCTFSMPGDWTAGHVGAPLPCARVKLTDIPDMNYYASSGEGEICIQGPSVFQGYLNDKERTDEALDSDGWLHTGDVGQWQPNGTLQIIDRKKNIFKLSQGEYIAPEKIENVYSRCVPVL-QVFVHGDSLQSFLIGIVVPDPEVFVNWN--------------KDRGI-VGSYEEL--CQNPDVKKAVLEDMTAVGKKAGLKSFEQVKDVYLHSELFSISNGLLTPTLKSRRVDLRRVFSEQINQMYS 710          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:103039859])

HSP 1 Score: 182.57 bits (462), Expect = 1.825e-48
Identity = 164/585 (28.03%), Postives = 276/585 (47.18%), Query Frame = 3
Query:  390 VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPD--VPQLKAII------KYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVK--IQPFKNSV-ISYLPLSHIAANLNDIMTTV--SVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGT-IKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE------NNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVN-SCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            +GI   N P W IS+L       +   +Y T  P+   FI+N  +   ++ +  ++   +L       +P L  II         GD +++             E +NL   +       R    +P+D +++ +TSGTTG PKG ML+H+N++      ++  +    P    V IS+LPL+H+      ++ TV    G  V F Q D     L   +K ++PTVF  VPR+  ++ +++Q   S A T  KK++  +A    H    A++    +       K+ +F K++E+LG  R   + + AAP++   L +  + L   I + YG +ECT   T+ +      G  G  +    +K+ +  E      N+ GE+CI+G++VF GY N+ E+T E++D DGWLH+GD+GK   +  L I  R K +   A GE IAP  IE+ +  R   ++ V + GD         +L+S++ V    P  ++ P     L   G    ++EE+  CK+  +KK I   + K+     +     V+   L    F+I  G L PT+K KR  + + +   + S+Y+
Sbjct:  135 IGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEALIFIINRGSISTVICDKQNKAETLLDSCEKKLIPVLNTIIIMDPFDAAVGDRASKCGV----------EILNLKDVEVHSNSIYRFPP-KPEDLSIVCFTSGTTGDPKGAMLTHENVVADAASFVKSFESAFTPLPTDVTISFLPLAHM---FERVVQTVLYGAGGRVGFFQGDIR--LLPDDMKTLKPTVFPVVPRLLNRVYDRVQ---SGAQTPFKKWLLNFAIERKH----AEVKEGIIRNDSIWDKF-IFHKVQESLG-GRVRVMVTGAAPISPSVLSFLRACLGCQIFEAYGQTECTAGCTISLPGDWTAGHVGVPVPCNVVKLVDVEEMNYFASNDEGEVCIKGKNVFRGYLNDPERTAEALDQDGWLHTGDIGKWLSSGVLKIIDRKKNIFKLAQGEYIAPEKIEN-VYIRSALVAQVFVHGD---------SLQSSL-VAIVVPDPEVLPGYAEKLSLKG----SMEEL--CKNQQIKKAIITDLTKLGREAGLKSFEQVKDLYLHADQFTIENGLLTPTLKAKRPELCKYFKTQIDSLYA 677          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 307/633 (48.50%), Postives = 418/633 (66.03%), Query Frame = 3
Query:  195 ANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQP----FKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEK--SYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            ++TP ETI    ++ VK   D   L  K    N + I +T ++Y    ++AA +F+KLGL     VGILGFN   WFIS +G I AGG   GIYTTN+ + C+++ ++C   IIVVEND QL KIL +   +P LKAI++Y G    ELK K   ++Y+W EFM   +     +LD  ++  + + C  LIYTSGTTG PKGVMLSHDN+ +T     E  +++     ++  VISYLPLSHIAA L DI   +  G   YFAQPDALKGSL  T+KEVRPT F+GVPRV+EK+ E+M+   +K+G  K+ IAGWAK+VG +  LA + G P E    Y LA  LVF K++EALGLDRC    + AAP+T+ +L++FLSLD+P+ ++YG+SE +GPHT+      +IGS GT+L+G    +   +E   GE+C  GRHVF+GY N  EKT+E+ID DGWLHSGDLG+V++   LYITGRIKELIITAGGEN+ P+PIED IKE +P +S+ M++GDR+KF+S LLTLK   + D+  P + LT   +   + +G  A    ++   KD  +++ I + I++VN  + S A  VQKW LL RDFSI GGELGPTMK+KR  + ++Y E++  +Y
Sbjct:   77 SDTP-ETINQLFERTVKLYGDHKALASKEG--NTWKI-LTYKEYYAQCRQAAKSFLKLGLQRYHGVGILGFNSAEWFISDIGAILAGGFAVGIYTTNSAEACQYVADNCLANIIVVENDKQLQKILEVQSQLPHLKAIVQYKG----ELKEKKP-NVYSWAEFMRAGEEVPDAQLDAIIASQRANQCCSLIYTSGTTGSPKGVMLSHDNLTWTATVTGELTQLRSADDNYQEVVISYLPLSHIAAQLVDIWLPMRFGGVTYFAQPDALKGSLVVTMKEVRPTGFMGVPRVWEKMMEKMKATAAKSGIFKRKIAGWAKSVGLQTHLANMKGNPAEAPMGYTLANMLVFKKVREALGLDRCTKCYTGAAPITRDTLEFFLSLDIPVFELYGMSESSGPHTISSPTAFQIGSCGTLLRGCRTLLHSKDEEGSGEVCFWGRHVFMGYLNMEEKTREAIDDDGWLHSGDLGRVDEQGLLYITGRIKELIITAGGENVPPIPIEDAIKEELPVVSNAMVIGDRRKFLSVLLTLKCESNGDSGEPDDALTDEVVHWCQRVGSTATRASQIAGGKDPVVERAIRDGIERVNKRAPSNAQRVQKWELLLRDFSIPGGELGPTMKLKRPVVTKIYQELIERLY 700          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 176.407 bits (446), Expect = 5.309e-47
Identity = 179/702 (25.50%), Postives = 319/702 (45.44%), Query Frame = 3
Query:   51 SFFIITQTIYIMTDCNLNKIGNGVNHSEKSNNFNAKPVNQ-FSKITEETANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGL--DVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQ-----LKAII---KYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMI--FTVKKAMEHVKIQPFKNSV-ISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNI------GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTL----KSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLEC-KDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            ++++ T+   +   C+L+K    V   E        P +  F     E A T  E      ++ ++ +++ P L Y+  P + Y+  ++ ++  +  +   S F+ LG     +  +GI   N P W I++        ++  +Y T   +   +I+N     ++V    D+L K+  +L  + +     +K I+    + G V  +   K  I +  + E   + + +  + +       QPDD A++ YTSGTTG PKG ML+H NMI  F+   A+      P  + V IS+LPL+H+   L +  + +  G  V F Q D     L   +K ++PTVF  VPR+  +I +++   G+K+     +   W         +A++    V K     K L+F +++ ++G  R  ++ + AAP++   L +  + L   + + +G +ECT   T  +      G  G  +    +K+ +  E N       GE+C+ G +VF GY  +  +T E++D DGWLH+GD+GK   N  L I  R K +   + GE IAP  IE       P ++ V + GD  +  SCL+ +       +    Q+   +  P ++   KD  + A  + +++   K+  LK F  E ++ V+              L    FSI  G L PT K+KR  + + +   + S+Y+
Sbjct:   42 AYWLATRPRALSAPCDLSKQSLPVKGREYQRRSPLVPDDDTFFTYFYEDARTGYEV----FQRGLRISNNGPCLGYRK-PNHPYEW-ISYKETSDRAEYLGSGFLHLGAKPSSEQVIGIFSQNRPEWIIAEQACYTYSLVVVPLYDTLGRESIDYIINQAEISMVVC---DKLEKVKGLLESIEEGAIRIVKTIVVMDPFDG-VMEQRARKCGIDLILFRELEVIGKTNHREPIPP-----QPDDIAIICYTSGTTGNPKGAMLTHKNMISDFSAFLAITKDTFLPNTDDVLISFLPLAHMFERLVE-ASILCNGGRVGFYQGDIRL--LMDDMKVLQPTVFPVVPRLLNRIHDKVLS-GAKS-----HFKRWLLEFAVSRKIAELRCGVVRKDSIWDK-LIFHRVQASMG-GRVRFMVTGAAPISASILTFLRAILGCQVYEGFGQTECTAGCTFTMPSDSTAGHVGPPMPCNHIKVVDVAEMNYFAANGEGEVCVYGTNVFKGYLKDPTRTAEALDEDGWLHTGDIGKWLPNGTLKIVDRKKHIFKLSQGEYIAPEKIETVYVRSEP-VAQVFVHGDSLQ--SCLVCIVVPDMEVLPSWVQKRGIKCNPNSVFINKD--VRAAILHDMVRLGKEAGLKSF--EQVRAVH--------------LHSDLFSIENGLLTPTFKVKRAEVCKFFHSEIDSLYA 696          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 163.696 bits (413), Expect = 3.344e-44
Identity = 131/456 (28.73%), Postives = 227/456 (49.78%), Query Frame = 3
Query:  741 QPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVK---KAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE------NNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCS-VSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            +P+D A++ +TSGTTG PKG ML+H N++  +    K  E + +    +  ISYLPL+H+   L    T    G ++ F Q D     L   ++ +RPTVF  VPR+  ++ +++  +GS     ++ +       G R  +A++  + V +   L  +LVF  ++ ++G  R   + + AAP++   L++  + +   + + YG +ECT   T+ +    + G  G  +    +K+ +  +         GE+C++G +VF GY  + EKT E++D DGWLH+GD+G+   N  L I  R K +   A GE IAP  IE+ +  R   ++ V + GD     +CL+ +          P  ++    IR    +G    T  E+  C++  +++ I E ++++   S +     V+   L    FSI  G L PT K KR  +   +  ++SSMY
Sbjct:   17 KPEDLAIVCFTSGTTGNPKGAMLTHRNIVSDMSGFLKVTESLFLPETSDIAISYLPLAHMFERLVQA-TLFCHGASIGFFQGDVR--LLLDDMQALRPTVFPVVPRILNRMYDKV--LGSTRTPFRRKLL----EFGARRKMAELQ-RGVVRRNSLWDWLVFRPMQLSVG-GRVRMIMTGAAPISPGVLNFLRVVMGCQMYEGYGQTECTAGCTLTLPGDWKAGHVGAPMPCNYIKLHDVKDMEYYTSQGKGEVCVKGPNVFKGYLKDAEKTAEAVDRDGWLHTGDIGQWMPNGTLKIIDRKKHIFKLAQGEYIAPEKIEN-VYSRCEPVAQVYVHGD--SLQACLVAVVV--------PDPEILCCWIRKKGIVG----TYSEL--CRNKEVRQAILEDMQRLGKESDLQPFEQVKDVHLHNEMFSIENGLLTPTFKAKRTELRTHFRSVISSMY 444          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: acsl3b (acyl-CoA synthetase long chain family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-492])

HSP 1 Score: 87.0409 bits (214), Expect = 4.747e-19
Identity = 80/306 (26.14%), Postives = 133/306 (43.46%), Query Frame = 3
Query:  573 SILPDVPQLKAIIKYTGDVS--AELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDAL--------KGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEN 1457
            +IL  VP+L+ ++   G  S  A +K    I +   ++   L   D      R      P D A+++YTSG+TG PKGV ++H N++  +      +      ++ I YLPL+H+   L   M  +S G  + ++    L        KGS G  +  +RPT+   VP + E+I + +         +++ I   A N      L +    P      L   LVF+K+   LG +  + L S AAPL+ ++  +  +    P+ Q YGL+E     T+        G  G  L   E+++    E 
Sbjct:    2 AILMQVPRLRYVVLVDGTASGVAGVKLPRGIEVMGMSDVEEL--GDKPQHRQRARDRPGPRDLAVVMYTSGSTGIPKGVRIAHSNLVAAITGMYLRINDICGDDTYIGYLPLAHV-LELGAEMVCLSRGCRIGYSSAQTLTDQSTRIKKGSQGD-VTILRPTLMAAVPEIMERIYKGVMGKVQCMSLLQRIIFKLAYNY-KLEQLERGFDTP------LCNRLVFNKLCALLGGNVRLLL-SGAAPLSPRTQRFMNVCFCCPVGQGYGLTETCAAGTIAELQDYSTGHVGAPLSCCEIQLRNWEEG 295          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA2 (Medium chain fatty acyl-CoA synthetase; activates imported fatty acids; accepts a wide range of fatty acid chain lengths with a preference for medium chains, C9:0-C13:0; localized to the peroxisome; comparative analysis suggests that a mitochondrially targeted form may result from translation starting at a non-canonical codon upstream of the annotated start codon [Source:SGD;Acc:S000000817])

HSP 1 Score: 160.229 bits (404), Expect = 1.365e-41
Identity = 145/590 (24.58%), Postives = 271/590 (45.93%), Query Frame = 3
Query:  390 VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELK----TKYSISIYTWTE---FMNLNQADSADELDRRLS-EIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSV----ISYLPLSHIAANLNDIMTTVSVGVTV-YFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEK--SYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTI-------LKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQ----KWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            V IL  N+P W ++ L           +Y T  P+  ++I+N     I++    +  + +L ++PD+  +  ++        EL+    +   +   +  E   F +L Q +     ++  +    PD    + +TSGTTG PKGV +SH N+   +  A    +I P K +     + +LPL+HI   +  I   +++G  + +  +PD     L + LK ++P     VPR+  + +  ++    K+ T+++ +A    +       A+  G P +   ++ +   ++ DKI+++LGL    ++ + +AP+++ +L +  S LD+ I Q YGL+E      +    +  +GS G I       LK V       +++  GE+ IRG  VF  Y+ N  +T +++D DGW  +GD+  ++    + +  R+K     A GE IAP  IE+      P+I+ + + GD  K     L     VDVD  +P        I + K   ++  T E ++E  +   KK   E + K+N C+     + +    K  L P   ++    + PT K+KR    + + + +  +Y+
Sbjct:  166 VAILSHNNPEWILTDLACQAYSLTNTALYETLGPNTSEYILNLTEAPILIFAKSNMYH-VLKMVPDMKFVNTLVCMDELTHDELRMLNESLLPVKCNSLNEKITFFSLEQVEQVGCFNKIPAIPPTPDSLYTISFTSGTTGLPKGVEMSHRNIASGIAFAFSTFRIPPDKRNQQLYDMCFLPLAHIFERMV-IAYDLAIGFGIGFLHKPDPT--VLVEDLKILKPYAVALVPRILTRFEAGIKNALDKS-TVQRNVANTILDSKSARFTAR--GGPDKSIMNFLVYHRVLIDKIRDSLGLSNNSFIITGSAPISKDTLLFLRSALDIGIRQGYGLTETFAGVCLSEPFEKDVGSCGAIGISAECRLKSVPEMGYHADKDLKGELQIRGPQVFERYFKNPNETSKAVDQDGWFSTGDVAFIDGKGRISVIDRVKNFFKLAHGEYIAPEKIENIYLSSCPYITQIFVFGDPLK---TFLVGIVGVDVDAAQP--------ILAAKHPEVKTWTKEVLVENLNRN-KKLRKEFLNKINKCTDGLQGFEKLHNIKVGLEP--LTLEDDVVTPTFKIKRAKASKFFKDTLDQLYA 734          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA1 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; accounts for most acyl-CoA synthetase activity; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms ER foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000005844])

HSP 1 Score: 134.035 bits (336), Expect = 4.809e-33
Identity = 108/373 (28.95%), Postives = 185/373 (49.60%), Query Frame = 3
Query:  657 ISIYTWTEFMNLNQADSADELDRRLSEIQP---DDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHV-KIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKT----LKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE------NNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQK 1733
            I  +++ + + L + +S +E+D     + P   DD   ++YTSG+TG PKGV+L H N++  V  A  +V K     + VI +LPL+HI   + ++++    G  + +A    L  S  +     L+E +PT+ +GV  V+E +++ +         + K I   A N         I G     +      LVF KI+ A G  +  YL +  +P+++ + ++  +L  P+   YGL+E     T+       +G AG +   V +K+ +  E      NN GE+ I G +V   YY N E+T +++ SDGW  +GD+G+ E N HL I  R K L+ T  GE IA   +E   +    +++++ +  D+ K
Sbjct:  235 IKTFSFDDILKLGK-ESCNEID-----VHPPGKDDLCCIMYTSGSTGEPKGVVLKHSNVVAGVGGASLNVLKFVGNTDRVICFLPLAHIFELVFELLS-FYWGACIGYATVKTLTSSSVRNCQGDLQEFKPTIMVGVAAVWETVRKGILNQIDNLPFLTKKIFWTAYNTKLNMQRLHIPGGGALGN------LVFKKIRTATG-GQLRYLLNGGSPISRDAQEFITNLICPMLIGYGLTETCASTTILDPANFELGVAGDLTGCVTVKLVDVEELGYFAKNNQGEVWITGANVTPEYYKNEEETSQALTSDGWFKTGDIGEWEANGHLKIIDRKKNLVKTMNGEYIALEKLESVYRSN-EYVANICVYADQSK 592          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA4 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; role in stationary phase survival; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms cytoplasmic foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000004860])

HSP 1 Score: 108.997 bits (271), Expect = 4.490e-25
Identity = 98/377 (25.99%), Postives = 175/377 (46.42%), Query Frame = 3
Query:  657 ISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHV--KIQPFKNSVISYLPLSHI--------AANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKY--IAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE------NNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQK 1733
            I IY++ E + + +  + DE++      +P+D A ++YTSG+TG PKGV+L+H N++  +     +V   I P  + +I++LPL+HI        A   N I+   +V        P + +   G  L E +PTV +GV  V+E +++         G + K   + GW++ +       K    P      L   L+F +I+EA G     ++ +  + ++  +  +  +L  P+   YGL+E      +   +    G AG ++  +  K+ +  +      NN GE+  +G  +   YY N E+T  +   DGW  +GD+ +      + I  R K L+ T  GE IA   +E  I    P++ ++ +  D  K
Sbjct:  235 IKIYSFDEIIEIGK-KAKDEVELHFP--KPEDPACIMYTSGSTGTPKGVVLTHYNIVAGIGGVGHNVIGWIGP-TDRIIAFLPLAHIFELTFEFEAFYWNGILGYANVKTLT----PTSTRNCQGD-LMEFKPTVMVGVAAVWETVRK---------GILAKINELPGWSQTLFWTVYALKERNIPCSG---LLSGLIFKRIREATG-GNLRFILNGGSAISIDAQKFLSNLLCPMLIGYGLTEGVANACVLEPEHFDYGIAGDLVGTITAKLVDVEDLGYFAKNNQGELLFKGAPICSEYYKNPEETAAAFTDDGWFRTGDIAEWTPKGQVKIIDRKKNLVKTLNGEYIALEKLES-IYRSNPYVQNICVYADENK 588          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA3 (Long chain fatty acyl-CoA synthetase; activates imported fatty acids with a preference for C16:0-C18:0 chain lengths; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery [Source:SGD;Acc:S000001271])

HSP 1 Score: 101.679 bits (252), Expect = 8.063e-23
Identity = 105/383 (27.42%), Postives = 171/383 (44.65%), Query Frame = 3
Query:  552 DQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHV-KIQPFKNSVISYLPLSHI--------AANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE------NNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIA 1655
            D +NKI  + PD                       I IY++ E + + +  S DE+  +L   +P D A ++YTSG+   PKGV+L+H N++  +     +V       + V+S+LPL+HI        A   N I+   SV  T+        KG L     E +PT+ IGV  V+E +++ + E  S    + + I  W        S   +  K V  + FL++ +VF K+++A G     Y+ +  + ++  +  +F  +  P+   YGL+E      +   D    G  G ++  V  K+ +  +      NN GE+ ++G  V   YY N  +T  S   DGW  +GD+ +      L I  R K L+ T  GE IA
Sbjct:  223 DAINKIREVRPD-----------------------IKIYSFEEVVKIGK-KSKDEV--KLHPPEPKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNVFGWIGSTDRVLSFLPLAHIFELVFEFEAFYWNGILGYGSVK-TLTNTSTRNCKGDL----VEFKPTIMIGVAAVWETVRKAILEKISDLTPVLQKIF-W--------SAYSMKEKSVPCTGFLSR-MVFKKVRQATG-GHLKYIMNGGSAISIDAQKFFSIVLCPMIIGYGLTETVANACVLEPDHFEYGIVGDLVGSVTAKLVDVKDLGYYAKNNQGELLLKGAPVCSEYYKNPIETAVSFTYDGWFRTGDIVEWTPKGQLKIIDRRKNLVKTLNGEYIA 563          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: PCS60 (Oxalyl-CoA synthetase; capable of catalyzing conversion of oxalate to oxalyl-CoA; catalyzes first step in pathway of oxalate degradation that functions to protect yeast from inhibitory effects of oxalate; peroxisomal protein that binds mRNA; localizes to both peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid; similar to E. coli long chain acyl-CoA synthetase [Source:SGD;Acc:S000000426])

HSP 1 Score: 77.0258 bits (188), Expect = 3.567e-15
Identity = 87/332 (26.20%), Postives = 139/332 (41.87%), Query Frame = 3
Query:  750 DCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITD----KIRIGSAGTILKGVEMKIDEPNEN-----NIGEICIRGRHVFLGYYNNMEKTKESI-DSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIE------DKIKERIPF 1697
            D AL+++TSGTT  PK V L H N++ +        K+ P   S +  +PL H+   +  +++T     +V    PD                     P++F    +Q            KY   W   V   + +     KP             +       +  C   +SA AP T   L+     + P+ + Y ++E +  H M   +    K + G+ G   +GV + I + N+N      +GE+ IRG +V LGY NN +  KE+    + +  +GD G  +    L +TGRIKEL I  GGE I+P+ ++       KI E + F
Sbjct:  190 DVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTYKLTPLDRSYV-VMPLFHVHGLIGVLLSTFRTQGSV--VVPDGFH------------------PKLF---WDQFV----------KYNCNWFSCVPTISMIMLNMPKP-------------NPFPHIRFIRSC---SSALAPATFHKLEK--EFNAPVLEAYAMTEAS--HQMTSNNLPPGKRKPGTVGQP-QGVTVVILDDNDNVLPPGKVGEVSIRGENVTLGYANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKEL-INRGGEKISPIELDGIMLSHPKIDEAVAF 465          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO32054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW65])

HSP 1 Score: 511.916 bits (1317), Expect = 3.543e-175
Identity = 250/514 (48.64%), Postives = 356/514 (69.26%), Query Frame = 3
Query:  474 YTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKE--LIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELG 2009
            YTTN+P+ C F+ ++CN  +IVVEN  QL+KIL +   +P LKA+++YTG+V  + +     ++Y W +F+ L +  +   L  R+S++  + C  LIYTSGTTG PKGVM+SHDN+ +T + A+ HV+    +  ++SYLPLSH+AA + DI  ++    TV+FAQPDALKGSL  TL+E RPT+F+GVPRV+EKI E+M E+G+     K+ IA WAK    + ++    G+     + +A   +  KIK +LGLDRC     AAAP+T ++L YF S+++P+ ++YG+SEC+GP T+ I   +  GS G  ++G EMKID+P+E+  GE+C+RGR+VF+G+ NN EKTKE++D DGWLHSGD+ K++D     ++ RI E  LIITAGGENIAPVPIED IK+ +P IS+ +L+GD++KF+SCLLTLK  V+ DT  PT++LT AAI   K +G EA TV E+L+ KD  + K I   + + N  ++SRA  VQKW +L  DF+I GGELG
Sbjct:   52 YTTNSPEACHFVADNCNANVIVVENKAQLSKILKVWDRLPHLKAVVQYTGEVEGKHE-----NVYNWNQFLELGKTVADRVLQERMSQLVANRCCTLIYTSGTTGAPKGVMISHDNITWTAQAALNHVQAGKREEHIVSYLPLSHVAAQMTDIYMSMYCCGTVWFAQPDALKGSLVNTLRECRPTLFLGVPRVWEKIMEKMLEVGATVTGPKRRIADWAKGKALQGNMNIEQGRSTPFGWTIATG-ILKKIKVSLGLDRCWGQFVAAAPVTMETLRYFQSINIPLYELYGMSECSGPLTISIPGHVLSGSCGIKMEGTEMKIDKPDEDGNGELCMRGRNVFMGFLNNEEKTKEALDVDGWLHSGDVCKIDD-----VSIRIAEGQLIITAGGENIAPVPIEDNIKKEVPLISNAILIGDKRKFLSCLLTLKVEVEADTGAPTDRLTKAAIAFCKSVGSEATTVSEILKTKDENVMKAIQAGVDRANEEAISRAQKVQKWCILENDFTIHGGELG 554          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO45461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR3])

HSP 1 Score: 189.889 bits (481), Expect = 2.266e-51
Identity = 178/666 (26.73%), Postives = 302/666 (45.35%), Query Frame = 3
Query:  132 EKSNNFNAKPVNQFSKITEETANTPKE---TIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGL--DVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRR----LSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSL--DMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPNENNI-----GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQK-FVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            E+S   +  PV + S ++E    T  +   T  +  ++  +   D P L  + D K G    ++  +  E      S  + LG     +  VGI   N   W ++ L       +   IY T+ PD C FI+N  + + IV  N  ++  IL  +  +P LK II+    V  E +    +S      F        A+E+ R+    ++  +P+D   + YTSGTTG PKG + +H N+I  V   +         +   SYLPL+H A     ++  +  G  + F + D     L + ++E++PT F  VPR+  K+ +++      A   +     W    G     A +  K V +S  +   +VF K++   G  R   + S AAPL+ + + +F     D  I + YG +ECT   ++ +   ++ G  G  L    +K +D P ++       GE+CI+G +V   Y+ N EKT E++D DGWLH+GD+G   +N  L I  R K++   A GE +AP  +E+ I +R PF++   + G+  K FV  +L     V          L   A +  K+I  + KT+ E    K+   +   ++ ++      +     V+   L P  FS+    +  T K+KR  I++ + +++ S+Y
Sbjct:   32 EQSVAIDGDPVVRRSALSEHLMATYYDDVTTAYEGFQRGCRIAGDLPCLGKRGD-KIGMYRWLSYNEVRERAHSFGSALVHLGCHPSQRTFVGIQAKNCVEWVLTDLACQMFSMVSVPIYDTHGPDACLFIINHADVETIVC-NHTKVPFILKNIKRIPHLKCIIQIGELVKEEERKDAKVSGIELLSF------SIAEEIGRKNIKVVNPPKPNDIFTICYTSGTTGTPKGAVQTHSNVIADVSGVIRQYNTCGI-DVHFSYLPLAH-AYERTGVICMLQSGCRIGFYRGDP--QLLFEDIQELKPTFFASVPRIMNKVYDKVM-----AQVSESKFKSWMFQKGLHAKKADMN-KNVFRSNTIWDKVVFKKVQMLFG-GRVRAITSGAAPLSPKVMTFFRCAMGDCRIMEGYGQTECTACASLQLPQDMQAGIVGPPLTCNYIKLVDVPEKSYSTKDLKGEVCIKGPNVIPRYHKNPEKTAETLDEDGWLHTGDIGMWLENGALKIIDRKKDIFKLAQGEYVAPGKLEN-IAQRSPFVAQAFVHGESLKTFVVAILVPDGEV----------LKKWAAQ--KNIQGDLKTLCE----KEEVRQAVFEDVVRVCKEAELFSFEQVKAVHLHPEAFSVENDLMTATFKIKRPQIIKAFHDVIESLY 661          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO46335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC0])

HSP 1 Score: 182.956 bits (463), Expect = 3.064e-49
Identity = 176/634 (27.76%), Postives = 285/634 (44.95%), Query Frame = 3
Query:  243 KTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLG---LDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVK---IQPFKNSV-ISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKT---LKEVRPTVFIGVPRVFEKIQEQ-MQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPNENNI-----GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLE--CKDIALKKFIDEAI----KKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            + + D P L ++      Y+  +T  + L       S   +LG   ++    +G+   N   W + +        +I  +Y T  PD C FI+N     ++V +   ++  +L      P LK IIK   DV++E K +   +      F ++     A   +++L   +PDD A++ YTSGTTG PKG M++H N +  +      +K   I+   + V ISYLPL+H+   L  +M  +  G   +F       G++ K    L+E++PTVFI VPRV  ++ ++ M+EI S   +IKK++     N       A++    V K+  +  YLVF+KI+   G                                YG +E T   T+ +      G  G  +   ++K +D P+ N       GEIC  G +VF GY ++ EKT+E+ID DGWLHSGD+G+  +N  L +  R K +   A GE IAP  IE  +  + P +  V + GD +K  SC++ +    +   ++ T                E   V+  +E  C +  ++K I E +    KK    S  +   V+   L P  F++  G L PT+K KR  I   + +    +Y
Sbjct:   88 RISGDKPCLGHRVTEGGPYEW-LTYNEVLNRASNVGSGLQELGSNDVEGDTFIGVYASNKIEWVLIEQACAMHAKVITPLYDTLGPDACAFIINQAKMSMVVCDAA-KIPLLLQRADQCPTLKFIIKINPDVTSEEKQEGERNGIKIISFSDVEAMGKAHPYEKKLP--KPDDLAVVCYTSGTTGNPKGAMITHSNAVAMLAGLCVMIKKCGIRVDNDDVHISYLPLAHMYERLAQLMIFMYGGKVGFFG------GNIRKIMEDLQELKPTVFISVPRVLNRVYDKVMKEISS--SSIKKFVF----NTALSFKKAEVERNIVRKNS-IWDYLVFNKIQVLEG--------------------------------YGQTETTAAATIQLVGDHTFGHVGPPMPCTKIKLVDVPDMNYFAKDGKGEICFYGPNVFKGYLHDPEKTREAIDEDGWLHSGDVGEWTENGTLKLIDRKKHIFKLAQGEYIAPEKIE-AVYMQCPLVHQVFVYGDSRK--SCIVGVVVPEETALKKWT----------------EKNEVQGDMEALCNNEKVRKAILEEMSAMGKKEKLFSFQQ---VKDIYLHPDPFTVDNGLLTPTLKFKRPVIQAHFKDTFEKLY 650          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO45504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR2])

HSP 1 Score: 176.792 bits (447), Expect = 2.960e-47
Identity = 169/606 (27.89%), Postives = 278/606 (45.87%), Query Frame = 3
Query:  336 IQKAASNF----IKLGLD--VKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTG--DVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMI-------FTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDI-MTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKY--IAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPN-----ENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFID-EAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            I + ASNF     +LG D   +  VG+   N   W ++ L       +   IY ++  + C +I+N      IV  +  ++N +L     +P LK+II  +G  +V  +      I I ++ E   +   +  +++  R     P+D   + +TSGTTGFPKGV+L+HDN+I       F +K+  E +  Q   ++ +SYLP  H+      + M      + +Y  + + L        K +RPTVF  VPR+   I +       K   +++Y   AG       R  + K T         +   LVF KI++ +G +  I +   +APL+ +   +    +   +N+ YG +E T   TM        G  G  +    +K +D P       NN GEICIRGR+VF GY ++ E+T+E+ DS GW +SGD+G+   +  L I  R K +   + GE IAP  I++    R  F++ V + G+         +LKS +          L P A     DI  + K +     C++  ++K I  + I K     ++    V+   L P  F++  G L PT+K KR A+ + + E ++ +Y
Sbjct:   57 IHERASNFGSGLCELGCDPSQETFVGLWSTNCTEWLLADLACQMFSMVTVPIYDSHGSEACTYIINKAKLSTIVC-HKKKVNFLLEHAHLLPTLKSIIVISGAGEVRRDKSDILGIRIISFDEVEKIGINNPHEKVPAR-----PEDTFTISWTSGTTGFPKGVILTHDNIISDMSAYLFLIKQDGEELTPQ---DTHLSYLPPEHMYERCTQVLMMMAGAKIGLYHGKREFLMDDF----KALRPTVFAAVPRLLNAIYD-------KVVPLRRYSLFAGNTFFFHARRIIRKDT---------IWDRLVFKKIQDLIGGNVRI-ITCGSAPLSARVTSFIRCVMGCYLNEGYGSTETTAMVTMQRLKDFNTGHVGAPVPCATVKLVDVPEMDYYASNNQGEICIRGRNVFKGYLHDAERTEEAFDSSGWFYSGDIGEWTQDGTLRIIDRKKHIFKLSQGEYIAPAKIQNAYL-RSMFVAQVFVHGN---------SLKSFIVAVVVPDAEVLIPWA--KTHDIEGDIKQL-----CQNQTVRKAIHGDMIAKGKEAKLNSLEQVKGIYLHPELFTVEEGLLTPTLKTKRPALAQFFEEKLNVLY 615          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO46361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQG4])

HSP 1 Score: 162.155 bits (409), Expect = 1.238e-42
Identity = 143/482 (29.67%), Postives = 235/482 (48.76%), Query Frame = 3
Query:  690 LNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKK---AMEHVKIQPF--KNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTL---KEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAG-----TILKGVEM-KIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGK--VEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRS-LKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCS-VSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            ++ +D +     R+   + DD   + YTSGTTG PKG ML+HDN+I  +      ++ V I+ F   +  +S+LPLSH+   +N I+  ++ G   +F       G + K L   K +RPTVF  VPR+  +I +++    +K+  IK++I   A N   R+   KI  +       +  YL+F+KI+  LG  R  ++ S +APL+ +   +    +   + + YG +E     T+ + D    G  G      ++K V++ ++D    N  GEIC++GR+VF GY +N   T E +D D WL++GD+G+        LY   R    I    GE IAP  IE+ I  R PF++ + + GD     S    L + V  D +          IR  LK +            C++  + + I E++ KV   S ++    V+   L    FSI  G L PT+K+KR  +   + +I+ ++Y+
Sbjct:   92 ISSSDRSAAARLRIKPPKSDDLYTVCYTSGTTGTPKGAMLTHDNVISDLSAFLYVLKQVIIRYFGVDDVHLSFLPLSHMYERVNQIVIFMNGGKIGFF------NGDIKKLLDDFKTLRPTVFGAVPRLLNRIHDKVTNEINKS-WIKRWIFQIALNAKKRDLARKIVRRDT-----IWDYLIFNKIQALLG-GRVWFIISGSAPLSPKVATFIRCVMGCQVQEGYGQTETVASVTLQLLDDFTAGHVGPPTPVNVVKLVDVPEMDYWANNKQGEICVKGRNVFKGYLHNPAMTAEVLDKDRWLYTGDIGEWTTVGTRRLYTRER-GACIQGNEGEYIAPQKIEN-IYLRSPFVAQIYVHGD-----SIRSFLVAVVVPDAEVLEAWAEKKGIRGDLKRL------------CQNKTVHQRIFESMVKVGEESQLNSLEKVRGIHLCSEAFSIDNGLLTPTLKIKRPQMSTFFRDIIDNLYT 541          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:101171154])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 291/593 (49.07%), Postives = 411/593 (69.31%), Query Frame = 3
Query:  324 YLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPF---KNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKI-----TGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            Y +  + AA +++KLGL     V ILGFN   WFI+ +G I AGG   G+YTTN+P+ C+F+  +C   +IV+EN+ QL KIL I   +P LKAI++Y G     L+ K   ++YTW EFM L + +    LD  ++  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T     +HV +      +  V+SYLPLSHIAA + D+   + VG + +FAQPDALKGSL  TLKEVRPT F+GVPRV+EK+QE+M+ IG+K+ T+++ +A WAK+VG + +L ++     TG+ P +  Y LAK LVF K+++ALGLDRC    + AAP T+ +L++FLSLD+P+ ++YG+SECTGPHT+   D  R+ S G  + G   K+D P+E   GEIC  GRH+F+GY N  +KT+E++D++GWLHSGDLGK +++  LYITGRIKELIITAGGENI PVPIED +K+ +P +S+ ML+GD++KF+S L+T+K  ++ +T  P ++LTP A+   K +G  AKTV E+   +D  +   I E I +VN  + S A  +QK+ +L RDFSI+GGELGPTMK+KR  +++MY + + + Y
Sbjct:  161 YYKACRTAAKSYLKLGLQRYHGVCILGFNSAEWFIADIGAILAGGFGVGVYTTNSPEACQFVAENCKANVIVLENEKQLQKILQIEDQLPHLKAIVQYKG----ALREKRP-NLYTWAEFMELGRDEPDGPLDAIIASQKPNQCCSLIYTSGTTGQPKGVMLSHDNLTWTALSTAKHVCLTDATVAQEVVVSYLPLSHIAAQMVDMWLIMRVGGSTHFAQPDALKGSLVNTLKEVRPTAFMGVPRVWEKMQEKMKSIGAKSSTLRRKVASWAKDVGLQTNLTRMRQNTATGQAPFQ--YHLAKKLVFKKVRKALGLDRCTKCYTGAAPTTKDTLEFFLSLDIPLFELYGMSECTGPHTISRPDAFRLTSCGKEIPGCTTKLDNPDEEGNGEICFWGRHIFMGYLNAPDKTEEALDAEGWLHSGDLGKRDEHGFLYITGRIKELIITAGGENIPPVPIEDAVKDAVPLLSNAMLIGDKRKFLSMLVTIKCQINPETGNPEDELTPEAVEICKKLGTSAKTVSEIAGGRDRTVHAAIQEGINQVNKKATSNAQCIQKFVILNRDFSINGGELGPTMKLKRPVVLKMYKDQIDNFY 746          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:101171154])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 291/593 (49.07%), Postives = 411/593 (69.31%), Query Frame = 3
Query:  324 YLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPF---KNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKI-----TGK-PVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            Y +  + AA +++KLGL     V ILGFN   WFI+ +G I AGG   G+YTTN+P+ C+F+  +C   +IV+EN+ QL KIL I   +P LKAI++Y G     L+ K   ++YTW EFM L + +    LD  ++  +P+ C  LIYTSGTTG PKGVMLSHDN+ +T     +HV +      +  V+SYLPLSHIAA + D+   + VG + +FAQPDALKGSL  TLKEVRPT F+GVPRV+EK+QE+M+ IG+K+ T+++ +A WAK+VG + +L ++     TG+ P +  Y LAK LVF K+++ALGLDRC    + AAP T+ +L++FLSLD+P+ ++YG+SECTGPHT+   D  R+ S G  + G   K+D P+E   GEIC  GRH+F+GY N  +KT+E++D++GWLHSGDLGK +++  LYITGRIKELIITAGGENI PVPIED +K+ +P +S+ ML+GD++KF+S L+T+K  ++ +T  P ++LTP A+   K +G  AKTV E+   +D  +   I E I +VN  + S A  +QK+ +L RDFSI+GGELGPTMK+KR  +++MY + + + Y
Sbjct:  170 YYKACRTAAKSYLKLGLQRYHGVCILGFNSAEWFIADIGAILAGGFGVGVYTTNSPEACQFVAENCKANVIVLENEKQLQKILQIEDQLPHLKAIVQYKG----ALREKRP-NLYTWAEFMELGRDEPDGPLDAIIASQKPNQCCSLIYTSGTTGQPKGVMLSHDNLTWTALSTAKHVCLTDATVAQEVVVSYLPLSHIAAQMVDMWLIMRVGGSTHFAQPDALKGSLVNTLKEVRPTAFMGVPRVWEKMQEKMKSIGAKSSTLRRKVASWAKDVGLQTNLTRMRQNTATGQAPFQ--YHLAKKLVFKKVRKALGLDRCTKCYTGAAPTTKDTLEFFLSLDIPLFELYGMSECTGPHTISRPDAFRLTSCGKEIPGCTTKLDNPDEEGNGEICFWGRHIFMGYLNAPDKTEEALDAEGWLHSGDLGKRDEHGFLYITGRIKELIITAGGENIPPVPIEDAVKDAVPLLSNAMLIGDKRKFLSMLVTIKCQINPETGNPEDELTPEAVEICKKLGTSAKTVSEIAGGRDRTVHAAIQEGINQVNKKATSNAQCIQKFVILNRDFSINGGELGPTMKLKRPVVLKMYKDQIDNFY 755          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: ENSORLT00000027775.1 (long-chain-fatty-acid--CoA ligase ACSBG2 [Source:NCBI gene;Acc:101158282])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 306/642 (47.66%), Postives = 430/642 (66.98%), Query Frame = 3
Query:  156 KPVNQFSKITEETANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKP-VEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            K VN   + +   + TP  TI     + V+ + D   L +K D   G    +T  QY E  + AA +F+KLGL+    VGILGFN P WFIS +G IFAGG+  GIYTTN+P+ C+++  +C   I+VVEN  QL+KIL +   +P LKAII+Y G    +L+ K SI +Y+W EFM + +  S ++L+  +   + ++C  LIYTSGTTG PKGVMLS DN+ +T + +   +     +  +ISYLPLSH+AA + DI  ++S   T YFA+PDALKGSL  TLKE RPT F+GVPRV+EK+QE M+  G KA  +KK +A WAK++G + + + + G+  V   + LA  LVF K++ ALGLDRC Y  + AAP+T+ +L+YFLSL++P+ ++YG+SE +GPHT+ I D+ RIGS G ++ G ++K++ P+E   GE+C  GR+VF+GY N  +KT+E++D DGWLHSGDLGK +    LYITGRIKELIITAGGENI PVPIED +K  +P IS+ ML+GD+ KF+S L+TLK  +D D   P N+L+   +   +   + A  V E+   K+ A+ K I E I +VN+ S S A  +QKW +L RDFS+ GGELGPT+K++R  +V+MY E ++ +YS
Sbjct:   89 KAVNLRMEASGPGSETPV-TIHQMFLETVERSGDQTALVFKED---GQTASLTWRQYYEQCRAAAKSFLKLGLERFHGVGILGFNSPEWFISDIGCIFAGGLAAGIYTTNSPEACQYVAANCEANILVVENQKQLDKILQVKDQLPHLKAIIQYKG----KLQQKTSI-LYSWEEFMKVGEDVSDEQLNAVIDSQRANECCTLIYTSGTTGNPKGVMLSQDNITWTARISSGLICKNYGQEILISYLPLSHVAAQMVDIWISMSFSGTTYFAEPDALKGSLVNTLKEARPTCFLGVPRVWEKMQEGMRAGGEKASPLKKRVADWAKSIGLQYNYSAMEGENLVPWGFMLANNLVFKKVRAALGLDRCRYCFTGAAPITKDTLEYFLSLNIPVKELYGMSESSGPHTVSI-DEYRIGSCGKVIPGSKIKLNNPDEEGNGEVCFWGRNVFMGYLNMPDKTEEALDEDGWLHSGDLGKFDQENFLYITGRIKELIITAGGENIPPVPIEDAVKSELPIISNTMLIGDKLKFLSMLITLKCVMD-DNGEPLNELSSEVLDFCRRHSVTATKVSEITANKEPAIYKAIQEGIDRVNARSTSNAQKIQKWVVLERDFSVVGGELGPTLKLRRPIVVKMYQEKINELYS 719          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: ENSORLT00000001544.2 (long-chain-fatty-acid--CoA ligase ACSBG2 [Source:NCBI gene;Acc:101158282])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 306/642 (47.66%), Postives = 430/642 (66.98%), Query Frame = 3
Query:  156 KPVNQFSKITEETANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKP-VEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            K VN   + +   + TP  TI     + V+ + D   L +K D   G    +T  QY E  + AA +F+KLGL+    VGILGFN P WFIS +G IFAGG+  GIYTTN+P+ C+++  +C   I+VVEN  QL+KIL +   +P LKAII+Y G    +L+ K SI +Y+W EFM + +  S ++L+  +   + ++C  LIYTSGTTG PKGVMLS DN+ +T + +   +     +  +ISYLPLSH+AA + DI  ++S   T YFA+PDALKGSL  TLKE RPT F+GVPRV+EK+QE M+  G KA  +KK +A WAK++G + + + + G+  V   + LA  LVF K++ ALGLDRC Y  + AAP+T+ +L+YFLSL++P+ ++YG+SE +GPHT+ I D+ RIGS G ++ G ++K++ P+E   GE+C  GR+VF+GY N  +KT+E++D DGWLHSGDLGK +    LYITGRIKELIITAGGENI PVPIED +K  +P IS+ ML+GD+ KF+S L+TLK  +D D   P N+L+   +   +   + A  V E+   K+ A+ K I E I +VN+ S S A  +QKW +L RDFS+ GGELGPT+K++R  +V+MY E ++ +YS
Sbjct:   89 KAVNLRMEASGPGSETPV-TIHQMFLETVERSGDQTALVFKED---GQTASLTWRQYYEQCRAAAKSFLKLGLERFHGVGILGFNSPEWFISDIGCIFAGGLAAGIYTTNSPEACQYVAANCEANILVVENQKQLDKILQVKDQLPHLKAIIQYKG----KLQQKTSI-LYSWEEFMKVGEDVSDEQLNAVIDSQRANECCTLIYTSGTTGNPKGVMLSQDNITWTARISSGLICKNYGQEILISYLPLSHVAAQMVDIWISMSFSGTTYFAEPDALKGSLVNTLKEARPTCFLGVPRVWEKMQEGMRAGGEKASPLKKRVADWAKSIGLQYNYSAMEGENLVPWGFMLANNLVFKKVRAALGLDRCRYCFTGAAPITKDTLEYFLSLNIPVKELYGMSESSGPHTVSI-DEYRIGSCGKVIPGSKIKLNNPDEEGNGEVCFWGRNVFMGYLNMPDKTEEALDEDGWLHSGDLGKFDQENFLYITGRIKELIITAGGENIPPVPIEDAVKSELPIISNTMLIGDKLKFLSMLITLKCVMD-DNGEPLNELSSEVLDFCRRHSVTATKVSEITANKEPAIYKAIQEGIDRVNARSTSNAQKIQKWVVLERDFSVVGGELGPTLKLRRPIVVKMYQEKINELYS 719          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsl2 (long-chain-fatty-acid--CoA ligase 1 [Source:NCBI gene;Acc:101168717])

HSP 1 Score: 187.193 bits (474), Expect = 7.215e-50
Identity = 170/608 (27.96%), Postives = 284/608 (46.71%), Query Frame = 3
Query:  324 YLELIQKAASNFIKLGLDVKAA-------VGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPD--VPQLKAIIKYTG--DVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNM---IFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYF-LSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMK-IDEPN-----ENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDR-QKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVN-SCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
            Y E+ Q+A   +I  GL  K         +GI G N P W IS+L        +  +Y T   +    I+N     +++ + + +   +L I      P+L  ++ +T      AE   K  + +    E M L + +  D +       QP D A++ +TSGTTG PKG M++H N+     +V K +E   +    +  ISYLPL+H+   +   +T    G +V F Q D     L   +K ++PT    VPR+  +I +++  + S     ++ +  +A     +   A+++   V  +    K L+F+KI+ +LG     ++ +A+AP++   L +   +L   I + YG +ECT   T  +      G  G  L    +K +D P+     +N  GEICI+G  VF GY  + E+T E++DS+GWLH+GD+G+   N  L I  R K +   + GE IAP  IE+      P +  V + GD  Q ++  ++     V VD  +    +      S K++            C++  +K  + E ++ V     +     V+   L P  FSI+ G L PT+K +R  I +++ E +SSMYS
Sbjct:  175 YTEVAQQA--QWIGSGLLAKGCLPTPEQYIGIFGQNKPEWVISELACYTYSMAVVPLYDTLGTEAMVHIINLAEMSLVICDQEQRAASLLHIKEKGLTPKLSCLVLFTSFSQAFAERAKKCHVEVLRLDELMELGRQNLKDPVPP-----QPQDLAVVCFTSGTTGKPKGAMITHGNIASNTSSVIKILEGFFVIRHDDVSISYLPLAHMFERMIQ-LTMFCFGASVGFYQGDITL--LMDDMKTLKPTFLPVVPRLLNRIYDKI--LASTKSPFRRALLHFAV----QRKQAELSRGIVRNNSLWDK-LIFNKIQASLG-GNLRFVLTASAPISSTVLSFLRATLGCLIFEGYGQTECTSGCTFSMPGDSSTGHVGAPLPCAMVKLVDIPDMNYYAKNGEGEICIQGPSVFRGYLKDPERTAEALDSEGWLHTGDVGQWLKNGSLRIVDRKKHIFKLSQGEYIAPEKIENIYMRSTPVL-QVFVHGDSLQSYLVGIVVPDPEVFVDWSKERGFMG-----SYKEL------------CQNPDVKNAVLEDMRGVGKEAGLKSFEQVKDLYLHPEMFSIANGLLTPTLKSRRNDIRQVFQEQLSSMYS 746          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 1368.99 bits (3542), Expect = 0.000e+0
Identity = 678/680 (99.71%), Postives = 680/680 (100.00%), Query Frame = 3
Query:   42 MNASFFIITQTIYIMTDCNLNKIGNGVNHSEKSNNFNAKPVNQFSKITEETANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP 2081
            MNASFFIITQTIYIMTDCNLNKIGNGVNHSEKSNNFNAKPVNQFSKITEETANTPKETIP+CLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE+NIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP
Sbjct:    1 MNASFFIITQTIYIMTDCNLNKIGNGVNHSEKSNNFNAKPVNQFSKITEETANTPKETIPECLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP 680          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 1340.48 bits (3468), Expect = 0.000e+0
Identity = 664/666 (99.70%), Postives = 666/666 (100.00%), Query Frame = 3
Query:   84 MTDCNLNKIGNGVNHSEKSNNFNAKPVNQFSKITEETANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP 2081
            MTDCNLNKIGNGVNHSEKSNNFNAKPVNQFSKITEETANTPKETIP+CLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE+NIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP
Sbjct:    1 MTDCNLNKIGNGVNHSEKSNNFNAKPVNQFSKITEETANTPKETIPECLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP 666          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 1182.93 bits (3059), Expect = 0.000e+0
Identity = 588/589 (99.83%), Postives = 589/589 (100.00%), Query Frame = 3
Query:  315 MEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP 2081
            MEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNE+NIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP
Sbjct:    1 MEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYSP 589          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027217.1 (SMESG000027217.1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 379/636 (59.59%), Postives = 494/636 (77.67%), Query Frame = 3
Query:  171 FSKITEETANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMYS 2078
             S + +ET N P+ETI + LK+ V++  +  VLKYKSDPK  YD+ +TM++YLE I KAA+ FI LGL+ KAA+ ILGFNHPAWFIS+LGGI+AGG+ CGIYT+NT +ICK+IM DC CQI+++ENDDQLNKILSILP VPQ+KAIIKYTG+V  E K K  I IYTW++F++++  ++ DEL  R   ++P DCA+LIYTSGTTG PKGVMLSHDN++FT+K    H++++ F+N +ISYLPLSH+AAN+ DI +TV +G T+YFAQPDALKGSLGKTLKEVRPTVF+GVPRV+EKIQEQ++ +  KA T KK                                L   K+K+ LGLDRC Y+AS AAP++QQ+L++F  +D+ I+QIYG+SE +GPHT+G  D+ ++G  GT++KGVE+KI+ P+EN IGEIC+RGRHVFLGY+N +EKTKE++DS+ WLHSGDLGKV+   +L +TGRIKEL+ITAGGEN+APVPIED IK  +PFIS+VMLVGD++KF+SCLLTLK+  D  TQ PT +L+ +AIRSL+  GIEAK VE++L      LK  ID A+ +VN+ SVS+AAYVQKW++LPRDFS+ GGELGPT+KMKRM ++E Y +++ SMY+
Sbjct:   30 ISNVDDETKNVPEETIINRLKENVESQPNHVVLKYKSDPKKDYDLSLTMKEYLEQITKAATGFITLGLEPKAAICILGFNHPAWFISELGGIYAGGVSCGIYTSNTAEICKYIMIDCKCQILILENDDQLNKILSILPGVPQVKAIIKYTGEVQEEAKKKSKIPIYTWSQFLSIDSTNATDELHNRQENVKPKDCAVLIYTSGTTGLPKGVMLSHDNILFTLKMVQIHLELKKFQNIIISYLPLSHVAANMLDIASTVGMGSTIYFAQPDALKGSLGKTLKEVRPTVFLGVPRVYEKIQEQLENL--KASTNKK--------------------------------LDSVKVKQNLGLDRCEYIASGAAPISQQTLEFFQGIDILIHQIYGMSESSGPHTIGKKDEKKLGCVGTLMKGVELKIENPDENLIGEICMRGRHVFLGYFNAVEKTKEALDSENWLHSGDLGKVDGEGYLMVTGRIKELLITAGGENVAPVPIEDNIKSELPFISNVMLVGDKKKFISCLLTLKTDFDSKTQLPTEKLSVSAIRSLESFGIEAKEVEDLLNSNFAVLKSTIDNAMNRVNAQSVSKAAYVQKWTILPRDFSLKGGELGPTLKMKRMFVMEKYEDVIKSMYT 631          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000080395.1 (SMESG000080395.1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 289/573 (50.44%), Postives = 398/573 (69.46%), Query Frame = 3
Query:  357 FIKLGLDVKAAVGILGFNHPAWFISQLXXXXXXXXXXXXYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 2075
            F ++GL+ + +V I G N P WFI+  G IFAGG+  GIY TN  +  +FI+N+C C + +V N++ L K + +  + P LKAI+ Y G +   +K    IS+Y WTEFMNL    + D L  RL+ + P++C  LIYTSGTTG PKGVM+SHDN+++T +  + ++K +  K  +ISYLPLSH+AA + DI+  +    T++FAQPDALKGSLG TLKEV PT FIGVPRVFEKI EQM+E+     ++KK I+ WAK++G+R +LAK+  +     Y +AK ++F+K+ +ALG DRC+ + SAAAPL+   L YF SLD+ I +IYG+SEC+GP T+   ++ R GS G IL     K+D  +    GEIC+ GRHVF+GY N  EKTKE  DS+ WLHSGD+G   D  +L+ITGRIKEL+ITAGGENIAPVPIE KIKE + FIS+ M+VGD++K++  LLT+K  +D  TQ PT+ LTPAA R    IG    ++ +++  K+  L   IDE IK+ N  ++SR+A VQKW+ LP DFS+ GGELGPT+K+KR  + E+YS +++S+Y
Sbjct:    4 FDEIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDWTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKEDGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSICIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 575          
The following BLAST results are available for this feature:
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSBG21.481e-18044.73acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG21.103e-17944.73acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG21.103e-17944.73acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG11.183e-17345.44acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
ACSBG24.593e-15145.89acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-131.245e-4727.89Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-131.416e-4727.89Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-132.323e-4728.04Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-182.306e-4326.24Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-58.869e-4126.13Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bgm5.993e-17644.43gene:FBgn0027348 transcript:FBtr0080590[more]
bgm5.993e-17644.43gene:FBgn0027348 transcript:FBtr0346624[more]
hll2.447e-13736.74gene:FBgn0286723 transcript:FBtr0080591[more]
CG39616.091e-4826.14gene:FBgn0036821 transcript:FBtr0302322[more]
CG39619.047e-4826.14gene:FBgn0036821 transcript:FBtr0333712[more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg20.000e+047.56acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg20.000e+047.56acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg13.800e-17344.97acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
acsl51.936e-5129.14acyl-CoA synthetase long chain family member 5 [So... [more]
acsl51.936e-5129.14acyl-CoA synthetase long chain family member 5 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg20.000e+050.00acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg20.000e+050.00acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg20.000e+050.00acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg20.000e+049.92acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg20.000e+049.92acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acsbg23.398e-18043.61acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
Acsbg11.812e-17945.78acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
Acsbg35.410e-12032.89acyl-CoA synthetase bubblegum family member 3 [Sou... [more]
Acsl53.148e-4827.90acyl-CoA synthetase long-chain family member 5 [So... [more]
Acsl11.846e-4425.63acyl-CoA synthetase long-chain family member 1 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZYC4|ACBG2_XENLA0.000e+049.45Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopu... [more]
sp|Q5ZKR7|ACBG2_CHICK0.000e+044.93Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus... [more]
sp|A1L1K7|ACBG2_RAT2.850e-18044.66Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus... [more]
sp|Q924N5|ACBG1_RAT9.993e-18045.95Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus... [more]
sp|Q2XU92|ACBG2_MOUSE2.377e-17943.61Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus mu... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D0PP320.000e+048.54long-chain-fatty-acid--CoA ligase ACSBG2-like OS=I... [more]
A0A5N5KDU10.000e+048.77Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A1L8HNF60.000e+050.08AMP-binding domain-containing protein OS=Xenopus l... [more]
H3DDR20.000e+049.60AMP-binding domain-containing protein OS=Tetraodon... [more]
A0A5G3K2190.000e+050.00AMP-binding domain-containing protein OS=Xenopus t... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016625.20.000e+047.43long-chain-fatty-acid--CoA ligase ACSBG2-like [Sou... [more]
acsbg20.000e+048.81acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg11.518e-16642.22acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
acsl28.745e-5028.22long-chain-fatty-acid--CoA ligase 6 [Source:NCBI g... [more]
acsl51.825e-4828.03acyl-CoA synthetase long chain family member 5 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
acsbg20.000e+048.50acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSL15.309e-4725.50acyl-CoA synthetase long chain family member 1 [So... [more]
ACSL13.344e-4428.73acyl-CoA synthetase long chain family member 1 [So... [more]
acsl3b4.747e-1926.14acyl-CoA synthetase long chain family member 3b [S... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FAA21.365e-4124.58Medium chain fatty acyl-CoA synthetase; activates ... [more]
FAA14.809e-3328.95Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA44.490e-2525.99Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA38.063e-2327.42Long chain fatty acyl-CoA synthetase; activates im... [more]
PCS603.567e-1526.20Oxalyl-CoA synthetase; capable of catalyzing conve... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320543.543e-17548.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454612.266e-5126.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463353.064e-4927.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455042.960e-4727.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463611.238e-4229.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg20.000e+049.07acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg20.000e+049.07acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ENSORLT00000027775.10.000e+047.66long-chain-fatty-acid--CoA ligase ACSBG2 [Source:N... [more]
ENSORLT00000001544.20.000e+047.66long-chain-fatty-acid--CoA ligase ACSBG2 [Source:N... [more]
acsl27.215e-5027.96long-chain-fatty-acid--CoA ligase 1 [Source:NCBI g... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027204.10.000e+099.71SMESG000027204.1[more]
SMESG000027204.10.000e+099.70SMESG000027204.1[more]
SMESG000027204.10.000e+099.83SMESG000027204.1[more]
SMESG000027217.10.000e+059.59SMESG000027217.1[more]
SMESG000080395.10.000e+050.44SMESG000080395.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013319 ID=SMED30013319|Name=Long-chain-fatty-acid--CoA ligase ACSBG2|organism=Schmidtea mediterranea sexual|type=transcript|length=2136bp
GAGTGTGCCACTGCGCGGTTGTGTGTGCTTGATAAATATATATGAATGCA
TCTTTTTTTATCATTACTCAGACCATTTACATAATGACGGATTGCAATTT
GAATAAAATTGGTAACGGAGTAAATCATTCCGAGAAATCAAATAATTTCA
ATGCAAAACCGGTAAATCAATTTTCTAAGATTACTGAAGAAACTGCAAAT
ACTCCAAAAGAAACAATTCCAGATTGTCTGAAAAAATTAGTGAAAACCAA
TTCAGATTTTCCGGTTTTAAAATACAAGAGCGATCCAAAGAATGGTTATG
ATATTGAAGTTACTATGGAACAATACTTAGAACTAATTCAAAAAGCTGCT
TCGAATTTTATTAAATTAGGACTCGATGTGAAAGCCGCAGTTGGTATTCT
CGGTTTTAATCATCCAGCCTGGTTTATCAGTCAACTTGGAGGAATATTTG
CTGGAGGAATCATTTGCGGGATTTACACAACGAACACTCCAGACATATGT
AAATTTATCATGAACGACTGCAACTGCCAGATTATTGTCGTTGAGAATGA
TGACCAATTGAACAAGATTTTGTCCATTTTGCCAGATGTCCCTCAGCTGA
AAGCTATCATCAAATACACTGGAGACGTATCAGCCGAATTAAAAACCAAA
TACTCTATTTCAATTTATACGTGGACAGAGTTCATGAATCTGAATCAGGC
AGATTCGGCAGATGAGTTAGATAGACGGCTGAGTGAAATACAACCAGACG
ATTGTGCATTATTGATATACACCAGTGGTACCACTGGATTCCCTAAAGGA
GTGATGCTTTCTCATGACAATATGATTTTCACAGTAAAAAAGGCCATGGA
GCATGTCAAAATACAACCATTTAAAAATAGTGTCATTTCCTATTTACCAC
TCAGTCATATCGCTGCGAATCTAAATGATATCATGACTACGGTGTCTGTG
GGGGTCACGGTTTATTTTGCTCAACCCGATGCTCTGAAAGGGTCTTTGGG
AAAGACTCTGAAGGAAGTAAGACCCACCGTTTTCATTGGAGTACCAAGAG
TATTTGAGAAAATCCAAGAACAAATGCAGGAAATCGGATCAAAAGCCGGT
ACGATTAAAAAGTATATTGCTGGATGGGCGAAAAATGTCGGACATAGGAA
TTCTTTAGCGAAGATAACTGGGAAACCTGTTGAAAAGTCCTATTTCCTGG
CGAAATATTTGGTGTTTGATAAAATAAAGGAAGCTTTGGGTCTTGATCGA
TGCATATATTTGGCTTCAGCTGCAGCTCCACTCACTCAACAGTCTTTGGA
TTACTTCCTCAGTCTGGACATGCCAATAAACCAAATTTATGGCTTATCAG
AATGTACTGGGCCCCACACCATGGGAATCACGGATAAAATACGAATCGGA
TCAGCTGGAACGATACTGAAAGGAGTTGAAATGAAAATTGACGAGCCTAA
TGAGAACAATATCGGGGAGATCTGTATTCGTGGAAGACATGTATTCCTTG
GCTATTACAACAATATGGAAAAGACGAAGGAATCCATTGACTCAGATGGA
TGGTTACATTCCGGAGATCTTGGTAAAGTTGAGGATAATGAGCACTTGTA
CATTACTGGGCGAATAAAGGAACTCATTATAACGGCTGGAGGAGAGAATA
TAGCTCCAGTTCCTATTGAGGATAAAATCAAAGAGAGAATACCATTTATT
AGCAGTGTGATGCTGGTCGGAGACAGGCAGAAATTTGTGTCTTGCCTTTT
GACTCTTAAATCTACAGTAGATGTTGATACGCAGCGTCCAACTAATCAGT
TAACTCCTGCTGCTATTAGGAGTCTTAAGGATATCGGGATTGAGGCGAAA
ACTGTTGAGGAAGTTTTGGAATGCAAAGACATTGCGCTAAAAAAATTTAT
TGATGAAGCCATTAAGAAAGTCAACAGTTGTTCGGTTTCCAGGGCAGCAT
ATGTTCAAAAATGGTCCTTACTTCCGAGAGATTTCTCCATTTCCGGAGGA
GAGCTAGGGCCGACGATGAAAATGAAACGAATGGCCATTGTGGAGATGTA
TTCAGAAATTGTCAGTTCTATGTATTCTCCATGATCATATCAGTTTATAG
ATAAATTTCATTTGATAACAATAAATTTTTCAATGG
back to top

protein sequence of SMED30013319-orf-1

>SMED30013319-orf-1 ID=SMED30013319-orf-1|Name=SMED30013319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=681bp
MNASFFIITQTIYIMTDCNLNKIGNGVNHSEKSNNFNAKPVNQFSKITEE
TANTPKETIPDCLKKLVKTNSDFPVLKYKSDPKNGYDIEVTMEQYLELIQ
KAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTP
DICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAEL
KTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGF
PKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTT
VSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGS
KAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALG
LDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKI
RIGSAGTILKGVEMKIDEPNENNIGEICIRGRHVFLGYYNNMEKTKESID
SDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERI
PFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGI
EAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSI
SGGELGPTMKMKRMAIVEMYSEIVSSMYSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003996acyl-CoA ligase activity
GO:0047676arachidonate-CoA ligase activity
GO:0004129cytochrome-c oxidase activity
GO:0003824catalytic activity
GO:0000166nucleotide binding
GO:0004467long-chain fatty acid-CoA ligase activity
GO:0005524ATP binding
GO:0016874ligase activity
GO:0102391decanoate--CoA ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR020845AMP-binding_CS
IPR023616Cyt_c_oxase-like_su1_dom
IPR000873AMP-dep_Synth/Lig
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008152metabolic process
GO:0001676long-chain fatty acid metabolic process
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 68..531
e-value: 1.4E-85
score: 287.4
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 383..528
e-value: 6.1E-32
score: 112.6
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 41..377
e-value: 8.8E-48
score: 165.0
NoneNo IPR availablePANTHERPTHR43272FAMILY NOT NAMEDcoord: 50..679
NoneNo IPR availablePANTHERPTHR43272:SF32LONG-CHAIN-FATTY-ACID--COA LIGASE ACSBG2coord: 50..679
NoneNo IPR availableCDDcd05933ACSBG_likecoord: 83..678
e-value: 0.0
score: 797.721
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 46..678
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 241..252