Serine/threonine-protein kinase

Overview
NameSerine/threonine-protein kinase
Smed IDSMED30013318
Length (bp)477
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase (SMED30013318) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase (SMED30013318) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase (SMED30013318) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase (SMED30013318) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013318

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30013318SMESG000074546.1 SmedASXL_001888SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30013318SMESG000074546.1 SmedASXL_001888SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30013318SMESG000074546.1 dd_Smed_v4_15776_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 47.3654 bits (111), Expect = 2.963e-6
Identity = 23/66 (34.85%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   71 CSICLRECNTE-IGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIEN 265
            C ICL     + +G    C H FC  CI EW  ++N CP+D      + I  + GG+I+++  +EN
Sbjct:  104 CPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRKIPVEN 169          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 47.3654 bits (111), Expect = 2.963e-6
Identity = 23/66 (34.85%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   71 CSICLRECNTE-IGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIEN 265
            C ICL     + +G    C H FC  CI EW  ++N CP+D      + I  + GG+I+++  +EN
Sbjct:  104 CPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRKIPVEN 169          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 47.3654 bits (111), Expect = 2.963e-6
Identity = 23/66 (34.85%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   71 CSICLRECNTE-IGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIEN 265
            C ICL     + +G    C H FC  CI EW  ++N CP+D      + I  + GG+I+++  +EN
Sbjct:  107 CPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRKIPVEN 172          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 47.3654 bits (111), Expect = 2.963e-6
Identity = 23/66 (34.85%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   71 CSICLRECNTE-IGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIEN 265
            C ICL     + +G    C H FC  CI EW  ++N CP+D      + I  + GG+I+++  +EN
Sbjct:  107 CPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRKIPVEN 172          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PHRF1 (PHD and ring finger domains 1 [Source:HGNC Symbol;Acc:HGNC:24351])

HSP 1 Score: 47.3654 bits (111), Expect = 3.137e-6
Identity = 23/66 (34.85%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   71 CSICLRECNTE-IGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIEN 265
            C ICL     + +G    C H FC  CI EW  ++N CP+D      + I  + GG+I+++  +EN
Sbjct:  108 CPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRKIPVEN 173          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 48.521 bits (114), Expect = 5.801e-7
Identity = 21/50 (42.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:   59 SGIECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNK-CPMDTQPIT 205
            S  EC+IC+   N  +  LT CGH FCR+C+  W+  +N+ CPMD + ++
Sbjct:  100 SRYECAICIDWLNEPV--LTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLS 147          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: PHRF1 (PHD and ring finger domains 1 [Source:NCBI gene;Acc:100127807])

HSP 1 Score: 45.8246 bits (107), Expect = 9.288e-6
Identity = 24/65 (36.92%), Postives = 34/65 (52.31%), Query Frame = 2
Query:   71 CSICLRECNTEI-GQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIE 262
            C ICL     ++ G    C H FC  CI EW  ++N CP+D    + + I    GGEI+K+  I+
Sbjct:  100 CPICLNGFRDQVVGTPENCSHYFCLDCIVEWSKNANSCPVDRIAFSCIHIRAHFGGEILKKVPIQ 164          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Phrf1 (PHD and ring finger domains 1 [Source:MGI Symbol;Acc:MGI:2141847])

HSP 1 Score: 45.4394 bits (106), Expect = 9.589e-6
Identity = 23/66 (34.85%), Postives = 34/66 (51.52%), Query Frame = 2
Query:   71 CSICLRECNTE-IGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIEN 265
            C ICL     + +G    C H FC  CI EW  ++N CP+D      + I  +  G+I+K+  +EN
Sbjct:  109 CPICLNAFRDQAVGTPETCAHYFCLDCIIEWSRNANSCPVDRTVFKCICIRAQFNGKILKKIPVEN 174          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|Q06554|IRC20_YEAST (Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC20 PE=1 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.937e-6
Identity = 21/41 (51.22%), Postives = 28/41 (68.29%), Query Frame = 2
Query:   65 IECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPM 187
            + CSICL E   EIG + +CGH FC++CI  WL   +KCP+
Sbjct: 1237 LSCSICLGEV--EIGAIIKCGHYFCKSCILTWLRAHSKCPI 1275          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: E0VD94 (Arginine/serine-rich protein, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8238211 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.779e-7
Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = 2
Query:   68 ECSICLRECNT-EIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIENP 268
            +C+ICLR  N  E+G    C H FC  CI EW  +SN CP+D Q  + +L+     G ++K+  +E P
Sbjct:   70 KCAICLRSINNQEVGNPEGCDHLFCSVCIIEWSKNSNVCPLDRQQFSIILVRKNKDGNLVKKVQVEEP 137          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A4C1WAT9 (PHD and RING finger domain-containing protein 1 OS=Eumeta variegata OX=151549 GN=PHRF1 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 4.388e-7
Identity = 25/62 (40.32%), Postives = 37/62 (59.68%), Query Frame = 2
Query:   68 ECSICL-RECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQ 250
            +CSICL R  N E+G    C H FC  CI EW  + N CP+D      +++ +RPGG ++++
Sbjct:  117 KCSICLMRFTNQEVGTPQNCEHVFCVDCITEWSKNVNTCPVDRSTFEVIIVRERPGGRVLRK 178          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A0R3TUR2 (RING-type domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11505 PE=4 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.808e-7
Identity = 26/65 (40.00%), Postives = 35/65 (53.85%), Query Frame = 2
Query:   68 ECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIE 262
            +CSICL E    IG L  C H FC  CI++W  D   CP+D  P   + I    GG I+++  +E
Sbjct:    6 QCSICLGEMKASIGMLGGCEHIFCYDCIKKWSEDKRTCPLDRTPFDSINILHEIGGAIVEEEKLE 70          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A0R3TEG2 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS13100 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 9.968e-7
Identity = 24/61 (39.34%), Postives = 34/61 (55.74%), Query Frame = 2
Query:   68 ECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQ 250
            +CS+CL E    +G L EC H FC  CI+ W     KCP+D  P   + I  R GG ++++
Sbjct:    6 KCSVCLEELKLPLGMLCECKHIFCYDCIKRWSGTRRKCPLDRTPFDTIGILHRIGGPVVEE 66          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A1B6JSP2 (Uncharacterized protein OS=Homalodisca liturata OX=320908 GN=g.54543 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.458e-6
Identity = 23/68 (33.82%), Postives = 38/68 (55.88%), Query Frame = 2
Query:   68 ECSICLRECN-TEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIENP 268
            +C ICL   N  E+G+   C H FC  CI+EW    N CP+D +P   +++     G+++++  +E P
Sbjct:  558 KCPICLTRFNLQEVGKPASCDHSFCVPCIQEWAKSKNTCPVDRRPFQSIVVRSHLQGKVVREIPVETP 625          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008781.1 (pep scaffold:Pmarinus_7.0:GL478673:190102:212513:-1 gene:ENSPMAG00000007949.1 transcript:ENSPMAT00000008781.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 1.095e-6
Identity = 22/66 (33.33%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   71 CSICLREC-NTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIEN 265
            C ICL    + E+G    C H FC  CI EW  + N CP+D +  T + +    GG +++Q  +++
Sbjct:   96 CPICLNGLRDQELGTPENCAHLFCLDCILEWAKNMNSCPVDRKVFTSVSVRACVGGPVLRQVPVQD 161          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004580.1 (pep scaffold:Pmarinus_7.0:GL479395:1031:10600:-1 gene:ENSPMAG00000004170.1 transcript:ENSPMAT00000004580.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 2.616e-6
Identity = 21/69 (30.43%), Postives = 33/69 (47.83%), Query Frame = 2
Query:   62 GIECSICLRECNTE-IGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIEN 265
            G  C ICL     + +G    C H FC  C+ EW  + N CP+D +P   +      GG++++   + N
Sbjct:    8 GDSCPICLNGFRVQAVGIPESCQHAFCLDCLLEWAKNVNSCPVDRKPFKVISALSCFGGDVVRTIAVPN 76          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: IRC20 (E3 ubiquitin ligase and putative helicase; involved in synthesis-dependent strand annealing-mediated homologous recombination; ensures precise end-joining along with Srs2p in the Yku70p/Yku80p/Lig4p-dependent nonhomologous end joining (NHEJ) pathway; localizes to both the mitochondrion and the nucleus; contains a Snf2/Swi2 family ATPase/helicase and a RING finger domain; interacts with Cdc48p and Smt3p; null mutant displays increased levels of spontaneous Rad52p foci [Source:SGD;Acc:S000004237])

HSP 1 Score: 50.0618 bits (118), Expect = 2.789e-8
Identity = 21/41 (51.22%), Postives = 28/41 (68.29%), Query Frame = 2
Query:   65 IECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPM 187
            + CSICL E   EIG + +CGH FC++CI  WL   +KCP+
Sbjct: 1237 LSCSICLGEV--EIGAIIKCGHYFCKSCILTWLRAHSKCPI 1275          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000074546.1 (SMESG000074546.1)

HSP 1 Score: 197.593 bits (501), Expect = 6.485e-66
Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 2
Query:   56 MSGIECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIENPXXXXXXXXXXXXXXXXXXXXXEFSSDSELTDEGELINEEDFFAMGGFLV 415
            MSGIECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIENPLANNLNFQNYLNNLHNYLVENEFSSDSELTDEGELINEEDFFAMGGFLV
Sbjct:    1 MSGIECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIENPLANNLNFQNYLNNLHNYLVENEFSSDSELTDEGELINEEDFFAMGGFLV 120          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000017887.1 (SMESG000017887.1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.890e-19
Identity = 34/71 (47.89%), Postives = 44/71 (61.97%), Query Frame = 2
Query:   56 MSGIECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIENP 268
            M+ IEC +CL EC+  IGQ   C HE+C  CI EWL  SN CP D   I E+ +YD+P G +I   +I +P
Sbjct:    1 MASIECPVCLAECSDMIGQSGNCFHEYCYDCISEWLKSSNICPCDGSEINELFVYDKPQGNLINHLMILHP 71          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000017910.1 (SMESG000017910.1)

HSP 1 Score: 69.3218 bits (168), Expect = 5.083e-15
Identity = 32/71 (45.07%), Postives = 42/71 (59.15%), Query Frame = 2
Query:   56 MSGIECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRIIENP 268
            M  IEC +CL +C+  IGQ   C HE+C  CI E L  SN CP D   I E+ +YD+P G +I   +I +P
Sbjct:    1 MVSIECPVCLADCSDMIGQSGNCFHEYCYDCISECLKSSNICPCDGSEINELFVYDKPQGNLINHLMILHP 71          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000045165.1 (SMESG000045165.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.214e-9
Identity = 22/63 (34.92%), Postives = 36/63 (57.14%), Query Frame = 2
Query:   68 ECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRI 256
            +C IC  +  + +     C H FC  C+++W +  ++CPMD  PI  +L+ D PGG I K+ +
Sbjct:   88 QCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEV 150          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000045165.1 (SMESG000045165.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.225e-9
Identity = 22/63 (34.92%), Postives = 36/63 (57.14%), Query Frame = 2
Query:   68 ECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPITEMLIYDRPGGEIIKQRI 256
            +C IC  +  + +     C H FC  C+++W +  ++CPMD  PI  +L+ D PGG I K+ +
Sbjct:   87 QCCICFSKYKSPVASTDSCTHSFCFECLKKWCTFKHECPMDRMPIKLLLLSDFPGGHITKKEV 149          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHRF12.963e-634.85PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
PHRF12.963e-634.85PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
PHRF12.963e-634.85PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
PHRF12.963e-634.85PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
PHRF13.137e-634.85PHD and ring finger domains 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf65.801e-742.00gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PHRF19.288e-636.92PHD and ring finger domains 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Phrf19.589e-634.85PHD and ring finger domains 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q06554|IRC20_YEAST1.937e-651.22Uncharacterized ATP-dependent helicase IRC20 OS=Sa... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E0VD943.779e-739.71Arginine/serine-rich protein, putative OS=Pediculu... [more]
A0A4C1WAT94.388e-740.32PHD and RING finger domain-containing protein 1 OS... [more]
A0A0R3TUR24.808e-740.00RING-type domain-containing protein OS=Rodentolepi... [more]
A0A0R3TEG29.968e-739.34Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A1B6JSP21.458e-633.82Uncharacterized protein OS=Homalodisca liturata OX... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008781.11.095e-633.33pep scaffold:Pmarinus_7.0:GL478673:190102:212513:-... [more]
ENSPMAT00000004580.12.616e-630.43pep scaffold:Pmarinus_7.0:GL479395:1031:10600:-1 g... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
IRC202.789e-851.22E3 ubiquitin ligase and putative helicase; involve... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074546.16.485e-66100.00SMESG000074546.1[more]
SMESG000017887.13.890e-1947.89SMESG000017887.1[more]
SMESG000017910.15.083e-1545.07SMESG000017910.1[more]
SMESG000045165.11.214e-934.92SMESG000045165.1[more]
SMESG000045165.11.225e-934.92SMESG000045165.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013318 ID=SMED30013318|Name=Serine/threonine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=477bp
TAAATTGATAAATGTTGTTTATATATTTCATTTAAAAAAACGAAATTAGA
GAATTATGTCTGGTATTGAATGCTCAATTTGCTTGCGTGAATGTAATACA
GAAATCGGCCAACTTACAGAATGTGGACATGAATTTTGTAGAACATGCAT
TGAAGAATGGTTATCGGATTCAAATAAATGTCCAATGGATACTCAGCCTA
TTACGGAAATGTTAATATATGATCGTCCCGGAGGAGAAATTATTAAGCAG
CGCATTATAGAGAATCCACTTGCTAATAATTTGAATTTTCAGAATTATTT
AAATAATCTTCATAACTATCTTGTTGAAAATGAATTTTCATCAGATTCTG
AATTAACAGATGAAGGAGAGTTAATAAACGAAGAGGATTTTTTTGCCATG
GGTGGATTTCTGGTTGAAGAACGAAGTGACGAAGAATACAGTGATAGTGA
TGTGGAAAATTAACTGACGAGATCGGA
back to top

protein sequence of SMED30013318-orf-1

>SMED30013318-orf-1 ID=SMED30013318-orf-1|Name=SMED30013318-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=136bp
MSGIECSICLRECNTEIGQLTECGHEFCRTCIEEWLSDSNKCPMDTQPIT
EMLIYDRPGGEIIKQRIIENPLANNLNFQNYLNNLHNYLVENEFSSDSEL
TDEGELINEEDFFAMGGFLVEERSDEEYSDSDVEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0005515protein binding
GO:0008270zinc ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000419prepharyngeal region
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 6..45
e-value: 1.8E-6
score: 37.5
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 5..44
e-value: 3.9E-9
score: 36.7
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 6..46
score: 12.297
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 2..106
e-value: 5.9E-15
score: 57.1
NoneNo IPR availablePANTHERPTHR12618FAMILY NOT NAMEDcoord: 5..74
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 3..52
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 23..32