Calpain

Overview
NameCalpain
Smed IDSMED30013312
Length (bp)2680
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calpain (SMED30013312) t-SNE clustered cells

Violin plots show distribution of expression levels for Calpain (SMED30013312) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calpain (SMED30013312) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calpain (SMED30013312) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013312

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30013312h1SMcG0021179 Contig42066newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013312h1SMcG0021179 Contig42066uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013312h1SMcG0021179 Contig23758newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013312h1SMcG0021179 Contig50737newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013312h1SMcG0021179 Contig50737uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30013312h1SMcG0021179 dd_Smed_v4_1971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013312h1SMcG0021179 dd_Smed_v4_1971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013312h1SMcG0021179 dd_Smed_v4_1971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013312h1SMcG0021179 dd_Smed_v4_1971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013312h1SMcG0021179 dd_Smed_v4_1971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013312h1SMcG0021179 dd_Smed_v4_1971_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30013312h1SMcG0021179 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30013312h1SMcG0021179 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013312h1SMcG0021179 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30013312h1SMcG0021179 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30013312h1SMcG0021178 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30013312h1SMcG0021178 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013312h1SMcG0021178 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30013312h1SMcG0021178 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013312h1SMcG0021179 dd_Smed_v4_1971_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calpain vs. Ensembl Human
Match: CAPN9 (calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486])

HSP 1 Score: 523.087 bits (1346), Expect = 1.486e-174
Identity = 294/683 (43.05%), Postives = 403/683 (59.00%), Query Frame = 2
Query:  383 ASKVQAKHTPKKKEDVGQQTSYFDLLEQ-LKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL-VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNA 2407
            A   QA   PK           F+ + Q     G L+ED DFPA  SS+F S+  +    FVWKRP +I KNP+    G +R D+ QG LGDCWLLA +ASL+L +     V+P DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ ET +   KE P   Y  + K  K+ +L+GC I++   A+ E     GLI GHAYS+T + +V    G  +EL+R+RNPWG + EW G WSDSSPEW ++  +E++RLC    +DGEFWM F DF  +F K+EIC+L P++L ED     +WE+ +  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   + ++ LMQKD R+ +  G   L IGY IY+  D +   LNK FF++  + A+S  FIN REV  R KLP G Y++IPSTF P++EA+F LRIFSEK   T  +D   G  +I            DQ   EE                 LF  +AG    + A +L  +LNA+L  K    FK   L  C+++++L D    GK+EF +F   W  +K W   F  FD D +G    +E R AL   G  +S+ L +++  RY D E+  + F+DF+  ++RL NA
Sbjct:    7 APGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSE--RPQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQT--KEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVS-FRGQRIELIRIRNPWG-QVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEED--AIHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKD-EHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMD---GNVDI-DLPEPPKPTPPDQETEEEQ------------RFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYAD-EELQLDFDDFLNCLVRLENA 661          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 504.982 bits (1299), Expect = 5.979e-167
Identity = 275/682 (40.32%), Postives = 415/682 (60.85%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL--VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L+ DP+FP D +S+F S+  K   +FVWKRP +IC+NP+   DG +R D+ QG LGDCW LA +A L+L + +   V+P DQ F +NY G F F+FWR+G+WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  ++ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T + +V    G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM+++DF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK N ++ ++               + +  D+PV +     +++    +++   +F  +AG    I A +L+ +LN ++   KD+K   GF LE CRS++AL D D +GK+  ++F  +W  IK W+  FK +D D +G  + +E RNA+ + G  ++N L+ ++  RY D     I F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   74 LYVDPEFPPDETSLFYSQ--KFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI--RDAPSDMYKIMKKAIERGSLMGCSIDTIIPVQYETRMACGLVRGHAYSVTGLDEVP-FKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVE---------------NTISVDRPVPQPG--SSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKT-HGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMY 728          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 501.13 bits (1289), Expect = 7.213e-165
Identity = 279/709 (39.35%), Postives = 422/709 (59.52%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNT--GTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLD--------IKNGKTNIAKHLRDTDDVDSDQPVSEESXX-------------------XXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL--VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L+ DP+FP D +S+F S+  K   +FVWKRP +IC+NP+   DG +R D+ QG LGDCW LA +A L+L + +   V+P DQ F +NY G F F+FWR+G+WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  ++ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T + +V    G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM+++DF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK N ++ ++        +K  KT     + D  + + +  V +ES+                     +++    +++   +F  +AG    I A +L+ +LN ++   KD+K   GF LE CRS++AL D D +GK+  ++F  +W  IK W+  FK +D D +G  + +E RNA+ + G  ++N L+ ++  RY D     I F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   74 LYVDPEFPPDETSLFYSQ--KFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI--RDAPSDMYKIMKKAIERGSLMGCSIDTIIPVQYETRMACGLVRGHAYSVTGLDEVP-FKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKT-HGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMY 772          
BLAST of Calpain vs. Ensembl Human
Match: CAPN2 (calpain 2 [Source:HGNC Symbol;Acc:HGNC:1479])

HSP 1 Score: 481.485 bits (1238), Expect = 3.234e-158
Identity = 270/672 (40.18%), Postives = 412/672 (61.31%), Query Frame = 2
Query:  476 TGKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQF--RXXXXXXXXXXXXNTGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVK--DIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETM-ELQPED 2437
             G L++DP FPA  S++    +   S   R   WKRP +IC +PQ    G +R D+ QGALGDCWLLA +ASL+L E I   VVP +Q F +NY G F F+FW++G+WVEVVVDDRLPT  G+L+F+HSA+ +EFWSALLEKAYAK+ G YE+LSGG+  E  EDFTGG+ E  +L  K+ P  L+  + K  ++ +L+GC+I+   +A  E +    L+ GHAYS+T  ++V +++G++ +L+R+RNPWG E EW G+W+D+ P W TI   E+ERL      DGEFWM+F DF ++++++EIC+L P++L  D    ++W++   DG+W +   AGGCRN+ ++F  NPQ+  ++E  D D+ED E+  T ++GL+QK   RQR +G     IG+ IY++ +   G     L+K+FF  +    +S  FIN REV  R KLP G Y+++PSTF PN++ +F +R+FSEK      +D    + N+ +     DD+D                        +LF  +AG    I+A +L+ IL  +L K  DIK+  GF +E C+ +V + D D +GK+  K+F  +W  I+ ++  +++ D D +G  + +E R AL   G  +   L +V+  R+ D ++ +I F++F+  ++RL   F+   +L PE+
Sbjct:   42 AGTLFQDPSFPAIPSALGFKELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYEL--KKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEEV-ESNGSLQKLIRIRNPWG-EVEWTGRWNDNCPSWNTIDPEERERLTRRH-EDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTY--KKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVD-DEIEANLEEFDISEDDIDDG--------------------FRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKS-DGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFAD-DQLIIDFDNFVRCLVRLETLFKIFKQLDPEN 683          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 482.256 bits (1240), Expect = 6.384e-157
Identity = 279/757 (36.86%), Postives = 421/757 (55.61%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESA---------------------------------------------------KIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNT--GTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLD--------IKNGKTNIAKHLRDTDDVDSDQPVSEESXX-------------------XXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL--VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L+ DP+FP D +S+F S+  K   +FVWKRP +IC+NP+   DG +R D+ QG LGDCW LA +A L+L + +   V+P DQ F +NY G F F+FWR+G+WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  ++ P  +Y  M K  ++ +LMGC+I+                                                     + E  MA GL+ GHAYS+T + +V    G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM+++DF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK N ++ ++        +K  KT     + D  + + +  V +ES+                     +++    +++   +F  +AG    I A +L+ +LN ++   KD+K   GF LE CRS++AL D D +GK+  ++F  +W  IK W+  FK +D D +G  + +E RNA+ + G  ++N L+ ++  RY D     I F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   74 LYVDPEFPPDETSLFYSQ--KFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI--RDAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQDSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVP-FKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKT-HGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMY 820          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 439.499 bits (1129), Expect = 5.827e-142
Identity = 231/477 (48.43%), Postives = 322/477 (67.51%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDP--NCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFS 1837
            +++L +Q   + +L+EDP F A+ SS+F SK      E  W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y + +   N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++
Sbjct:  257 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPPKRVE--WLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYT 728          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 439.499 bits (1129), Expect = 5.827e-142
Identity = 231/477 (48.43%), Postives = 322/477 (67.51%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDP--NCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFS 1837
            +++L +Q   + +L+EDP F A+ SS+F SK      E  W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y + +   N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++
Sbjct:  257 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPPKRVE--WLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYT 728          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 439.499 bits (1129), Expect = 5.827e-142
Identity = 231/477 (48.43%), Postives = 322/477 (67.51%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDP--NCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFS 1837
            +++L +Q   + +L+EDP F A+ SS+F SK      E  W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y + +   N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++
Sbjct:  257 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPPKRVE--WLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYT 728          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 438.343 bits (1126), Expect = 2.266e-141
Identity = 231/475 (48.63%), Postives = 321/475 (67.58%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFS 1837
            +++L +Q   + +L+EDP F A+ SS+F SK      E  W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y   + N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++
Sbjct:  282 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPPKRVE--WLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGN-NRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYT 750          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 438.728 bits (1127), Expect = 3.161e-141
Identity = 230/475 (48.42%), Postives = 321/475 (67.58%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFS 1837
            +++L +Q   + +L+EDP F A+ SS+F SK     +   W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y   + N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++
Sbjct:  303 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPP--KRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGN-NRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYT 771          
BLAST of Calpain vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0076343)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 305/695 (43.88%), Postives = 427/695 (61.44%), Query Frame = 2
Query:  455 LLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTV---VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK--SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLD--IKNGKTN--IAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L +     G ++EDPDFPA  +S+  S+    Y E  W RP DI  +PQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P DQDF +NY G F F+FW++GKWVEVV+DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E   +  KE P  L++ M+K A++ ++MGC++E     +E     GLI GHAYSIT V  +  +       + ++R+RNPWGN+ EW G WSDSSPEW  I +  KE +  NF  DGEFWM+F DF  +F ++EIC+L P+SL ED   S +R+WEM + +G W   + AGGCRNF+++F  NPQ+ + + DPDDED +   T I+ LMQK+ R +RN+G   L IG+ IY L D +  +  +  +FFK+  ++A+SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE  N  +  D  +  G+T+  IA  L      + D P                  L +LF+ +AG  E ++  +L+ IL+  +   +    GF  +  RS+VA+ D D +G++ F++F  +  DI  W+  FK +D    G  D F  R AL + G  ++N L   +A+RY   E G I F+DF+M  I++    E    +  D+     F  D++LE  +Y
Sbjct:  249 LRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYE--WLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI--KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDRIAPSLPPPTPKEEDDP--------------QRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSRE-GQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0304675)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 305/695 (43.88%), Postives = 427/695 (61.44%), Query Frame = 2
Query:  455 LLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTV---VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK--SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLD--IKNGKTN--IAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L +     G ++EDPDFPA  +S+  S+    Y E  W RP DI  +PQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P DQDF +NY G F F+FW++GKWVEVV+DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E   +  KE P  L++ M+K A++ ++MGC++E     +E     GLI GHAYSIT V  +  +       + ++R+RNPWGN+ EW G WSDSSPEW  I +  KE +  NF  DGEFWM+F DF  +F ++EIC+L P+SL ED   S +R+WEM + +G W   + AGGCRNF+++F  NPQ+ + + DPDDED +   T I+ LMQK+ R +RN+G   L IG+ IY L D +  +  +  +FFK+  ++A+SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE  N  +  D  +  G+T+  IA  L      + D P                  L +LF+ +AG  E ++  +L+ IL+  +   +    GF  +  RS+VA+ D D +G++ F++F  +  DI  W+  FK +D    G  D F  R AL + G  ++N L   +A+RY   E G I F+DF+M  I++    E    +  D+     F  D++LE  +Y
Sbjct:  249 LRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYE--WLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI--KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDRIAPSLPPPTPKEEDDP--------------QRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSRE-GQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086530)

HSP 1 Score: 487.649 bits (1254), Expect = 7.240e-163
Identity = 249/491 (50.71%), Postives = 329/491 (67.01%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDV---QKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK----SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKN 1876
            Y  +L     +G L+EDP FPA   S+  S+     R   W RP +I +NPQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P +Q F++NY G F FRFW++GKWV+V++DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GGS  EAMEDFTGG+ E   L  KE P  L+  + K A+++++MGC+IE      E     GLI GHAYSIT V     V       + ++R+RNPWGNE EW G WSDSSPEW  I + +K  +   F  DGEFWM+F DF  +F ++EIC+L P+SL ED   SGKR+WEM + +G W   + AGGCRNF+D+F  NPQ+ + +VDPD+ED E   TVI+ LMQK+ R +RN+G   L IG+ IY L D    L N+    +FF++ +++ +SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE  N  + + + N
Sbjct:   75 YETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL--KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRE--LENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMECVQVDN 559          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0112869)

HSP 1 Score: 485.723 bits (1249), Expect = 1.489e-158
Identity = 249/488 (51.02%), Postives = 327/488 (67.01%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDV---QKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK----SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLD 1867
            Y  +L     +G L+EDP FPA   S+  S+     R   W RP +I +NPQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P +Q F++NY G F FRFW++GKWV+V++DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GGS  EAMEDFTGG+ E   L  KE P  L+  + K A+++++MGC+IE      E     GLI GHAYSIT V     V       + ++R+RNPWGNE EW G WSDSSPEW  I + +K  +   F  DGEFWM+F DF  +F ++EIC+L P+SL ED   SGKR+WEM + +G W   + AGGCRNF+D+F  NPQ+ + +VDPD+ED E   TVI+ LMQK+ R +RN+G   L IG+ IY L D    L N+    +FF++ +++ +SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE  N  +  D
Sbjct:   75 YETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL--KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRE--LENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEEND 556          

HSP 2 Score: 83.5741 bits (205), Expect = 5.129e-16
Identity = 41/131 (31.30%), Postives = 72/131 (54.96%), Query Frame = 2
Query: 2099 GFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            GF  ++CRS+VA+ D D +GK+ F++F  +  +I  WK  FK +D +  G    F+ R AL + G  ++N +  V+ +RY     G I F+DFIM  +++    +  + +  +      FT +E++E  +Y
Sbjct:  698 GFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRY-GSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 827          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086529)

HSP 1 Score: 485.723 bits (1249), Expect = 1.489e-158
Identity = 249/488 (51.02%), Postives = 327/488 (67.01%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDV---QKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK----SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLD 1867
            Y  +L     +G L+EDP FPA   S+  S+     R   W RP +I +NPQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P +Q F++NY G F FRFW++GKWV+V++DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GGS  EAMEDFTGG+ E   L  KE P  L+  + K A+++++MGC+IE      E     GLI GHAYSIT V     V       + ++R+RNPWGNE EW G WSDSSPEW  I + +K  +   F  DGEFWM+F DF  +F ++EIC+L P+SL ED   SGKR+WEM + +G W   + AGGCRNF+D+F  NPQ+ + +VDPD+ED E   TVI+ LMQK+ R +RN+G   L IG+ IY L D    L N+    +FF++ +++ +SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE  N  +  D
Sbjct:   75 YETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL--KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRE--LENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEEND 556          

HSP 2 Score: 83.5741 bits (205), Expect = 5.129e-16
Identity = 41/131 (31.30%), Postives = 72/131 (54.96%), Query Frame = 2
Query: 2099 GFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            GF  ++CRS+VA+ D D +GK+ F++F  +  +I  WK  FK +D +  G    F+ R AL + G  ++N +  V+ +RY     G I F+DFIM  +++    +  + +  +      FT +E++E  +Y
Sbjct:  698 GFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRY-GSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIY 827          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 524.242 bits (1349), Expect = 3.517e-175
Identity = 292/686 (42.57%), Postives = 423/686 (61.66%), Query Frame = 2
Query:  443 SYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL--VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFL 2476
            +Y  L  +    GKL+EDPDFPA   S+F S+  +    F WKRP +ICK PQ    G +R D+ QG LGDCWLLA +ASL+L E     VVP DQ FD+ Y G F F+FW+  KW++VVVDDRLP    KLVF+HSADNNEFWSALLEKAYAK+ G YE+L GGS +EAMEDFTGG+ E  +   K  P  L+  + K  ++ +++GC+I+   SA+ E   + GL+ GHAYS+T V++V    G  V+L+RVRNPWG + EW G WSD+S EW  I  SEK+RL  N  +DGEFWM F DF  N+ K+EIC+L P++L++D+S  ++W + + +GSW +   AGGCRN+ID+F TNPQF+  +   + +D +   +VI+ LMQK+   +R+  L    IG+ IY+  D +     K FF+++ + A+S  +IN REV  R +LP G+Y+++P+TF P++EA+F++R+FSEK  K   +++ N    I   L +    +  +  ++E            K L KLF  +AGP  VI+A +L+ +LN +L   K++K F G  L  C S++ L D D +G MEF +F   W  +K W   F  +D D +G    +E R+AL   G+ ++N + +++  R+ D EK  I F+D++  ++RL N F   +      +G       +FL
Sbjct:   26 TYEQLRRECLEKGKLFEDPDFPAVDGSLFYSQ--RVPVNFEWKRPGEICKEPQFITGGATRTDICQGQLGDCWLLAAIASLTLKEETLNRVVPNDQTFDRGYAGIFHFQFWQHNKWMDVVVDDRLPCVRDKLVFLHSADNNEFWSALLEKAYAKLNGSYEALKGGSTMEAMEDFTGGVGEMYE--TKNGPNNLFLILKKAIERGSMLGCSIDITSSAESEAQTSTGLVKGHAYSVTGVEEVNYR-GAKVQLIRVRNPWG-QVEWNGPWSDNSREWTVIDSSEKKRLLQNSLDDGEFWMEFGDFKSNYDKVEICNLSPDALSDDVS--KQWAVNLFEGSWIRGSTAGGCRNYIDTFWTNPQFK--LHLENPDDGDKLCSVIVALMQKNRRRLRKEGLDLETIGFAIYEAPD-DQDHQGKDFFRYNPSKARSRTYINVREVSERFRLPPGNYLLVPTTFQPHKEADFLIRLFSEK--KAGAIEVGN---KIEADLPEPPKPNPPEEETDEE-----------KGLRKLFEQVAGPDNVISARELQHVLNNVLGRRKEVK-FDGLSLNTCISIINLMDVDGSGMMEFSEFKVFWDKLKKWIMLFLSYDVDRSGTMSSYELRSALNAAGMKLNNRILQLLGLRFAD-EKLEIDFDDYLTCIVRLENMFRIFQALDAQKKGEVSLNMHQFL 682          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 507.679 bits (1306), Expect = 2.247e-168
Identity = 291/679 (42.86%), Postives = 413/679 (60.82%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGT--VVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGFLV--IGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L+EDP FPA  SS+F S+  K   +  WKRP +ICKNPQ    G +R D+ QG LGDCWLLA +A L+L + I K VVP DQ F +NY G F F+FWR+G+WV+VV+DDRLPTY  KLVF  S  NNEFWSAL+EKAYAK+ G YE+L GG+ +EAMEDFTGG+ E  ++ E   P  LYN M K  K+ +LMGCAI++          A+GL+ GHAYS+T V++ K+ DG   ++ LVRVR+PWG       K +D    W  ++K+E+++        GEFWM F++F KNFTK+EIC+L P++L +D   K  W + + +G W K  +AGGCRNF D++ TNPQFR  +V  + +  E T TV++ LMQK  R +R  G  +  IG+ IY++K      L+K FF ++ + A+S  ++N REV  R  L  G YVIIPSTF+P++E+ F+LR+FSE  + +  +D        A+   +   VD+   V ++ K   E+    EK+   +F  +AG    INA +LR +LN ++   K++K  +GF LE CRS++AL D D TG +  ++F  +W  IK WK  F  FD D +     FE RNAL   G  ++N L+ ++  RY + E   + F+ +I  ++RL   F       +D +G       E+L+  +Y
Sbjct:   65 LFEDPLFPAQDSSLFYSE--KFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEITEA--PKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWGVAPPPACKSND----WVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQMFK--WNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFR--LVLLEADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEMKGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVID--------AEIEAEPMQVDN---VKKKIKPFEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKHKELKT-EGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYAN-EHMELDFDSYISCLVRLEGMFRAFRAFDKDGDGLIKLNVFEWLQLTMY 718          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 507.679 bits (1306), Expect = 2.977e-168
Identity = 287/699 (41.06%), Postives = 425/699 (60.80%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDG--TVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMR-QRNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEV------------INACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L+ED  FPA   S+    +   S   +  VWKRPK+IC NPQ    G SR D+ QG LGDCWLLA +A L+L + +   V+P +Q F + Y G F F+FWR+G WV+VVVDDR+PT+  +LVF  SA+ NEFWSALLEKAYAK+ G YE+L GG+  E MEDFTGG+ E  ++  KE P  LY  M K  ++ +LMGC+I+S   A+ E   A GL+ GHAYS+T V++ KQ+    + V LVR+RNPWG + EW G WSD+S EWE++SK+EKE+L    A DGEFWM+F+DF KN+TKIEIC+L P++L +D   K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+ +++ DD+  ++    T ++ LMQK+ R +R LG   L IG+ IY++     G    + K FF  +T  A+S  +IN REV  R +L  G YVIIPS++ P++E  F+LR+FSEK N ++ ++               + +++D PV   S     +    +++   +F  +AG +              ++A +L+D+LN ++   KDI   + F  E CRS++AL D D TG++  ++F ++W  IK W+  FK +D D N     +E RNA+ + G  ++N L+ ++  RY + E   + FE FI  ++RL   F   +   +  +G+   +  E+L+  +Y
Sbjct:   50 LFEDETFPATVDSLGYKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNDKLLYRVIPQEQSFSEQYAGIFHFQFWRYGDWVDVVVDDRIPTFNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTAEGMEDFTGGVTEFYEM--KEAPKELYKIMQKALERGSLMGCSIDSLVPARFETRTATGLVKGHAYSVTAVEECKQSQQKESRVRLVRLRNPWG-QVEWNGPWSDNSKEWESLSKAEKEKLQQQNAEDGEFWMSFEDFKKNYTKIEICNLTPDALEDDKLHK--WTVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPEDDEVACTFVVALMQKNRRKERKLGANLLTIGFSIYEVPKEMHGNKQHMQKEFFMSTTAKARSRAYINLREVTQRFRLSPGEYVIIPSSYEPHQEGEFILRVFSEKRNTSEEIE---------------NRIEADHPVP--SPASTGEESEEDQQFLSIFQHIAGDVSTGEAVSAWGSNMEVSANELKDVLNKVVSKHKDIHT-ESFSRECCRSMIALMDMDGTGRLNLQEFRQLWNKIKQWQEIFKRYDFDHNDTISSYEMRNAINDAGFRLNNQLYDIITMRYAN-ESMNVDFESFISCLVRLEGMFRAFQAFDQCGDGSIRLSVLEWLQLTMY 724          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 501.901 bits (1291), Expect = 4.672e-166
Identity = 291/683 (42.61%), Postives = 413/683 (60.47%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGT--VVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGFLV--IGYVIY----KLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L+EDP FPA  SS+F S+  K   +  WKRP +ICKNPQ    G +R D+ QG LGDCWLLA +A L+L + I K VVP DQ F +NY G F F+FWR+G+WV+VV+DDRLPTY  KLVF  S  NNEFWSAL+EKAYAK+ G YE+L GG+ +EAMEDFTGG+ E  ++ E   P  LYN M K  K+ +LMGCAI++          A+GL+ GHAYS+T V++ K+ DG   ++ LVRVR+PWG       K +D    W  ++K+E+++        GEFWM F++F KNFTK+EIC+L P++L +D   K  W + + +G W K  +AGGCRNF D++ TNPQFR  +V  + +  E T TV++ LMQK  R +R  G  +  IG+ IY    ++K      L+K FF ++ + A+S  ++N REV  R  L  G YVIIPSTF+P++E+ F+LR+FSE  + +  +D        A+   +   VD+   V ++ K   E+    EK+   +F  +AG    INA +LR +LN ++   K++K  +GF LE CRS++AL D D TG +  ++F  +W  IK WK  F  FD D +     FE RNAL   G  ++N L+ ++  RY + E   + F+ +I  ++RL   F       +D +G       E+L+  +Y
Sbjct:   65 LFEDPLFPAQDSSLFYSE--KFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEITEA--PKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWGVAPPPACKSND----WVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQMFK--WNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFR--LVLLEADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEVPKEMKGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVID--------AEIEAEPMQVDN---VKKKIKPFEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKHKELKT-EGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYAN-EHMELDFDSYISCLVRLEGMFRAFRAFDKDGDGLIKLNVFEWLQLTMY 722          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 489.574 bits (1259), Expect = 2.139e-161
Identity = 280/668 (41.92%), Postives = 394/668 (58.98%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGT--VVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGFLV--IGYVIYKLKDPNCG----LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEG 2446
            L+EDP FPA  SS+F S+  K   +  WKRP +ICKNPQ    G +R D+ QG LGDCWLLA +A L+L + I K VVP DQ F +NY G F F+FWR+G+WV+VV+DDRLPTY  KLVF  S  NNEFWSAL+EKAYAK+ G YE+L GG+ +EAMEDFTGG+ E  ++ E   P  LYN M K  K+ +LMGCAI++          A+GL+ GHAYS+T V++ K+ DG   ++ LVRVR+PWG       K +D    W  ++K+E+++        GEFWM F++F KNFTK+EIC+L P++L +D   K  W + + +G W K  +AGGCRNF D++ TNPQFR  +V  + +  E T TV++ LMQK  R +R  G  +  IG+ IY++     G     L+K FF ++ + A+S  ++N REV  R  L  G YVIIPSTF+P++E+ F+LR++    N + +   +  +T   K  R                               +F  +AG    INA +LR +LN ++   K++K  +GF LE CRS++AL D D TG +  ++F  +W  IK WK  F  FD D +     FE RNAL   G  ++N L+ ++  RY + E   + F+ +I  ++RL   F       +D +G
Sbjct:   74 LFEDPLFPAQDSSLFYSE--KFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEITEA--PKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWGVAPPPACKSND----WVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQMFK--WNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFR--LVLLEADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEVCSNKHGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRLY----NISHSQPFEEEETEEEKQFR------------------------------AIFQQIAGDDMEINANELRTVLNRVVAKHKELKT-EGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYAN-EHMELDFDSYISCLVRLEGMFRAFRAFDKDGDG 693          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 518.079 bits (1333), Expect = 1.129e-171
Identity = 287/717 (40.03%), Postives = 432/717 (60.25%), Query Frame = 2
Query:  431 GQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIK------------NGKTNIAKHLR-----DTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFK--GFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            G++ ++ +L ++       ++D +FP D SS+F S++     +F WKRP +IC+NPQ    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ+F  NY G F F+FWR+G WV+V++DD LPTY  +LVF  S+  NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  +L  KE P  +YN M K  ++ +L+GC+I++    ++E  MANGL+ GHAYS+T V++ K   G  ++LVR+RNPWG + EW G W D++ EW  + KSEK RL      DGEFWM++DDF KNFTK EIC+L P++L+ D    + W + + +G W +  +AGGCRN+ D++ TNPQ+R+++++ DD+ ++N    + ++ LMQK+ R+ R  G     IG+ IY++     G    L K FF ++ + AK   +IN REVC R +LP   YVIIPST+ P++E  F+LR+FSEK N ++ ++ K            + ++N  K L      D D    D    +++    +     EK+   +F  +AG    I+A +L+ +LN ++ K  K  K  GF LE CRS++AL D D  G++  ++F  +W+ IK W+  F  FD D +G    FE RNA+   G  ++N L+ ++  RY + ++  + F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   47 GREKTFEELRKKCLQRNFHFQDREFPPDESSLFYSQSFP--IKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDTLVPVQLETRMANGLVKGHAYSVTGVEETK-LKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSD--SLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNKH-KTLKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYAN-KRMDLDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMY 753          
BLAST of Calpain vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 511.531 bits (1316), Expect = 4.952e-170
Identity = 290/688 (42.15%), Postives = 415/688 (60.32%), Query Frame = 2
Query:  410 PKKKEDVGQQT-----SYFDLLEQLKG----TGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL--VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETME 2422
            P  KE + QQT     S     EQLK      G L+ED DFPA+ SS+F S+  K    FVWKRPK++  +P+    G SR DV QG LGDCWLLA +ASL+L + I   VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD NEFWSALLEKAYAK+ G YE+L GGS +EAMEDFTGG+ ET ++  +  P  L++ + K  K+ +++GC+I+   SA+ E     GL+ GHAYSIT    V    G  V+L+R+RNPWG + EW G WSD+S EW  I  +EK RL     +DGEFWM F+DF ++F K+EIC+L P+SL++D   K +WE+ + +GSW +   AGGCRNF+++F +NPQ +  +   + +D +   T I  LMQK+   +R+     L IGY IY+       +L+K FFKF+ + A+S  ++N RE+  R KLP G Y+ IP+TF P++EA+F LRIFSEK      +D   G+ NI   L D          +EE            ++   LF  ++G    ++A +L+ +LNA+L   K+IK FK   L  C ++++L D    GK+ F +F   W  +K W   F  +D D +G    +E R AL + G  ++N + +++  RY D ++  I F+DF+  ++RL N++   +
Sbjct:    8 PSLKESIAQQTPRSIHSSGKTYEQLKNDCLRKGVLFEDVDFPANDSSLFYSE--KPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFSTGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEI--RSAPANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGAD-VVNFKGQKVKLIRIRNPWG-QVEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDSLDDD--AKHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQIK--LSLTEQDDGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPGSE-SILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMD---GEVNI--DLPDPPAPTPPHKETEEE-----------RQFRTLFEQISGQDLEVSAEELQYVLNAVLRRTKNIK-FKEMSLLSCNNIISLMDASGNGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYAD-DQFQIEFDDFLNCLVRLENSYRVFK 666          
BLAST of Calpain vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 509.605 bits (1311), Expect = 2.583e-168
Identity = 290/688 (42.15%), Postives = 415/688 (60.32%), Query Frame = 2
Query:  410 PKKKEDVGQQT-----SYFDLLEQLKG----TGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL--VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETME 2422
            P  KE + QQT     S     EQLK      G L+ED DFPA+ SS+F S+  K    FVWKRPK++  +P+    G SR DV QG LGDCWLLA +ASL+L + I   VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD NEFWSALLEKAYAK+ G YE+L GGS +EAMEDFTGG+ ET ++  +  P  L++ + K  K+ +++GC+I+   SA+ E     GL+ GHAYSIT    V    G  V+L+R+RNPWG + EW G WSD+S EW  I  +EK RL     +DGEFWM F+DF ++F K+EIC+L P+SL++D   K +WE+ + +GSW +   AGGCRNF+++F +NPQ +  +   + +D +   T I  LMQK+   +R+     L IGY IY+       +L+K FFKF+ + A+S  ++N RE+  R KLP G Y+ IP+TF P++EA+F LRIFSEK      +D   G+ NI   L D          +EE            ++   LF  ++G    ++A +L+ +LNA+L   K+IK FK   L  C ++++L D    GK+ F +F   W  +K W   F  +D D +G    +E R AL + G  ++N + +++  RY D ++  I F+DF+  ++RL N++   +
Sbjct:    8 PSLKESIAQQTPRSIHSSGKTYEQLKNDCLRKGVLFEDVDFPANDSSLFYSE--KPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFSTGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEI--RSAPANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGAD-VVNFKGQKVKLIRIRNPWG-QVEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDSLDDD--AKHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQIK--LSLTEQDDGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPGSE-SILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMD---GEVNI--DLPDPPAPTPPHKETEEE-----------RQFRTLFEQISGQDLEVSAEELQYVLNAVLRRTKNIK-FKEMSLLSCNNIISLMDASGNGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYAD-DQFQIEFDDFLNCLVRLENSYRVFK 666          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 501.516 bits (1290), Expect = 6.727e-165
Identity = 289/757 (38.18%), Postives = 426/757 (56.27%), Query Frame = 2
Query:  455 LLEQLKGTGKLWEDPDFPADTSSV----FVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES-----------------------------------------------AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIK------------NGKTNIAKHLR-----DTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFK--GFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L  +  G  KL+EDP F     S+    F  K++K  +  +WKRPK+IC+NPQ    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ+F  NY G F F+FWR+G WV+V++DD LPTY  +LVF  S+  NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  +L  KE P  +YN M K  ++ +L+GC+I+                                                 ++E  MANGL+ GHAYS+T V++ K   G  ++LVR+RNPWG + EW G W D++ EW  + KSEK RL      DGEFWM++DDF KNFTK EIC+L P++L+ D    + W + + +G W +  +AGGCRN+ D++ TNPQ+R+++++ DD+ ++N    + ++ LMQK+ R+ R  G     IG+ IY++     G    L K FF ++ + AK   +IN REVC R +LP   YVIIPST+ P++E  F+LR+FSEK N ++ ++ K            + ++N  K L      D D    D    +++    +     EK+   +F  +AG    I+A +L+ +LN ++ K  K  K  GF LE CRS++AL D D  G++  ++F  +W+ IK W+  F  FD D +G    FE RNA+   G  ++N L+ ++  RY + ++  + F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   40 LKSEFVGKKKLFEDPIFLPAVQSLGQKEFAQKSTK-LKNIIWKRPKEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDDKYGSSCGFAPPSNMEDAIMKMIESVGDTRPDTNGRGQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEETK-LKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSD--SLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNKH-KTLKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYAN-KRMDLDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMY 787          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 499.975 bits (1286), Expect = 3.790e-164
Identity = 287/761 (37.71%), Postives = 431/761 (56.64%), Query Frame = 2
Query:  431 GQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE-----------------------------------------------SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIK------------NGKTNIAKHLR-----DTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFK--GFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            G++ ++ +L ++       ++D +FP D SS+F S++     +F WKRP +IC+NPQ    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ+F  NY G F F+FWR+G WV+V++DD LPTY  +LVF  S+  NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  +L  KE P  +YN M K  ++ +L+GC+I+                                                 ++E  MANGL+ GHAYS+T V++ K   G  ++LVR+RNPWG + EW G W D++ EW  + KSEK RL      DGEFWM++DDF KNFTK EIC+L P++L+ D    + W + + +G W +  +AGGCRN+ D++ TNPQ+R+++++ DD+ ++N    + ++ LMQK+ R+ R  G     IG+ IY++     G    L K FF ++ + AK   +IN REVC R +LP   YVIIPST+ P++E  F+LR+FSEK N ++ ++ K            + ++N  K L      D D    D    +++    +     EK+   +F  +AG    I+A +L+ +LN ++ K  K  K  GF LE CRS++AL D D  G++  ++F  +W+ IK W+  F  FD D +G    FE RNA+   G  ++N L+ ++  RY + ++  + F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   47 GREKTFEELRKKCLQRNFHFQDREFPPDESSLFYSQSFP--IKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDDKYGSSCGFAPPSNMEDAIMKMIESVGDTRPDTNGRGQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEETK-LKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSD--SLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNKH-KTLKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYAN-KRMDLDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMY 797          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn9 (calpain 9 [Source:MGI Symbol;Acc:MGI:1920897])

HSP 1 Score: 511.916 bits (1317), Expect = 2.577e-170
Identity = 285/694 (41.07%), Postives = 414/694 (59.65%), Query Frame = 2
Query:  389 KVQAKHTPKKKEDVGQQTSYFDLLEQ-LKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIK-NFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNA---FETMELQPED 2437
            + Q +  P     +      F+ L Q    +G L+ED DFPA   S+F S+  +    FVWKRP +I + P+    G +R D+ QG LGDCWLLA +ASL+L +     VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ E  ++  +E P   +  + K  K+ +L+GC+I++   ++ E   + GLI GHAY++T + +V    G  ++L+RVRNPWG + EW G WSDSSPEW ++   E++RL     +DGEFWM F DF  +F K+EIC+L P++L +  S   RWE+ I  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   T +  LMQKD R+ +  G   L IGY IY+  D + G L++ FF++  ++A+S  FIN REV  R +LP G Y++IPSTF P++EA+F LRIFSEK   T  LD               +++D D P         E+    E++   LF  +AG    ++A +L  +LNA+L K     FK   L  CR++++L D    GK+EF++F   W  +K W   F  FD D +G    +E R AL   G  +   L +++  RY D E   + F+D++  ++RL NA   F+++ ++ +D
Sbjct:    9 RPQPQPVPGDARTIHSSGQSFEQLRQGCLQSGTLFEDADFPASNVSLFYSERPQ--VPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI--REAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQVN-FHGQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSVDLEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDALED--SALHRWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRIFSEKRAVTRDLD---------------ENIDIDLP-ELPKPTPQEEETEEEQQFRALFQRVAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYAD-EDLQLDFDDYLNCLVRLENASRVFQSLSVKNKD 674          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 502.286 bits (1292), Expect = 4.487e-166
Identity = 275/682 (40.32%), Postives = 413/682 (60.56%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNT--GTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL--VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L+ DP+FP D +S+F S+  K   +FVWKRP +IC+NP+    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ F +NY G F F+FWR+G WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  K+ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T +++     G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM++DDF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK N ++  +               + +  D+PV        ++    +++   +F  +AG    I A +L+++LN ++   KD+K  +GF LE CRS++AL D D +G++  ++F  +WK IK W+  FK +D D +G  + +E RNA+ + G  +++ L+ ++  RY D     I F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   74 LYLDPEFPPDETSLFYSQ--KFPIQFVWKRPPEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI--KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEA-LFKGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAE---------------NTISVDRPVPRPG--HTDQESEEQQQFRNIFRQIAGDDMEICADELKNVLNTVVNKHKDLKT-QGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMY 728          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 492.656 bits (1267), Expect = 1.500e-162
Identity = 273/694 (39.34%), Postives = 412/694 (59.37%), Query Frame = 2
Query:  455 LLEQLKGTGKLWEDPDFPADTSSVFVSKASKG--YREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL--VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L +Q      L+ED  FPA   ++   + S+    +   WKRPK+IC+NP+    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ F +NY G F F+FWR+G WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  K+ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T +++     G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM++DDF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK N ++  +               + +  D+PV        ++    +++   +F  +AG    I A +L+++LN ++   KD+K  +GF LE CRS++AL D D +G++  ++F  +WK IK W+  FK +D D +G  + +E RNA+ + G  +++ L+ ++  RY D     I F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   40 LKQQCLAQKCLFEDRVFPAGVQALGSHELSQKAKMKAITWKRPKEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI--KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEA-LFKGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAE---------------NTISVDRPVPRPG--HTDQESEEQQQFRNIFRQIAGDDMEICADELKNVLNTVVNKHKDLKT-QGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMY 708          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 481.485 bits (1238), Expect = 6.792e-158
Identity = 273/722 (37.81%), Postives = 412/722 (57.06%), Query Frame = 2
Query:  455 LLEQLKGTGKLWEDPDFPADTSSVFVSKASKG--YREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV------------------------------KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L +Q      L+ED  FPA   ++   + S+    +   WKRPK+IC+NP+    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ F +NY G F F+FWR+G WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  K+ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T +++     G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM++DDF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK N ++  +               + +  D+PV        ++    +++   +F  +AG    I A +L+++LN ++                               KD+K  +GF LE CRS++AL D D +G++  ++F  +WK IK W+  FK +D D +G  + +E RNA+ + G  +++ L+ ++  RY D     I F+ FI   +RL   F       +D +G       E+L+  +Y
Sbjct:   40 LKQQCLAQKCLFEDRVFPAGVQALGSHELSQKAKMKAITWKRPKEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI--KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEA-LFKGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAE---------------NTISVDRPVPRPG--HTDQESEEQQQFRNIFRQIAGDDMEICADELKNVLNTVVNKRERPTPDVGDGQGPQLSESSSSPFSIPPDKDLKT-QGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMY 736          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn8 (calpain 8 [Source:MGI Symbol;Acc:MGI:2181366])

HSP 1 Score: 474.937 bits (1221), Expect = 7.795e-156
Identity = 277/696 (39.80%), Postives = 403/696 (57.90%), Query Frame = 2
Query:  455 LLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYRE---FVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTG----TVIIGLMQKDMRQRNL---GFLVIGYVIYK----LKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAK--HLRDTDDVDSD-QPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVK--DIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFL 2476
            L +Q   +G L++DP+FPA  S++       G  E    +WKRP ++C NPQ    G +R D++QG LGDCWLLA +ASL+L E +   VVP DQ F KNY G F F+FW++G+WVEVV+DDRLPT  G+L+F+HS + NEFWSALLEKAYAK+ G YE+L+GGS IE  EDFTGG+ E   L  ++ P  LY  + K  ++ +L+GC+I+   +A+ E      L+ GHAYS+T V++V    G   +L+R+RNPWG E EW G WSDS+PEW  I   +K  L    A DGEFWM+F DF K F+++EIC+L P+SL+ +   K  W + + +G W +   AGGC+N+  ++ TNPQF++ + + D++  E T     TV++GLMQK+ R++     G L IGY +Y+    L++     L + FF+       S  ++N REV  R +LP G Y+++PSTF P ++ +F LR+FSEK  K   L+I +         H RD D  D     +SEE                      A     I+A QL+ +LN +L K  D+K F GF++  CR +++L D D TG +   +F  +W  I  +   +++ D    G  D  E R AL   G +++N + + +A RY   + GV  F+ F+  +IRL   F+   L  +D  G    +  E+L
Sbjct:   35 LRKQCLNSGVLFKDPEFPACPSALGYRDLGPGSAETQGIIWKRPTELCSNPQFIVGGATRTDIRQGGLGDCWLLAAIASLTLNEKLLYRVVPRDQSFQKNYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEEGNEFWSALLEKAYAKLNGSYEALAGGSTIEGFEDFTGGISEFYDL--RKPPGNLYYTIQKALRKGSLLGCSIDVSNAAEAEATTRQKLVKGHAYSVTGVEEV-DFRGLPEKLIRLRNPWG-EVEWTGAWSDSAPEWNYIDPQKKGEL-DKRAEDGEFWMSFSDFLKQFSRLEICNLSPDSLSSEEIHK--WNLVLFNGRWTRGSTAGGCQNYPATYWTNPQFKIHLDEVDEDQEEGTSEPCCTVLLGLMQKNRRRQRRIGQGMLSIGYAVYQIPKELENHTDEHLGRDFFQGRQPSTCSSTYMNLREVSSRVQLPPGQYLVVPSTFEPFKDGDFCLRVFSEK--KAQALEIGDAVAGDPHEPHPRDMDGEDEHFWSLSEE---------------------FADKDSEISAHQLKRVLNGLLSKRTDMK-FDGFNINTCREMISLLDGDGTGSLRPVEFKTLWLKICKYLEIYQEMDHSRAGTIDAHEMRTALKKAGFTLNNQVQQTIATRYACSKLGV-DFDGFVACMIRLEILFKLFRLLDKDQNGIVQLSLAEWL 698          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|P27730|CAN_SCHMA (Calpain OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 324/697 (46.48%), Postives = 442/697 (63.41%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFV-WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFD-KNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGK--LVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESL--NEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQR-NLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNI------AKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGP-MEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            Y  L+++LK    LWEDPDFPA+  ++        +RE + WKRP +I  N + FA G SRFD++QGALGDCWLLAVVAS+S Y  +F  VVP DQ+     Y+G  RFRFWRFG WVEV++DDRLP   G+  LVFMHS D  EFWSALLEKAYAK+ G Y  LSGGSQ EAMED TGG+C +++LN+KERP  L +Q+  +A++  LMGC+I+S+ +E  M NGLI  HAYS+T V  V    G    L+R+RNPWG+  EWKG W D SP+W  IS+ EK+ +  +F  DGEFWM+++DF   F+++E+CHLG ESL  N++  GKRR +  I  G W +N+NAGGC N   ++ T+PQFR+ V DPD +D +N  +V+IGLMQ D+R++    F  IG+++Y   D    LL+++     + IAKS  FIN REV  + ++P G YV+IPSTF+PN E NF+LR+FS+       LD  N    +      A  L DT  +D DQ + ++                  F  +  P    INA +L ++LN   ++DI NF+GF+ ELCRS+VA  D + TG +E  +FM +W   K WK  F   D D +G F  +EFR AL + G  VSN L   + NRY DP    I+FEDF++ ++RL  AFET+E  P++ EG  +F+A+++L   +Y+
Sbjct:   86 YETLVKRLKTERTLWEDPDFPANDKAI---GNLPDFRERIEWKRPHEINPNAKFFAGGASRFDIEQGALGDCWLLAVVASISGYPQLFDQVVPKDQELKGPEYVGVVRFRFWRFGHWVEVLIDDRLPVRQGRNTLVFMHSNDPTEFWSALLEKAYAKLNGCYAHLSGGSQSEAMEDLTGGICLSLELNQKERPSDLIDQLKIYAQRCCLMGCSIDSSVMEQKMDNGLIGSHAYSLTGVYPVNYR-GRTQWLMRLRNPWGDSHEWKGAWCDGSPQWREISEQEKKNINLSFTADGEFWMSYEDFVTCFSRVEVCHLGLESLEYNQNFHGKRRLDEAIFSGQWQRNVNAGGCINNRTTYWTSPQFRITVEDPDPDDDDNKCSVLIGLMQTDIRKKVGADFQPIGFMVYNAPDDLNTLLSRAQLLTRSPIAKS-QFINTREVTAQFRVPPGSYVVIPSTFDPNIEVNFILRVFSQTSITEQELDEDNTNQGLPDDVIEALKLEDTL-LDEDQEIEQK------------------FLAIRDPKTNAINAVKLGELLNNSTLQDIPNFQGFNKELCRSMVASVDNNLTGHVELNEFMDLWIQAKGWKHIFIKHDVDQSGYFSAYEFREALNDAGYHVSNRLINAIINRYQDPGTDKISFEDFMLCMVRLKTAFETIEAHPKNIEGTSLFSAEDYLRFSVYI 758          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|Q9VT65|CANB_DROME (Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 305/695 (43.88%), Postives = 427/695 (61.44%), Query Frame = 2
Query:  455 LLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTV---VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK--SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLD--IKNGKTN--IAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L +     G ++EDPDFPA  +S+  S+    Y E  W RP DI  +PQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P DQDF +NY G F F+FW++GKWVEVV+DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E   +  KE P  L++ M+K A++ ++MGC++E     +E     GLI GHAYSIT V  +  +       + ++R+RNPWGN+ EW G WSDSSPEW  I +  KE +  NF  DGEFWM+F DF  +F ++EIC+L P+SL ED   S +R+WEM + +G W   + AGGCRNF+++F  NPQ+ + + DPDDED +   T I+ LMQK+ R +RN+G   L IG+ IY L D +  +  +  +FFK+  ++A+SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE  N  +  D  +  G+T+  IA  L      + D P                  L +LF+ +AG  E ++  +L+ IL+  +   +    GF  +  RS+VA+ D D +G++ F++F  +  DI  W+  FK +D    G  D F  R AL + G  ++N L   +A+RY   E G I F+DF+M  I++    E    +  D+     F  D++LE  +Y
Sbjct:  249 LRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYE--WLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI--KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDRIAPSLPPPTPKEEDDP--------------QRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSRE-GQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIY 924          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|O35920|CAN9_RAT (Calpain-9 OS=Rattus norvegicus OX=10116 GN=Capn9 PE=2 SV=2)

HSP 1 Score: 526.554 bits (1355), Expect = 4.447e-175
Identity = 290/681 (42.58%), Postives = 413/681 (60.65%), Query Frame = 2
Query:  389 KVQAKHTPKKKEDVGQQTSYFDLLEQ-LKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIK-NFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNA 2407
            + Q +  P+    V      F+ L Q    +G L+ED DFPA  SS+F S+  +    FVWKRP +I +NP+    G +R D+ QG LGDCWLLA +ASL+L +     VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ E  ++  +E P   Y  + K  ++ +L+GC+I++   ++ E     GLI GHAY++T + +V    G  ++L+RVRNPWG + EW G WSDSSPEW ++S  E++RL     +DGEFWM F+DF  +F K+EIC+L P++L ++   K  WE+ I  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   T +  LMQKD R+ +  G   L IGY IY+  D + G LN+ FF++  ++A+S  FIN REV GR +LP G Y++IPSTF P++EA+F LRIFSEK   T  LD      NI     D D  +  +P  +E           E++   LF  +AG    ++A +L  +LNA+L K     FK   L  CR++++L D    GKMEF++F   W  ++ W   F  FD D +G    +E R AL   G  + + L +++  RY D E   + F+D++  ++RL NA
Sbjct:    9 RPQPQPVPRDARTVHSSGHSFEQLRQSCLQSGTLFEDADFPASNSSLFYSERPQ--VPFVWKRPGEIVENPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI--REAPEDFYEILEKALRRGSLLGCSIDTLNASESEARTPLGLIKGHAYTVTGLDQVN-FHGQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSMSLEEQKRLGHTALDDGEFWMAFEDFKTHFDKVEICNLTPDALEDNTLHK--WEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLNRDFFRYHASLARSKTFINLREVSGRFQLPPGDYILIPSTFEPHQEADFCLRIFSEKKAVTQDLD-----ENI-----DIDLPELPKPTPQEE------ETEEERQFRALFRRIAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKMEFEEFRVFWDKLRYWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGSHLLQLIVLRYAD-ENLQLDFDDYLNCLVRLENA 661          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|O14815|CAN9_HUMAN (Calpain-9 OS=Homo sapiens OX=9606 GN=CAPN9 PE=1 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 7.134e-174
Identity = 294/683 (43.05%), Postives = 403/683 (59.00%), Query Frame = 2
Query:  383 ASKVQAKHTPKKKEDVGQQTSYFDLLEQ-LKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAIL-VKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNA 2407
            A   QA   PK           F+ + Q     G L+ED DFPA  SS+F S+  +    FVWKRP +I KNP+    G +R D+ QG LGDCWLLA +ASL+L +     V+P DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ ET +   KE P   Y  + K  K+ +L+GC I++   A+ E     GLI GHAYS+T + +V    G  +EL+R+RNPWG + EW G WSDSSPEW ++  +E++RLC    +DGEFWM F DF  +F K+EIC+L P++L ED     +WE+ +  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   + ++ LMQKD R+ +  G   L IGY IY+  D +   LNK FF++  + A+S  FIN REV  R KLP G Y++IPSTF P++EA+F LRIFSEK   T  +D   G  +I            DQ   EE                 LF  +AG    + A +L  +LNA+L  K    FK   L  C+++++L D    GK+EF +F   W  +K W   F  FD D +G    +E R AL   G  +S+ L +++  RY D E+  + F+DF+  ++RL NA
Sbjct:    7 APGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSE--RPQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQT--KEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVS-FRGQRIELIRIRNPWG-QVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEED--AIHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKD-EHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMD---GNVDI-DLPEPPKPTPPDQETEEEQ------------RFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYAD-EELQLDFDDFLNCLVRLENA 661          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|Q9D805|CAN9_MOUSE (Calpain-9 OS=Mus musculus OX=10090 GN=Capn9 PE=2 SV=2)

HSP 1 Score: 511.916 bits (1317), Expect = 1.802e-169
Identity = 285/694 (41.07%), Postives = 414/694 (59.65%), Query Frame = 2
Query:  389 KVQAKHTPKKKEDVGQQTSYFDLLEQ-LKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIK-NFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNA---FETMELQPED 2437
            + Q +  P     +      F+ L Q    +G L+ED DFPA   S+F S+  +    FVWKRP +I + P+    G +R D+ QG LGDCWLLA +ASL+L +     VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ E  ++  +E P   +  + K  K+ +L+GC+I++   ++ E   + GLI GHAY++T + +V    G  ++L+RVRNPWG + EW G WSDSSPEW ++   E++RL     +DGEFWM F DF  +F K+EIC+L P++L +  S   RWE+ I  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   T +  LMQKD R+ +  G   L IGY IY+  D + G L++ FF++  ++A+S  FIN REV  R +LP G Y++IPSTF P++EA+F LRIFSEK   T  LD               +++D D P         E+    E++   LF  +AG    ++A +L  +LNA+L K     FK   L  CR++++L D    GK+EF++F   W  +K W   F  FD D +G    +E R AL   G  +   L +++  RY D E   + F+D++  ++RL NA   F+++ ++ +D
Sbjct:    9 RPQPQPVPGDARTIHSSGQSFEQLRQGCLQSGTLFEDADFPASNVSLFYSERPQ--VPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI--REAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQVN-FHGQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSVDLEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDALED--SALHRWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRIFSEKRAVTRDLD---------------ENIDIDLP-ELPKPTPQEEETEEEQQFRALFQRVAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYAD-EDLQLDFDDYLNCLVRLENASRVFQSLSVKNKD 674          
BLAST of Calpain vs. TrEMBL
Match: A0A267GW14 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013791g1 PE=3 SV=1)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 373/690 (54.06%), Postives = 487/690 (70.58%), Query Frame = 2
Query:  461 EQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ--RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIA------KHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            ++ K +G+L+EDPDFPAD  S++ S++   Y  F WKRPK+IC +P   +DGVSRFDV+QG LGDCWLLA VASLS+++ +F  VV  DQDF  NY G FRFRFW+FG+W +V +DDRLPT  GKL FM S D NEFWSALLEKAYAK+ G YE+LSGG+Q EAM DFTGGLCET  +  +  P  LYN M++     +LMGCAIES ++EG ++NGLI+GHAYS+TDV+KV+  +G    LVRVRNPWGNE EWKG WSD S +W ++S+ EK++L  +  +DGEFWM++ DF+ +F KIEICHLGPES++  + G    KRRWEMC+E G W +N++AGGCRN IDSF  N QFR+E+VDPD++D EN GT+I+GLMQKD+R+  +   FL IGY IY +KDPN   L++ FF+F+  + KSP F+NQREVCGRHKLP GHYVIIPSTF+PNEEA F+LRIFSEKPN++  LD  N   N+       KH      +++++P+ +                   F + AG M  I+A QL+ ILN    ++IK F+GF LE CRS++AL D + +G MEF +F  +W +I++ KT FK++D DGNG FD FE R AL   G ++ N +F+ VA RY+DPE+G + FEDFI+  IRL  AFET +  P+ +EG  V   D FL   LY+
Sbjct:   97 DEQKLSGRLFEDPDFPADNRSIYPSRS---YSRFEWKRPKEICSDPLFISDGVSRFDVKQGELGDCWLLAAVASLSMHKKLFDQVVVPDQDFGANYCGMFRFRFWQFGEWKDVEIDDRLPTKYGKLCFMRSEDRNEFWSALLEKAYAKLNGSYEALSGGNQAEAMVDFTGGLCETFDM--RRAPPNLYNIMVQANNACSLMGCAIESEQLEGHLSNGLITGHAYSVTDVKKVRLNNGMEESLVRVRNPWGNECEWKGDWSDHSHKWSSVSQGEKDKLGMDQRDDGEFWMSYKDFSSHFNKIEICHLGPESMSSSVKGEAAKKRRWEMCLESGQWKRNVSAGGCRNNIDSFHMNEQFRIEIVDPDEDDDENMGTIIVGLMQKDIRKILKGADFLTIGYAIYSIKDPNIPPLDQKFFRFTRQVDKSPSFVNQREVCGRHKLPPGHYVIIPSTFSPNEEAEFILRIFSEKPNESGVLDTPNRMDNVVDGVYGRKHHNTV--MENEEPLKK------------------AFMEFAGSMAKIHAKQLQQILNRSFGREIKEFQGFSLEACRSMLALVDANMSGFMEFDEFKHLWNEIRLLKTIFKEYDADGNGYFDSFELRGALRVAGYNLCNKVFESVAMRYMDPEQGRVCFEDFILLSIRLKTAFETYKAMPKTNEGFGVVKQDHFLLQTLYL 761          
BLAST of Calpain vs. TrEMBL
Match: A0A1I8GXB3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 373/690 (54.06%), Postives = 487/690 (70.58%), Query Frame = 2
Query:  461 EQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ--RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIA------KHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            ++ K +G+L+EDPDFPAD  S++ S++   Y  F WKRPK+IC +P   +DGVSRFDV+QG LGDCWLLA VASLS+++ +F  VV  DQDF  NY G FRFRFW+FG+W +V +DDRLPT  GKL FM S D NEFWSALLEKAYAK+ G YE+LSGG+Q EAM DFTGGLCET  +  +  P  LYN M++     +LMGCAIES ++EG ++NGLI+GHAYS+TDV+KV+  +G    LVRVRNPWGNE EWKG WSD S +W ++S+ EK++L  +  +DGEFWM++ DF+ +F KIEICHLGPES++  + G    KRRWEMC+E G W +N++AGGCRN IDSF  N QFR+E+VDPD++D EN GT+I+GLMQKD+R+  +   FL IGY IY +KDPN   L++ FF+F+  + KSP F+NQREVCGRHKLP GHYVIIPSTF+PNEEA F+LRIFSEKPN++  LD  N   N+       KH      +++++P+ +                   F + AG M  I+A QL+ ILN    ++IK F+GF LE CRS++AL D + +G MEF +F  +W +I++ KT FK++D DGNG FD FE R AL   G ++ N +F+ VA RY+DPE+G + FEDFI+  IRL  AFET +  P+ +EG  V   D FL   LY+
Sbjct:   92 DEQKLSGRLFEDPDFPADNRSIYPSRS---YSRFEWKRPKEICSDPLFISDGVSRFDVKQGELGDCWLLAAVASLSMHKKLFDQVVVPDQDFGANYCGMFRFRFWQFGEWKDVEIDDRLPTKYGKLCFMRSEDRNEFWSALLEKAYAKLNGSYEALSGGNQAEAMVDFTGGLCETFDM--RRAPPNLYNIMVQANNACSLMGCAIESEQLEGHLSNGLITGHAYSVTDVKKVRLNNGMEESLVRVRNPWGNECEWKGDWSDHSHKWSSVSQGEKDKLGMDQRDDGEFWMSYKDFSSHFNKIEICHLGPESMSSSVKGEAAKKRRWEMCLESGQWKRNVSAGGCRNNIDSFHMNEQFRIEIVDPDEDDDENMGTIIVGLMQKDIRKILKGADFLTIGYAIYSIKDPNIPPLDQKFFRFTRQVDKSPSFVNQREVCGRHKLPPGHYVIIPSTFSPNEEAEFILRIFSEKPNESGVLDTPNRMDNVVDGVYGRKHHNTV--MENEEPLKK------------------AFMEFAGSMAKIHAKQLQQILNRSFGREIKEFQGFSLEACRSMLALVDANMSGFMEFDEFKHLWNEIRLLKTIFKEYDADGNGYFDSFELRGALRVAGYNLCNKVFESVAMRYMDPEQGRVCFEDFILLSIRLKTAFETYKAMPKTNEGFGVVKQDHFLLQTLYL 756          
BLAST of Calpain vs. TrEMBL
Match: A0A267DE36 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013791g4 PE=3 SV=1)

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 370/688 (53.78%), Postives = 485/688 (70.49%), Query Frame = 2
Query:  461 EQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ--RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHL----RDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            ++ K +G+L+EDPDFPAD  S++ S++   Y  F WKRPK+IC +P   +DGVSRFDV+QG LGDCWLLA VASLS+++ +F  VV  DQDF  NY G FRFRFW+FG+W +V +DDRLPT  GKL FM S D NEFWSALLEKAYAK+ G YE+LSGG+Q EAM DFTGGLCET  +  +  P  LYN M++     +LMGCAIES ++EG ++NGLI+GHAYS+TDV+KV+  +G    LVRVRNPWGNE EWKG WSD S +W ++S+ EK++L  +  +DGEFWM++ DF+  F KIEICHLGPES++  + G    KRRWEMC+E G W +N++AGGCRN IDSF  N QFR+E+VDPD++D EN GT+I+GLMQKD+R+  +   FL IGY IY +KDPN   L++ FF+F+  + KSP F+NQREVCGRHKLP GHYVIIPSTF+PNEEA F+LRIFSEKPN++  LD  N   N+   +      +  +++++P+ +                   F + AG    I+A QL+ ILN    ++IK F+GF LE CRS++AL D + +G MEF +F  +W +I++ KT FK++D DGNG FD FE R AL   G ++ N +F+ VA RY+DPE+G + FEDFI+  IRL  AFET +  P+ +EG  V   D FL   LY+
Sbjct:   97 DEQKLSGRLFEDPDFPADNRSIYPSRS---YSRFEWKRPKEICSDPLFISDGVSRFDVKQGELGDCWLLAAVASLSMHKKLFDQVVVPDQDFGANYCGMFRFRFWQFGEWKDVEIDDRLPTKYGKLCFMRSEDRNEFWSALLEKAYAKLNGSYEALSGGNQAEAMVDFTGGLCETFDM--RRAPPNLYNIMVQANNACSLMGCAIESEQLEGHLSNGLITGHAYSVTDVKKVRLNNGMEESLVRVRNPWGNECEWKGDWSDHSHKWSSVSQGEKDKLGMDQRDDGEFWMSYKDFSSQFNKIEICHLGPESMSSSVKGEAAKKRRWEMCLESGQWKRNVSAGGCRNNIDSFHMNEQFRIEIVDPDEDDDENMGTIIVGLMQKDIRKILKGADFLTIGYAIYSIKDPNIPPLDQKFFRFNRQVDKSPSFVNQREVCGRHKLPPGHYVIIPSTFSPNEEAEFILRIFSEKPNESGVLDTPNTMDNVVDGVYGRKHHSTVMENEEPLKK------------------AFMEFAGSTAKIHAKQLQQILNRSFGREIKEFQGFSLEACRSMLALVDANMSGFMEFDEFKHLWNEIRLLKTIFKEYDADGNGYFDSFELRGALRVAGYNLCNKVFESVAMRYMDPEQGRVCFEDFILLSIRLKTAFETYKAMPKTNEGFGVVKQDHFLLQTLYL 761          
BLAST of Calpain vs. TrEMBL
Match: A0A1I8JIV8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 365/684 (53.36%), Postives = 467/684 (68.27%), Query Frame = 2
Query:  461 EQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ--RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            ++ K +G+L+EDPDFPAD  S++ S++   Y  F WKRPK+IC +P   +DGVSRFDV+QG LGDCWLLA VASLS+++ +F  VV  DQDF  NY G FRFRFW+FG++     DDRLPT  GKL FM S D NEFWSALLEKAYAK+ G YE+LSGG+Q EAM DFTGGLCET  +  +  P  LYN M++     +LMGCAIES ++EG ++NGLI+GHAYS+TDV+KV+  +G    LVRVRNPWGNE EWKG WSD S +W ++S+ EK++L  +  +DGEFWM++ DF+ +F KIEICHLGPES++  + G    KRRWEMC+E G W +N++AGGCRN IDSF  N QFR+E+VDPD++D EN GT+I+GLMQKD+R+  +   FL IGY IY +KDPN   L++ FF+F+  + KSP F+NQREVCGRHKLP GHYVIIPSTF+PNEEA F+LRIFSEKPN++  LD     T                                           A  M  I+A QL+ ILN    ++IK F+GF LE CRS++AL D + +G MEF +F  +W +I++ KT FK++D DGNG FD FE R AL   G ++ N   K VA RY+DPE+G + FEDFI+  IRL  AFET +  P+ +EG  V   D FL   LY+
Sbjct:   92 DEQKLSGRLFEDPDFPADNRSIYPSRS---YSRFEWKRPKEICSDPLFISDGVSRFDVKQGELGDCWLLAAVASLSMHKKLFDQVVVPDQDFGANYCGMFRFRFWQFGEF-----DDRLPTKYGKLCFMRSEDRNEFWSALLEKAYAKLNGSYEALSGGNQAEAMVDFTGGLCETFDM--RRAPPNLYNIMVQANNACSLMGCAIESEQLEGHLSNGLITGHAYSVTDVKKVRLNNGMEESLVRVRNPWGNECEWKGDWSDHSHKWSSVSQGEKDKLGMDQRDDGEFWMSYKDFSSHFNKIEICHLGPESMSSSVKGEAAKKRRWEMCLESGQWKRNVSAGGCRNNIDSFHMNEQFRIEIVDPDEDDDENMGTIIVGLMQKDIRKILKGADFLTIGYAIYSIKDPNIPPLDQKFFRFTRQVDKSPSFVNQREVCGRHKLPPGHYVIIPSTFSPNEEAEFILRIFSEKPNESGVLDTPTEWTTWW---------------------------------------TACSMAKIHAKQLQQILNRSFGREIKEFQGFSLEACRSMLALVDANMSGFMEFDEFKHLWNEIRLLKTIFKEYDADGNGYFDSFELRGALRVAGYNLCN---KSVAMRYMDPEQGRVCFEDFILLSIRLKTAFETYKAMPKTNEGFGVVKQDHFLLQTLYL 723          
BLAST of Calpain vs. TrEMBL
Match: A0A2R2MIP4 (calpain-A OS=Lingula unguis OX=7574 GN=LOC106156774 PE=3 SV=1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 351/707 (49.65%), Postives = 476/707 (67.33%), Query Frame = 2
Query:  419 KEDVGQQTSYFDLLEQLKGT----GKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDF-DKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESA--KIEGVMANGLISGHAYSITDVQKVKQTDGTV---VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG---KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQR---NLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            K D+    +     E+LK      G+L+EDP+FPA   S+F S+A    R F WKRP ++C NP LF  G SRFDVQQG LGDCWLLA +ASLSL + +   VVP +Q F D  Y G F F+FWRFGKWV+VVVDDRLPTY  +LVFMHSAD+NEFWSA+LEKAYAK+CG YE+L GGS  EAMEDFTGG+ E   L + + P  L+  M K  ++S+LMGC+IE++  ++E  ++NGLI GHAYSIT V+ V      +   + L+R+RNPWGNE EWKG W D SPEW  IS++E++ +   F +DGEFWM+F DFA NF K+EIC+LGP++L ED  G   K++WE   E+G W + +NAGGCRN++D+F TNPQ+R+ V DPD++D +NT T+I+GLMQKD R++    L  L +GY IY LKDP+CG L+  FFK++ + AKSP FIN REVCGRHKLP G Y IIPSTF PN+E +F+LRIF+EK N    +D K G +++           +  PV+ +            ++L + F+ +AG    I+A +LRD+LNA  +++ K F GF +E CRS+VA+ D D +GK+ F++F K+W D+++WK+ FK FD D +G  + +E RNAL NVG+ VSN  F  +  R+ D + G I F+DFI+  +RL   F+T      +  G   FT D+F+++ +Y
Sbjct:  105 KPDIPTGATTVQNFEELKAQCLREGRLFEDPEFPAINQSIFYSRAPP--RPFQWKRPHELCSNPDLFVGGASRFDVQQGELGDCWLLAAIASLSLNKELLHKVVPPNQSFADGEYAGIFVFKFWRFGKWVDVVVDDRLPTYNNRLVFMHSADSNEFWSAMLEKAYAKLCGSYEALKGGSTCEAMEDFTGGVTEMFDLRQPQ-PPNLFQIMQKAFERSSLMGCSIEASPHQLEAELSNGLIMGHAYSITSVKMVDIKTPRMAGKIPLIRIRNPWGNEAEWKGAWGDKSPEWNFISEAERQEIGLQFDDDGEFWMSFKDFASNFQKLEICNLGPDALTEDELGTTSKKKWEASSEEGGWKRRVNAGGCRNYLDTFWTNPQYRISVTDPDEDDDDNTCTIIVGLMQKDRRKKKKEGLDLLTVGYAIYLLKDPDCGPLDLRFFKYNASFAKSPSFINMREVCGRHKLPPGSYAIIPSTFEPNQEGDFLLRIFTEKANTAAAIDEKTGISDVQNGFPHKPGPQA--PVTPQD-------EQQTQKLRETFHRVAGEDMEIDAHELRDVLNAAFMREFK-FDGFSMETCRSMVAMMDVDQSGKLGFEEFQKLWNDLRLWKSVFKQFDKDMSGTLNSYELRNALNNVGMRVSNQTFNALVMRFAD-KHGAIFFDDFILCAVRLKTMFDTFTSLDPNKTGAATFTLDQFIQTTMY 797          
BLAST of Calpain vs. Ensembl Cavefish
Match: zgc:55262 (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103042634])

HSP 1 Score: 486.878 bits (1252), Expect = 1.368e-160
Identity = 275/669 (41.11%), Postives = 397/669 (59.34%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKA---SKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK---IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEG 2446
            L+ED  FPA +SS+  ++    S   +   WKRP +IC  PQ   DG +R D+ QGALGDCWLLA +ASL+L + +   VVP  Q F   Y G F F+FW+FG+W++VV+DDRLP   GKL+F+HSA+  EFWSAL+EKAYAK+ G YE+LSGGS  E  EDFTGG+ E  +L  K+ P  LYN + +   + +L+GC+I+      +E V    L+ GHAYS+T V +V    GT  +LVR+RNPWG E EW G WSD+S EW+++  S + RL    + DGEFWM+F DF + F+++EIC+L  ++L  +    ++W  C+ +G W +   AGGCRNF  +F  NPQF+V +  PD   S +  + ++ LMQKD R +R  G     IG+ IY++     G     L + FF  + + A+S  FIN REV  R +LP G Y+I+PSTF P +EA+F+LR+FSEKP   + LD               DDV ++ P   +          ++   + LF  +AG    I+  +L+ ILN I+   KD+K   GF  E CRS++ L D D +GK+   +F  +W+ IK + T F+ FD D +G    +E R AL   G  ++N LF+++  RY + E   + F++F+  ++RL   F+T +    D +G
Sbjct:   50 LFEDSLFPASSSSLGFNELGPRSSKTQGVQWKRPPEICSRPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQSFGSGYAGIFHFQFWQFGEWMDVVIDDRLPVKDGKLLFVHSAEGGEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYEL--KKAPSDLYNIIQRAVDRGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTAVHEVVYR-GTPTKLVRIRNPWG-EVEWTGAWSDNSREWDSVDSSSRARLQVR-SEDGEFWMSFRDFLQEFSRLEICNLTADAL--EAGQVKKWSTCLYNGEWRRGSTAGGCRNFPATFWLNPQFKVNLTHPDKAGSSDC-SFLVALMQKDRRKKRKEGKDMETIGFAIYEVPGQYVGQSGVHLKRDFFLTNASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPQKEADFVLRVFSEKPASAEELD---------------DDVTAELPSENQ-----LDESQIDAGFKSLFRQLAGSDMEISVTELQTILNRIISKHKDLKT-DGFGPEACRSMINLMDTDGSGKLGLTEFHVLWEKIKRYLTVFRQFDLDKSGTMSSYEMRMALEAAGFKLTNHLFQLIILRYTE-EDLTVDFDNFVTCLVRLETMFKTFKTLDTDADG 688          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 478.019 bits (1229), Expect = 8.283e-157
Identity = 280/703 (39.83%), Postives = 417/703 (59.32%), Query Frame = 2
Query:  422 EDVGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDG--TVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTG---TVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFK--GFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            +D  +   + +L ++      L++DP FPAD SS++ ++  K   + VWKRP +ICKNPQ    G +R D+ QG LGDCWLLA +A L+L E +   VVP DQ F +NY G F F+FWR+G+WV+VVVDDRLPT    LVF  S + NEFWSALLEKAYAK+ G YE+L GG+ +EAMEDFTGG+ E  ++++  R +  YN M K   + +LMGC+I+S   +  E     GL+ GHAYS+T V++ KQ DG  T + LVR+R+PWG         S  S +W +++ SE+++        GEFWM F++F + FTK+EIC+L P++L +D   K  W++ + +G W +  +AGGCRN+ D+F TNPQ+R+ + + DD++ ++     TV++ LMQK   R+R  G   L IG+ IY++   N   L K FF ++ + A+   +IN REV  R  L  G YVI+PSTF+PN E++F+LR+FSE   KT T ++                +++D  V  +S    ++    EK+   +F  +AG    INA +LR + N +L K  K  K  GF L+ CRS++AL D D TG++  ++F  +W  I+ WK  F  +D D +     FE RNA+ + G  ++  L  ++A RY   E   + F+ +I  ++RL   F   +    D +G     + E+L+  +Y
Sbjct:   58 KDAKRLKDFLELRDKYVRKKVLFKDPLFPADDSSLYYNQ--KFPLKLVWKRPSEICKNPQFIVGGANRTDICQGDLGDCWLLAAIACLTLSETLLYRVVPADQSFSENYAGIFHFQFWRYGEWVDVVVDDRLPTSNNHLVFTRSGNKNEFWSALLEKAYAKLHGTYEALKGGNTLEAMEDFTGGVTEFYEISDAPREI--YNIMKKALNRGSLMGCSIDSLVPSASETKTDTGLVRGHAYSVTAVEQGKQEDGSDTRIRLVRLRDPWGVAP----PPSRMSCDWSSLATSEQDQQRLKPVEAGEFWMGFEEFQQTFTKLEICNLTPDALQDDELLK--WDVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLTEEDDDEPDHGEKGCTVVVALMQKGRRRERCTGGTLLTIGFAIYEMHG-NKQHLPKDFFLYTASKARCKSYINLREVTERFCLSPGEYVIVPSTFDPNNESDFILRVFSE---KTSTSELSGAV------------IEADPCVLPKS---EDEESDEEKQFRAMFQQIAGDDMQINAKELRSVFNKLLTK-YKGLKTEGFSLDSCRSMIALMDTDGTGRLNLEEFKHLWSKIQQWKLIFSRYDRDKSSSISSFEMRNAVADAGFQLNPQLHDIIAMRYAS-EHLYLDFDSYICCLVRLEGMFRAFKAFDIDGDGIIKLNSLEWLQLTMY 729          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn1a (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103024720])

HSP 1 Score: 468.003 bits (1203), Expect = 2.864e-153
Identity = 270/717 (37.66%), Postives = 427/717 (59.55%), Query Frame = 2
Query:  383 ASKVQAKHTPKKKEDVGQQTSYFDLLEQ--LKGTGKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFL 2476
            AS+++++     ++ V  Q   F+ L+Q  ++G G L+EDP FPA+  S+    +   S       W RP ++C +PQ    G +R D+ QGALGDCWLLA +ASL+L E +   VVP  Q F  +Y G F F+FW+FG+WV++V+DDRLP   G+L+F+HSA+ NEFWSAL+EKAYAK+ G YE+LSGGS  E  EDFTGG+ E  +L  ++ P  LY  + K  +  +L+GC+I+   +  +E V    L+ GHAYS+T +++V    G +  L+R+RNPWG + EW G WSD+S EW+ I  +E+E LC     DGEFWM+F++F + F+++EIC+L P++L++D  G   W      GSW +   AGGCRN  ++F  NPQ+++ +++ DD+  ++    + ++ L+QKD R+ R  G     IG+ +Y++ +   G     L K+FF   ++ A+S  FIN REV  R +LP G Y+I+PSTF P++EA+F+LR+F+EK ++T+ LD               D++ +D    EE          ++   + +F  +AG    I+  +LR ILN +++  KD+K   GF +E CR++V L D D + ++   +F  +W  I+ W   ++ FD D +G    +E R A+ + G  ++N L +++  RY + E  VI F++FI  +++L   F + +   ++  G       E+L
Sbjct:   13 ASRLKSEGMGSYEQAVHFQNQDFEELKQECVEG-GFLFEDPCFPAEPPSLGFKELGPHSSKTSGVEWMRPTELCDDPQFILGGATRTDICQGALGDCWLLAAIASLTLNEKLLHRVVPHGQSFQDDYAGIFHFQFWQFGEWVDIVIDDRLPVKDGELMFVHSAEGNEFWSALIEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYEL--RKPPRDLYRIISKALELGSLLGCSIDITSTFDMEAVTFKKLVKGHAYSVTGLRQVN-FRGDLQRLIRIRNPWG-QVEWTGAWSDNSSEWDEIDPTEREDLCLQM-EDGEFWMSFNEFLRQFSRLEICNLTPDALSDD--GLSHWNTIQFHGSWRRGSTAGGCRNHPNTFWINPQYKITLLEEDDDPEDDEVACSFLVALLQKDRRRYRRQGQDMHTIGFAVYEIPEEFRGCQNVHLKKNFFLSHSSCARSETFINLREVSARLRLPPGEYLIVPSTFEPSKEADFVLRVFTEKQSETEELD---------------DEISADLEDEEEI-----TEDDIDDSFKSMFAQLAGEDMEISVHELRTILNRVVLRHKDLKT-DGFSMESCRTMVNLMDKDGSARLGLVEFQILWNKIRKWLVIYRQFDLDKSGTMSSYEMRLAVESAGFKLNNRLNQILVARYAENE--VIDFDNFICCLVKLEAMFRSFQQLDKEGSGEVEMNITEWL 698          
BLAST of Calpain vs. Ensembl Cavefish
Match: si:dkeyp-50d11.2 (si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-22])

HSP 1 Score: 464.922 bits (1195), Expect = 4.372e-152
Identity = 273/704 (38.78%), Postives = 403/704 (57.24%), Query Frame = 2
Query:  416 KKEDVGQQTSYFDLL----EQLKGT----GKLWEDPDFPADTSSVFVSKASKG---YREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK---IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVF 2458
            + E +GQ       L    E L+ +     +L+ED  FPA  SS+   + + G    R   W RP + C +P    DG +R D+ QGALGDCWLLA +A L+L EP+   VVP  Q F   Y G F F+FW+FG WV+VV+DDRLP   GKL+F+HS +  EFWSAL+EKAYAK+ G YE+LSGG   E  EDFTGG+ E  +L  ++ P  L++ + +  ++ +L+GC+I+      +E V    L+ GHAYS+T V +V +  G + +L+R+RNPWG E EW G WSD S EW  I+ + + RL  N A DGEFWM+F DF K F+++EIC+L  ++L    S  ++W   +  G W +   AGGCRN+  +F  NPQ+++ + DPD E  +   + ++ LMQK+ RQ R  G     IG+ IY++     G+    L + FF  +T+ A+S  FIN REV  R  LP G Y+I+PSTF P +E +F+LR+FSEK   +  LD               D++ +D P  +           +++  + LF  +AG    I+  +L+ ILN ++   KD+K   GF  E CR +++L D    G++   DF  +W+ IK + T F++FD D +G    +E R AL + G  ++N LF+++  RY  P+  V  F++F+  +IRL + F+T      D +G   F
Sbjct:   19 RSEGIGQNHKALKFLGQDFESLRASCLQSRRLFEDETFPAQPSSLGFKELAPGSAKTRGVRWMRPTEFCDDPHFIVDGATRTDICQGALGDCWLLAAIACLTLNEPLLHRVVPHGQSFHYQYAGIFHFQFWQFGDWVDVVIDDRLPVRDGKLLFVHSDEGAEFWSALVEKAYAKLNGCYEALSGGCTSEGFEDFTGGVTEMYEL--RKAPPNLFSIIRRAVERGSLLGCSIDITSFFDMEAVTFKKLVKGHAYSVTGVDEV-EFRGNLTKLIRIRNPWG-EVEWTGAWSDESREWSGINPALRSRL-HNRAEDGEFWMSFSDFLKEFSRLEICNLTADALQS--SELKKWNSSLYTGEWRRGSTAGGCRNYPATFWINPQYKIMLKDPDTEGQDGC-SFLVALMQKNRRQLRREGKDMETIGFAIYEVPLQFLGMAGVHLKRDFFLTNTSSARSELFINLREVSSRFCLPAGEYIIVPSTFEPQKEGDFVLRVFSEKAADSQELD---------------DELTADLPEED-----ALPESEIDEGFKALFAKLAGKDMEIDVPKLQMILNRVISKHKDLKT-DGFGKEACRCMISLMDTSGCGRLGLTDFHVLWEKIKRYLTIFREFDLDKSGTMSSYEMRLALESAGFKLTNNLFQLIILRYAKPDLNV-DFDNFVTCLIRLESMFKTFRTMDTDADGVVTF 692          
BLAST of Calpain vs. Ensembl Cavefish
Match: zgc:55262 (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103042634])

HSP 1 Score: 460.299 bits (1183), Expect = 9.622e-151
Identity = 272/693 (39.25%), Postives = 392/693 (56.57%), Query Frame = 2
Query:  416 KKEDVGQQTSYFDLL----EQLKG----TGKLWEDPDFPADTSSVFVSKA---SKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK---IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDH------TGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMEL 2425
            + E +GQ  +    L    E LK     +  L+ED  FPA +SS+  ++    S   +   WKRP +IC  PQ   DG +R D+ QGALGDCWLLA +ASL+L + +   VVP  Q F   Y G F F+FW+FG+W++VV+DDRLP   GKL+F+HSA+  EFWSAL+EKAYAK+ G YE+LSGGS  E  EDFTGG+ E  +L  K+ P  LYN + +   + +L+GC+I+      +E V    L+ GHAYS+T V       GT  +LVR+RNPWG E EW G WSD+S EW+++  S + RL    + DGEFWM+F DF + F+++EIC+L  ++L  +    ++W  C+ +G W +   AGGCRNF  +F  NPQF+V +  PD   S +  + ++ LMQKD R +R  G     IG+ IY+    +   L + FF  + + A+S  FIN REV  R +LP G Y+I+PSTF P +EA+F+LR+FSEKP   + LD               DDV ++ P   +          ++   + LF  +AG    I+  +L+ ILN I+ K          E   SL  L  +D       +GK+   +F  +W+ IK + T F+ FD D +G    +E R AL   G  ++N LF+++  RY + E   + F++F+  ++RL   F    L
Sbjct:   19 RDEGLGQNHNAIKFLGQDYEMLKARCLQSRSLFEDSLFPASSSSLGFNELGPRSSKTQGVQWKRPPEICSRPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQSFGSGYAGIFHFQFWQFGEWMDVVIDDRLPVKDGKLLFVHSAEGGEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYEL--KKAPSDLYNIIQRAVDRGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTAV----VYRGTPTKLVRIRNPWG-EVEWTGAWSDNSREWDSVDSSSRARLQVR-SEDGEFWMSFRDFLQEFSRLEICNLTADAL--EAGQVKKWSTCLYNGEWRRGSTAGGCRNFPATFWLNPQFKVNLTHPDKAGSSDC-SFLVALMQKDRRKKRKEGKDMETIGFAIYEYVGQSGVHLKRDFFLTNASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPQKEADFVLRVFSEKPASAEELD---------------DDVTAELPSENQ-----LDESQIDAGFKSLFRQLAGSDMEISVTELQTILNRIISKR---------EFSDSLYCLIFFDRCIQTDGSGKLGLTEFHVLWEKIKRYLTVFRQFDLDKSGTMSSYEMRMALEAAGFKLTNHLFQLIILRYTE-EDLTVDFDNFVTCLVRLETMFSKWTL 670          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 492.271 bits (1266), Expect = 3.123e-165
Identity = 262/586 (44.71%), Postives = 371/586 (63.31%), Query Frame = 2
Query:  566 WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRF--RFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGT----VIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIK-NFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVG 2293
            W   ++I +NP+   DG +R D++QGALGDCWLLA +ASL+L + +   VVP  Q+F   Y G F F  +FW FG+W++V +DDRLPT  G+LVF+HSAD  EFWSALLEKAY+K+ G YE+L GGS  EAMEDFTGG+ E + L  K  P  L+  M K  ++ ++MGC+I+   +++ E   +NGL+ GHAYSIT V +V    G  V+L+R+RNPWG E EW G WSD +PEW+ + + E+ RL    A DGEFWM+FDDF ++FTK+EIC+L P+ +  +    R W + + DG W K   AGGCRNF ++F TNPQFR+++ + DDE    TG+     I+ LMQK+MR++    L +GY IYK+ D   G + K FF ++ + A+SP FIN REV  R +LP G YVI+PSTF P++EA+F++R+F+EKPN++   D K G         + D  D  +P +E            +++ + LF  +AG    I+  +L+D+LN I  K  +    GF +  CRS+VAL D D +GK+  ++F  +W  IK W+  F+  D D +G    +E +NAL   G
Sbjct:    4 WGLSREIVQNPEFIVDGATRTDIKQGALGDCWLLAAIASLTLNDQLLAKVVPPGQNFRDGYAGIFHFQQKFWHFGEWMDVFIDDRLPTKNGQLVFVHSADKREFWSALLEKAYSKLNGSYEALKGGSIAEAMEDFTGGVYELLDL--KTAPPDLFRIMCKARQKGSMMGCSIDVTNASESEARTSNGLVKGHAYSITGVDEVNYR-GQKVKLLRIRNPWG-EVEWNGAWSDHAPEWKALDQGERNRLQQVMAEDGEFWMSFDDFMRHFTKMEICNLTPDRVERE-GDPRYWTVTVHDGRWLKGCTAGGCRNFPETFWTNPQFRLKLHNEDDEAD-ETGSKACSFIVALMQKNMRKQQRNMLTMGYAIYKIPD-QTGPMPKEFFLYNASKARSPSFINLREVSQRFRLPAGEYVIVPSTFEPHQEADFLVRVFAEKPNRSKESDDKIGA--------EIDLNDVAKPGTE---------TEDDRKFKTLFGRLAGEDMEISPKELQDMLNKITAKHGELESTGFSMHACRSIVALTDVDGSGKLGLQEFRILWNKIKKWQAIFRKHDEDLSGTMSSYEMKNALNAAG 565          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 476.093 bits (1224), Expect = 9.669e-156
Identity = 284/756 (37.57%), Postives = 422/756 (55.82%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAI--------------------------------------ESAK---------IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNT--GTVIIGLMQKDMR-QRNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNG----------------KTNIAKHLRDTDDVDSDQP--------------VSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            L+EDPDFPA  +S++ S+ +    +F W RPK++C  P+      +   + +G LGDCW+LA +A +++ E +   V+P  Q F++NY G F F+FWRFG+WV+VVVDDRLPT+  +LVF+ SA+ NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  K  P  LY  M+K   + +LMGC+I                                      E AK          E     GL+  HAYSIT + +VK     +V+LVR+RNPWG+  EW G WSD+S EW  I+ SEK+RL    A DGEFW++F DF +NFTK+EIC+L P++L +D + K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+++ D DD+  +N    + I+ LMQK+ R +R  G   L IG+ IY++ +   G    L K FF ++ + A+   +IN REV  R +LP G YVI+PSTF  ++E  F+LR+F+EK N ++ +D   G                     K  +  +  D  +P              ++E    K   L   +K+ + +F  +AG    + A  L +ILN ++   KD+K   GF LE CR++VAL D D +GK+ + DF  +W  +K W+  F+ +D D +G    +E R A+   G  ++N L++++  R+ D E   I F++FI  +IRL   F   +   +D +G       E+L+  +Y
Sbjct:   66 LFEDPDFPAHNNSIYFSQNAP--MQFQWMRPKELCV-PRSIVIEANHTHICEGDLGDCWVLAAIACMTMNEELLARVIPAGQSFEENYAGIFHFQFWRFGEWVDVVVDDRLPTFNNQLVFVQSAERNEFWSALLEKAYAKVHGSYEALKGGNTTEAMEDFTGGVTEYFEM--KNPPKDLYKIMVKATSRRSLMGCSIDDGMCWRCGVPAPDSIGLVRSNMSPPILRHIQLTPIGIEDAKKRKIAMLTHAESRTPMGLVRNHAYSITGLDEVKHR-SKIVQLVRLRNPWGH-VEWIGPWSDASKEWNEITPSEKQRLQLISAEDGEFWISFQDFCRNFTKLEICNLSPDALADDRTNK--WTVSVSEGRWVRGCSAGGCRNYPDTFWTNPQYRLQLYDEDDDPDDNELLCSFIVALMQKNRRKERRQGSTMLTIGFAIYEVTEELRGSREHLPKDFFLYNASRARCNSYINLREVTERFRLPPGEYVIVPSTFEAHQEGEFLLRVFAEKHNVSEEMDDIIGVKKKSKKKKNKPIVFISDRTKKGQQQPESPDESEPEDGNEEESEPKSNKLAEPENPKEPDLTPEDKQFKTIFKQLAGDDMEVGAADLHNILNKVITKHKDLKT-SGFSLESCRTMVALMDTDLSGKLGYNDFKYLWDKLKFWQQIFRKYDSDKSGSMTSYEMRLAINEAGYQLNNQLYQIITLRHAD-ENLNIGFDNFIACLIRLEAMFRAFKAFDKDGDGIIRLNVLEWLQLTMY 810          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003998.1 (pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 gene:ENSPMAG00000003440.1 transcript:ENSPMAT00000003998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 471.085 bits (1211), Expect = 8.059e-155
Identity = 275/717 (38.35%), Postives = 386/717 (53.84%), Query Frame = 2
Query:  569 KRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCE---------------------------------TIKLNEKERPVGLYNQMLKFAKQST-------------------LMGCAIESAK---IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQF--RXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKL---KDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNK----TDTLDIKNGK----------TNIA------------KHLRDTDDVDSDQPVSEE---SXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFK--GFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEG 2446
            + P++IC NPQ   +G +R D++QGALGDCWLLA +ASL+L+  +   VVP  Q F   Y G F F+FW+FG+WV+VV+DD LPT   KL F+HS D NEFWSALLEKAYAK+ G YE+L GGS  EAMEDFTGG+ E                                 T K     R + +      F   S+                   L    IE      +E  + NGL+ GHAYSIT + +V   +G  V LVR+RNPWG E EW G WSD+S EW  +  SE+ RL    A DGEFWM+F DF +NF+K+EIC+L P++L    SG R W +   +G W +   AGGCRN+  +F TNPQF  R+   D D +D E   + I+ LMQK+MR++    L IGY IY++     P C  L   FF  +++ A+S  FIN REV  R +LP GHYVI+PST+ P++EA+F+LR++ EK N+    T    +  G+          +N+             +H+ D     + + V E    S          ++   ++F  +AG    I+  +L+D+LN +  K +K FK  GF L  C+S+VAL D D +GK+   +F  +W+ IK+W+  F+ +D D +G    +E R AL   G  ++N +++++  RY D E   I F D+I  ++RL   F       +D  G
Sbjct:    1 RAPQEICYNPQFIVNGATRTDIKQGALGDCWLLAAIASLTLHPRLLARVVPEGQSFSDGYAGIFHFQFWQFGEWVDVVIDDLLPTQNNKLAFLHSTDRNEFWSALLEKAYAKLNGSYEALKGGSIAEAMEDFTGGVFEFYNLKKAPPDLYRIMRKGLEKASMMGCSIDEGSTFKYRSTPRAINMSKMTATFRAWSSGIRRFAERFLPSRLGHARLLASSGIEITSMFDLEARLPNGLVKGHAYSITGLDQVF-FEGQDVRLVRIRNPWG-EVEWNGAWSDNSWEWRVVDVSERRRLEQVRAEDGEFWMSFSDFKRNFSKMEICNLSPDTLRTQ-SGSRHWTVTAHEGRWLRGCTAGGCRNYAGTFWTNPQFHLRLHEEDDDPDDDEVACSFIVALMQKNMRRQKRDLLTIGYAIYEIPLKAPPGCTHLPGEFFVRNSSRARSHNFINLREVSDRFRLPPGHYVIVPSTYEPHQEADFLLRVYCEKMNRSRGETKHNSVSKGRPIFRGAFKQVSNLGGCGGPNCYRVVDEHIADEILKSNSERVGEAVQPSMPVEVVETDEDRRFTQVFKKLAGEDMEISPRELQDLLNKVTAK-LKVFKSDGFSLYACQSMVALMDSDGSGKLGLPEFKLLWEKIKMWQAIFRKYDEDRSGTMSSYEMRAALNAAGFHLNNQMYQLITMRYAD-ESMTIKFNDYITCMVRLEAMFRIFHALDKDKRG 712          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn1a (calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-1263])

HSP 1 Score: 382.489 bits (981), Expect = 2.873e-121
Identity = 247/688 (35.90%), Postives = 365/688 (53.05%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVFV----SKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE----SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCR--NFIDSFVTNPQFRXXXXXXXXXXXXNTGT-VIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHL-RDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKG-----FDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFL 2488
            L+EDPDFPA  SS+ +    +  ++      WKRP ++ ++P+    G +R D+ QG L DCWLL+ +ASL+LY  +   VVP  Q F ++Y G F FRF ++G+WV+V VDDRLPT  G+LVF+ S   NEFWSALLEKAYAK+ G YE+L+ G  +EA+ DFTGG+ ET  +N    P   ++ + +  K+  ++ C IE    S + E V   GL+ GHAYSIT V K+K   G  V+L+RVRNP+G + E+ G WSD S  W  + + +++RL    A DGEFW++  DF KNF  +EICH G E   E    K  W   + +  W K +NAGG R       F  N QF + +++ D+      G   ++ L QK  R+ R +G  F+ IG  IYK   P   L  +   K    + +SP FI +REV  R  LP G+Y+IIP T +  +EA F+LRIF EK  +   L     +  +  +  R      ++    EES                 F  +AG  ++I A    D L A++  +I+ +       F +E CR LVAL D D++G++ +++F+ +W+ IK+    +K  D D +G     E   AL +    V   + +++  R+ +P    I+F+ F+  + ++  AF           G       EFL  F 
Sbjct:   43 LFEDPDFPASLSSLHIRVQPTVITQSNNFIEWKRPWELVRHPEFIVSGATRADINQGTLPDCWLLSAIASLTLYPDLLAKVVPMGQSFHEDYAGIFLFRFCQYGEWVDVHVDDRLPTKKGELVFVQSGTGNEFWSALLEKAYAKLNGCYEALAYGFPVEALCDFTGGVGETFTMNNA--PRDYWDGISRAIKKGAIICCGIETLAASGRGEKVTPMGLVEGHAYSITGVIKLK-FPGKTVQLIRVRNPYG-KVEYTGPWSDGSTTWNEVPEEDQKRLHVR-AEDGEFWISDKDFRKNFHLVEICHQGSEV--EIEHRKNLWICELHNSMWLKGLNAGGSRRHRVFKEFPLNYQFFLTLLEEDNVMDVCHGCHFLLSLTQKHRRKFRKIGIDFVPIGIYIYKAVVPGKKLTPQQLRK-EKPLVESPEFIARREVTMRMTLPPGNYIIIPCTESAGQEAQFLLRIFMEKAQQHQGL---ASQLEVTPYFPRMVSPPPAENFDMEES-----------------FLQVAGKDKLIKA----DKLQALITLEIQKYTTVVVDKFSMESCRVLVALFDIDNSGQLGYEEFLLVWEFIKMTLKTYKMCDVDKSGTLSSTELPMALEHSRFKVGKLMQRLIMMRFSEPNL-TISFDSFVCLLAKMYTAFNIFISLDAAGTGTITLNLHEFLSPFF 697          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007888.1 (pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1 gene:ENSPMAG00000007039.1 transcript:ENSPMAT00000007888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 328.946 bits (842), Expect = 1.350e-102
Identity = 202/567 (35.63%), Postives = 305/567 (53.79%), Query Frame = 2
Query:  902 KMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAI---ESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTG--TVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEK------------------PNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXX----XXXFNDMAGPMEVINACQLRDILNAILVK--DIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGV-ITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            ++ G YE+LSGGS  E  EDFTGG+ E+I+LN+   P  L+  + +   + +LMGC+I     A  E + +  L+ GHAYS+T   +V    G +V LVR+RNPWG + EW G WSD++P+W  +S  ++ RL  +   DGEFWM+F+DF + F+++EIC+L P++L++D  G   W     +GSW +  +AGGCRNFI       +F ++  + DD+  +N    T I+ LMQK+ R+ R  G   L +GY IY++ +   G     L K +F++ ++ A+S  FIN REV  R  LP G Y+++PSTF PN+EA+F+LRIFSEK                  P  T T        +   H R+     +  P    S                   KLF+ +AG  + I+A +L+ ILN ++ K        GF LE CRS+V+L D D T K+  K+F  +WK IK W+  F ++D D  G  +  E R AL   G  ++  L ++V  RY D E G+ I F++++  ++RL   F T +   +D          +FL   ++
Sbjct:    1 RLQGSYEALSGGSTTEGFEDFTGGVAESIELNKP--PSNLWRMLQQATLRGSLMGCSINITSQADSEAITSRKLVKGHAYSLTGTTEVDY-QGQMVRLVRIRNPWG-QVEWTGAWSDNAPQWGYVSDEDRGRLQVS-QEDGEFWMSFEDFLRQFSRLEICNLTPDALDDDSLG--HWSANNFEGSWVRGCSAGGCRNFIVHLWEKWKFHLKHTEEDDDPHDNEAGCTFIVALMQKERRKKRRQGGDVLTVGYAIYEVPEQFVGQPQVKLKKDYFQYHSSKARSEVFINLREVSQRFTLPAGEYIVVPSTFEPNQEADFILRIFSEKQSVTVSARTTTSNTSPHSPTHTCTYTNTRIPHDGCSHTRERAHSRARTPTPRHSDAPTSFTSFKFSSTCPRFYKLFDRLAGEDQEISAKELQSILNRVVSKLHSTVTTDGFGLEACRSMVSLMDKDGTAKLGVKEFNFLWKKIKNWQQIFLEYDTDSTGTMNSMEMRLALEAAGFRLNEKLNQIVTTRYADGENGITIDFDNYVCCLVRLETMFRTFQALEKDGNEKINLNLPQFLHVTMF 560          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO40193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W7])

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 304/689 (44.12%), Postives = 425/689 (61.68%), Query Frame = 2
Query:  452 DLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTD---QDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAI--ESAKIEGVMANGLISGHAYSITDVQKVK---QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR---QRNLGFLVIGYVIYKLKDP--NCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLE 2479
            D+  Q++ TGK +ED +F A  SS+F SK  +  R F WKRP DIC++P +F  G SR D+QQG LGDCWLLA +A+L+ +  +   VVP D      D+NY GA +F  W++G+W +V++DDRLPTY GKLVF+HS++ NEFWSALLEKAYAK+ G YESL GG   EA+EDFTGGL E+  LN K  P  L+  M    K+  LMGC+I  ++ +IE  + NGL+ GHAY++T  ++VK   +     VELVRVRNPWGNE+EWKG W D S EW+ +S  EK+ +   F +DGEFWM+FDDF K+FT +EIC LG +S  E  S    +E   E G W + + AGGCRNFI +F  NPQFR   +   D+D+++  TVII LMQKD R   +  +  L IG+ IYKL++     G L+  FF++  + A+SP FIN REV GR+ LP G YV+IP+TFNPNEE NF+LR++SEK +KT  +D    KT  A   +    +  +Q  +  S            + ++ F++++G    I+A +L+ IL+  L  D+   K F LE  RS++++ D D +GK+ F++F + W  +K W   F+ FD D +G  D +E R AL   G ++SN++   V+ RY   + G +  +DF+  + RL       + Q         F  D+FLE
Sbjct:    8 DVRRQVRSTGKPFEDDEFLAIDSSIFFSK--RPPRPFEWKRPSDICEDPHMFVGGASRLDIQQGMLGDCWLLAAIAALTQHSALMNKVVPQDYVANPNDRNYTGALKFCIWQYGEWKDVIIDDRLPTYNGKLVFVHSSERNEFWSALLEKAYAKLNGSYESLKGGQTGEALEDFTGGLAESFDLN-KNVPKDLFCIMQTAEKRHALMGCSIAAKANEIEAKLNNGLVKGHAYTVTGCRQVKAKTRRGDLDVELVRVRNPWGNEREWKGAWGDGSSEWQLLSDYEKKSIGLTFEDDGEFWMSFDDFKKHFTTLEICMLGADSAMEGSSVG--FESRSEHGMWRRGLTAGGCRNFIKTFHKNPQFR-ITLQDSDDDADDLCTVIIALMQKDRRKEKKHGINPLTIGFSIYKLEEEKDKQGNLDMEFFQYHASTARSPVFINSREVVGRYALPPGEYVVIPTTFNPNEEGNFVLRMYSEKAHKTCEVD---EKTEFAPQHQRRVQISREQHDTLNS------------KFKEFFDNLSGRDGEIDAKELQQILSTALKNDLGG-KPFSLEGARSIISMYDEDASGKLGFEEFKETWLQVKKWMKIFQVFDEDKSGEMDTYELRGALKEAGFTLSNSVLYAVSARYSTGD-GKVNVDDFMEILTRLNILSAAFQKQAGQGGRRAAFDIDQFLE 673          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO48633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ83])

HSP 1 Score: 491.5 bits (1264), Expect = 1.855e-163
Identity = 269/677 (39.73%), Postives = 400/677 (59.08%), Query Frame = 2
Query:  419 KEDVGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDK-NYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE-----SAKIEGVMANGLISGHAYSITDVQKVKQTD---GTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNL--GFLVIGYVIYKL-KDPNCG-LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAF 2410
            +  + ++  +  L  QL  + +L+ED DFPA    +F  + S    + +WKRP +I K+PQ  A G S  DV QG + +CW +A +A L+    +  +V P DQ F+  +Y G FRF FW+FG+WVE++VDD LPTY G+L F  S D +EFWSALLEKAYAK+CG YE++S G   EA++D TGG+ E + L     P GL+N M+K  ++ +LMGC+IE     S + EG + NGLI+ HAYSIT ++K   +       V+L+R+RNP  N  EW+G WSD SPEW  +S  EK  L   F +DGEFWM+FDDF  NFT++EIC L P+S+ ++   +R+W++  E G W K + AGGCRNFI SF TNPQFR   +   D+D +   TVI+ LM+ D   R        IG+ IYK   D   G  L+++FF+++  +A +  F   RE+  R++L  G YV+IPSTFNP +E +F+LRIFSE+P     +D +   T+  K +   DD  S   +  E                 +F+ MAG    ++  +L++IL+    +++ N   F LE CRS++++ D D +G + + +F  +   ++ WK  F  +D D +G  + +E R+AL  +G  +SN+    +  RY + ++G I+F+ FI  V+R+   F
Sbjct:    3 RRALHKRERFASLQRQLLNSKRLFEDRDFPASNRVLFTRRRSV---QLIWKRPHEISKSPQFIARGFSSSDVAQGRIRNCWFVAALADLTTNIDLLHHVCPPDQSFEPGSYCGMFRFNFWQFGEWVEIIVDDYLPTYNGRLYFTKSDDPDEFWSALLEKAYAKLCGSYEAMSLGRISEALQDMTGGMIENVDLQNP--PHGLFNVMMKAYERQSLMGCSIEVKKYSSDQYEGTLENGLITRHAYSITGLRKATLSSLRGRPEVDLIRLRNPHANSSEWRGAWSDRSPEWNMLSSQEKRELNLTFDDDGEFWMSFDDFLNNFTRLEICMLTPDSMEQN--DRRKWDVQNEKGRWQKGVTAGGCRNFIASFYTNPQFR-VCLKNPDDDDDELCTVIVSLMRVDHSHRVKIPDRAPIGFAIYKAPSDMRKGDRLDRAFFEYNKAVAMTTSFSKLREISSRYRLHAGEYVVIPSTFNPGQEGDFLLRIFSERPQYASEIDQETKMTSGPKVVITQDDAKS---IDHE--------------FWDVFHQMAGEDGEVDQYELQEILSKSFTRELNN-NLFALEACRSMISMFDTDRSGALGYNEFRALMILLEKWKNHFHKYDRDHSGDMNAYELRDALNGLGYQLSNSAMSSLVLRYHN-KRGTISFDTFIQIVVRVVVMF 652          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO34860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN59])

HSP 1 Score: 340.887 bits (873), Expect = 8.598e-106
Identity = 194/504 (38.49%), Postives = 294/504 (58.33%), Query Frame = 2
Query:  446 YFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKN--PQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTD--QDFD----KNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLN------EKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTV-------VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGK--RRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGT-VIIGLMQKDMRQ---RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLD 1867
            Y  L  + +   +L+ D  F  +TSS++ S++        WKRP +IC    P LF DG    DV QG LG+CW +A  +SL+L   +   V+P    Q++D    +NY G FRFRF+R G+W EVVVDD LPT  GKLV++HS + NEFWSAL+EKAYAK+ G YE+L+ GS  +A+ DFTGG+ E I L+      ++E+ + L+  + +  K+ +LM  +I+     ++E  +  GLI GHAY +T V+KV   +G +         ++R+RNPWG EKEW G+WSD S EW+ +   +++++   F NDGEFWM FDDF + FT   +CH+    +N+ +  K  ++W +   + +W +  NAGGC    D+F+ NPQ+           ++N G   ++ LMQ+D R+   + +G L IG+ I K+++     ++  F K   +I     FIN REV  R  L  G Y+++PST+ P+   +FM+RIF+ K +    LD
Sbjct:   12 YSKLKAECEKNEQLFVDSVFKPETSSLYYSRSCPP-EPVEWKRPSEICHPAVPHLFVDGADSHDVTQGKLGNCWFVAACSSLALRPFLLYKVIPDKDKQEWDPKKPENYQGIFRFRFYRQGEWTEVVVDDLLPTVNGKLVYIHSKEKNEFWSALIEKAYAKLAGTYEALAAGSTADALVDFTGGVAEAISLSNGGYAEDQEKRLQLFKTLERGHKEKSLMSASIKINNRNEMEQRLDTGLIKGHAYGVTMVKKVTVGEGLLSLFNKKHFYMIRLRNPWG-EKEWNGRWSDESEEWKKLKPGDRKKMGIVFENDGEFWMEFDDFCREFTDCTLCHV----INKAMIHKVFKQWHIYKHNYNWTQGQNAGGCVQNQDTFLKNPQY-------AFSITDNEGEDAMVSLMQEDRRKDKSKGVGNLTIGFYIMKVEENRKYRVHSMFPKAGDSI-----FINAREVMNRFFLAAGRYLVVPSTYEPHTPGHFMMRIFTRKRSNAMFLD 497          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO48536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ84])

HSP 1 Score: 330.872 bits (847), Expect = 2.525e-102
Identity = 189/497 (38.03%), Postives = 262/497 (52.72%), Query Frame = 2
Query:  578 KDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTD----QDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESL--NEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ---RNLGFLV---------------IGYVIYKLKDPN-------------------------CGLLNKSFFKFSTTIAKSPG-------------------FINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTL 1864
            ++IC  P+ + DG SR D++QG LG+CWLLA ++ L+ ++P+   ++P        F   Y G   F+ W++G+WV V++DDRLPTY GKLVF+HS + NEFW ALLEKAYAK+ G YE+L GG   EA+EDFTGGL E   L +   P  L+  M +  K+S LMGC+I          N  +S              T G  VEL+R+RNPWG+EKEW G W D SPEW+ +S+ EK  L   F  DGEFWM+F+DF  +F K+E+C L  E+      +S   R    +E+G W K+++AGGCRNF+++F TNPQFR+          E TG  +  +  + M +     +GF +                G+ +YK+ +                           CG +  + +K      +  G                   FIN REV GR +L  G YVI+PSTF  N EA+F+LRIFSEK   +  L
Sbjct:   11 QEICSEPRFYVDGASRLDIKQGVLGNCWLLAAMSVLAQHKPLVDRIMPEGVYEADRFSPRYTGKVVFKLWQYGEWVTVIIDDRLPTYKGKLVFVHSPEKNEFWCALLEKAYAKIHGSYEALKGGLTGEALEDFTGGLSEVFVLEDA--PANLFQIMQRAEKRSALMGCSI----------NVFLS--------------TRGG-VELIRIRNPWGDEKEWTGAWGDRSPEWQELSQDEKRSLDLEFDVDGEFWMSFEDFKSHFDKLEVCMLDVENAIDKTQISFNSR----LENGFWRKHVSAGGCRNFLETFHTNPQFRLVSRVMSRMICEGTGFALYKVSNRVMSREICEGIGFALYKVSNRVISKVLCEGTGFALYKVSNRVISRVICEGTGFALYKVSNRVISRVICGGIGFALYKIDDITKRKYGVSRLDKEYFQFNKSTERSTFINSREVVGRFELAPGEYVIVPSTFIQNAEADFLLRIFSEKAVSSSAL 476          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO37991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE78])

HSP 1 Score: 154.066 bits (388), Expect = 5.090e-39
Identity = 102/345 (29.57%), Postives = 168/345 (48.70%), Query Frame = 2
Query:  407 TPKKKEDVGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVS-KASKGYREFVWKRPKDI-----CKN--PQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVG---------LYNQMLKFAKQSTLMG--CAIESAKIE--GVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHL 1378
            T +K+++   +     +++  K     + D  FP    S++++ + S+  R   W RP +I     C+   P          D+ QG LGDCW L+ +A L+    + + ++ T +   +   GA++ R  + GKW  +++DD LP           A   + W  L+EKA AK+ G YE+L+ G  IE +   TG  CE+I L+E +   G         ++ Q++       LMG  C  ++   E  G  A GL + HAYS+ DV+ V       + L+R+RNPWG +  W G WSD+S  W   +   +  L  + A +G FWM+ +DF K F  +++C +
Sbjct:   17 TRRKRDETHARDQLSRIVDYCKTQEIQFVDDSFPPVLKSLYINPRHSEHPRVADWLRPNEIDNFSTCRTNIPWAVFRNPRPSDIIQGVLGDCWFLSSLAVLAERPELLEKILITREVSPQ---GAYQVRLCKDGKWTVILIDDLLPCNQRGQPVYSWAHRRQLWVPLIEKAMAKLHGSYEALTAGRSIEGLATLTGAPCESIALHESQNNSGNTEPIDKDLIWAQLISSRTAGFLMGASCGGDTQPEEEPGYNAVGLQTHHAYSVLDVRDVHG-----IRLLRLRNPWG-QYSWTGDWSDASSLW---TPELRHELMVHGAQEGVFWMSLEDFMKYFDSVDVCKI 349          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 512.686 bits (1319), Expect = 1.825e-170
Identity = 291/694 (41.93%), Postives = 426/694 (61.38%), Query Frame = 2
Query:  464 QLKGTGKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVK--QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            Q KG   L+ED  FPA   S+    +   S   +  VWKRPK+IC NPQ    G SR D+ QG LGDCWLLA +A L+L E +   VVP +Q F ++Y G F F+FWR+G WV+VVVDDR+PT   +LVF  SA+ NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  KE P  LY  M K  ++ +LMGC+I+S   A+ E     GL+ GHAYS+T V + +  Q   + V LVR+RNPWG + EW G WSD+S EW T+SK+EKE+L    A DGEFWM+F+DF KN+TKIEIC+L P++L +D   K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+ +++ DD+  +N    T ++ LMQK+  R+R +G     IG+ IY++     G    L K FF  +++ A+S  +IN REV  R +L  G YVI+PST+ P++E  F+LR+FSEK N ++ ++               + +++D PV   +     +    +     +F ++AG    I A +L+++LN ++   KD+ N  GF LE CRS++AL D D TG++  ++F  +W  IK W+  FK ++ D +G+ + +E RNA+ + G  ++N L+ ++  RY + E   I F+ FI  ++RL   F   +   +D +G    +  E+L+  +Y
Sbjct:   46 QRKG---LFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSESYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM--KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDECRPSQQKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKIHK--WTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEVPKEMHGNKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE---------------NRIEADHPVP--APASVGEESEEDHHFRTIFQEIAGEDMEITANKLKNVLNRVITERKDL-NTVGFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYAN-ENMNIDFDSFISCLVRLEAMFRAFQAFDQDGDGTIRLSVLEWLQLTMY 712          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 509.99 bits (1312), Expect = 3.081e-169
Identity = 285/667 (42.73%), Postives = 416/667 (62.37%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEG 2446
            L+ED  FPA   S+    +   S   +  VWKRPK+IC NPQ    G SR D+ QG LGDCWLLA +A L+L E +   VVP +Q F ++Y G F F+FWR+G WV+VVVDDR+PT   +LVF  SA+ NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  KE P  LY  M K  ++ +LMGC+I+S   A+ E     GL+ GHAYS+T V + K++    V LVR+RNPWG + EW G WSD+S EW T+SK+EKE+L    A DGEFWM+F+DF KN+TKIEIC+L P++L +D   K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+ +++ DD+  +N    T ++ LMQK+  R+R +G     IG+ IY++   N   L K FF  +++ A+S  +IN REV  R +L  G YVI+PST+ P++E  F+LR+FSEK N ++ ++               + +++D PV   +     +    +     +F ++AG    I A +L+++LN ++   KD+ N  GF LE CRS++AL D D TG++  ++F  +W  IK W+  FK ++ D +G+ + +E RNA+ + G  ++N L+ ++  RY + E   I F+ FI  ++RL   F   +   +D +G
Sbjct:   50 LFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSESYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM--KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDEQKESK---VRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKIHK--WTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEMHG-NKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE---------------NRIEADHPVP--APASVGEESEEDHHFRTIFQEIAGEDMEITANKLKNVLNRVITERKDL-NTVGFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYAN-ENMNIDFDSFISCLVRLEAMFRAFQAFDQDGDG 688          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 508.449 bits (1308), Expect = 1.946e-168
Identity = 285/672 (42.41%), Postives = 416/672 (61.90%), Query Frame = 2
Query:  485 LWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVK--QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILV--KDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEG 2446
            L+ED  FPA   S+    +   S   +  VWKRPK+IC NPQ    G SR D+ QG LGDCWLLA +A L+L E +   VVP +Q F ++Y G F F+FWR+G WV+VVVDDR+PT   +LVF  SA+ NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  KE P  LY  M K  ++ +LMGC+I+S   A+ E     GL+ GHAYS+T V + +  Q   + V LVR+RNPWG + EW G WSD+S EW T+SK+EKE+L    A DGEFWM+F+DF KN+TKIEIC+L P++L +D   K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+ +++ DD+  +N    T ++ LMQK+  R+R +G     IG+ IY++     G    L K FF  +++ A+S  +IN REV  R +L  G YVI+PST+ P++E  F+LR+FSEK N ++ ++               + +++D PV   +     +    +     +F ++AG    I A +L+++LN ++   KD+ N  GF LE CRS++AL D D TG++  ++F  +W  IK W+  FK ++ D +G+ + +E RNA+ + G  ++N L+ ++  RY + E   I F+ FI  ++RL   F   +   +D +G
Sbjct:   50 LFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSESYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM--KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDECRPSQQKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKIHK--WTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEVPKEMHGNKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE---------------NRIEADHPVP--APASVGEESEEDHHFRTIFQEIAGEDMEITANKLKNVLNRVITERKDL-NTVGFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYAN-ENMNIDFDSFISCLVRLEAMFRAFQAFDQDGDG 697          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3b (calpain-3 [Source:NCBI gene;Acc:101169329])

HSP 1 Score: 496.508 bits (1277), Expect = 1.688e-163
Identity = 287/716 (40.08%), Postives = 423/716 (59.08%), Query Frame = 2
Query:  422 EDVGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQT--DGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNT-GTVIIGLMQKDMR-QRNLG--FLVIGYVIYKLKDPNCGL---LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXX------------XXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVK--DIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLY 2491
            +D  +  ++ +L ++      L+EDP FPA+ SS+F S   K   +  WKRP +IC+NPQ   DG +R D+ QG LGDCWLLA +A L+L E +   V+P +Q F +NY G F F+FWR+G+W+++VVDDR+PT    LVF  S   NEFWSALLEKAYAK+ G YE+L GG+ ++AMEDFTGG+ E  +L+E   P GL+  M K  ++ +LMGC+I+   +  IE     GL+ GHAYSI  +++  Q   DG  + L+R+RNPWG    WKG WS +S EW T+S ++++ L        EFWM+FDDF KNFTK+E+C+L P++L  D   ++ W + I +G W +  +AGGCRNF D+F TNPQ+R+ + + DD + E    TV++ LMQK  R QR+ G  FL IG+ IY++     G    L K FF ++ + AK   +IN REV  R +LP G YVI+P+TF  +EE  F+LR+FSE  NK+ + + +     I   +  +D   +++ +  E               +  +    EK+   ++  +AG    I A +L  I+  +L K  +IK+  GF LE CRS++AL D D +GK+  ++F  +WK IK W+  FK +D DG      FE RNA+ + G +++  L+ ++A RY D     I F+ +I   +RL   F       +D +G       E+L+  +Y
Sbjct:   56 KDAKRLKTFLELRDKYVKKKVLFEDPLFPANDSSLFYSH--KPSMKIEWKRPTEICENPQFIIDGANRTDICQGELGDCWLLAAIACLTLSEKLLYRVIPPEQSFTENYAGIFHFQFWRYGEWIDIVVDDRIPTCNNLLVFTKSFRENEFWSALLEKAYAKLHGSYEALKGGNTLDAMEDFTGGVTELFELSEA--PKGLFIIMKKALERGSLMGCSIDVTTANDIESRTNQGLVRGHAYSIIALEECDQVSEDGK-IRLIRLRNPWG-WVLWKGPWSVNSKEWSTVSTADRDNLKKQTLEMSEFWMSFDDFKKNFTKLEMCNLTPDALTGD--ERQSWTVSINEGRWVRGSSAGGCRNFPDTFWTNPQYRLRLYEEDDPEEEQVLCTVVVALMQKGRRMQRHAGAKFLTIGFSIYEVPKELQGQNQHLQKDFFLYNASKAKCKAYINLREVTERFRLPPGEYVILPTTFKAHEEGEFLLRVFSE--NKSTSEEAETSIDKIEPIVFVSDRARTNKEIEHEGIRGEKKKKPKRKPLQAVEETEEEKQFRVIYQKIAGEDMEICASELMAIMKNVLSKHSEIKS-DGFSLETCRSMIALMDTDGSGKLNLQEFKHLWKKIKEWQLIFKRYDKDGKCSISSFEMRNAVNDAGFNLNKQLYDIIAMRYADKHLN-IDFDSYICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMY 759          
BLAST of Calpain vs. Ensembl Medaka
Match: capn9 (calpain 9 [Source:NCBI gene;Acc:101158662])

HSP 1 Score: 489.96 bits (1260), Expect = 2.315e-162
Identity = 279/696 (40.09%), Postives = 409/696 (58.76%), Query Frame = 2
Query:  392 VQAKHTPKKKEDVGQQTSYFD--LLEQLKG----TGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVA------LEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMEL 2425
            +Q+  + KK   V  +++ +D    EQL+      G L+EDPDFPA  SS+F S+      +  WKRPK+IC+NP+    G  R D+ QG LGDCWLLA +ASL+L +     VVP DQDFD NY G F F+FW+  KW++VVVDDRLPT   +L+ +HSA N+EFWSALLEKAYAK+ G YESL GGS +EAMEDFTGG+ E  +   K  P  L++ M K   + ++MGC+I+   SA+ E   + GL+ GHAYSIT ++++ Q  G  V+L+RVRNPWG + EW G WSD+S EW  I K EK+R+  N   DGEFWM F+DF KN+ K+EIC++ P++L++D   KR W + + +G+W +   AGGCRN+ID+F TNPQFR   ++  D+D ++  +V+I LMQK+   +R+  L    IG+ +Y+  D     + K FF++  + A+S  +IN REV  R  LP G Y+++P+T+ P++EA+F++RIFSEK            +T+  K LR                              +LF+ +AG +   N                +NF    +    +L++          D+TG +EF++F   W+ +K W   F  FD D +G    +E R+AL   G+ ++N L ++V  R+ D +   I F+D++  ++RL N F+  E+
Sbjct:    3 LQSTLSGKKSSSVQAESTQWDGKTFEQLRQECLQKGVLFEDPDFPAVDSSLFYSQTVP--VQIQWKRPKEICENPKFIVGGADRTDICQGQLGDCWLLAAIASLTLKKDAMARVVPPDQDFDHNYAGIFHFQFWQHNKWLDVVVDDRLPTVRNRLIMLHSASNDEFWSALLEKAYAKLNGSYESLKGGSTMEAMEDFTGGVGEMYET--KSAPENLFSIMKKALDRGSMMGCSIDITSSAESEAKTSTGLVKGHAYSITGMEEL-QFRGQTVKLIRVRNPWG-QVEWNGAWSDNSREWNYIDKKEKDRILQNSLEDGEFWMEFEDFKKNYDKVEICNMTPDALDDDT--KRHWAVNVFEGNWIRGSTAGGCRNYIDTFWTNPQFR-LQLEDADDDDDDVCSVVIALMQKNRRKLRKEGLDLETIGFAVYEAPDDESQ-VEKDFFRYHPSKARSRTYINMREVSERFTLPPGKYLLVPTTYQPHQEADFIIRIFSEKKADPPMPTPPEEETDEEKSLR------------------------------RLFDQLAGDVREQN----------------QNFPPTRISYEANLLSGCFPERRNQVDNTGMIEFQEFKVFWEKMKNWIMLFLAFDTDRSGKMSSYELRSALKAAGMQLNNQLLQLVGLRFGD-DTFNIDFDDYLTCIVRLENMFKLTEI 641          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000062902.1 (SMESG000062902.1)

HSP 1 Score: 1376.3 bits (3561), Expect = 0.000e+0
Identity = 697/703 (99.15%), Postives = 699/703 (99.43%), Query Frame = 2
Query:  386 SKVQAKHTPKKKEDVGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            SKVQAK TPKKKEDVGQQTSY DLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREF WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSENTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTT+AKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESKVKNEKLVALEKELEKLFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDH+GKMEFKDFMKIWKDIKVWKTAFKDFD DGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM
Sbjct:   32 SKVQAKQTPKKKEDVGQQTSYSDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSENTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESKVKNEKLVALEKELEKLFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHSGKMEFKDFMKIWKDIKVWKTAFKDFDSDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 734          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 1258.05 bits (3254), Expect = 0.000e+0
Identity = 628/700 (89.71%), Postives = 664/700 (94.86%), Query Frame = 2
Query:  395 QAKHTPKKKEDVGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            Q K TP KK D+ +QTSY D+LE LKGTGKLWEDPDFPADTSSVFVSKASKGYREF WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTY G+LVFMHSADNNEFWSALLEKAYAKMCGIYESL+GGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSE+TGTVIIGLMQKDMRQRNL FLVIGYVIYKLKDPNCGLLNKSFFKFSTT+AKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEK NK+  LD++NGKT IAKHLR+TD VD  + VSEE KVKNEK++ALEK+LE+LF  MAGPMEVINACQLRDILNA+L KD+KNFKGFDLE+CRS++AL+D DHTGKMEF +F+ +W ++++WKTAFKDFD D NGVFD +EFRNAL NVGL+VSN LFKV+ NRY DPE GVI FEDFIMAVIRLTNAFETMELQP+D+E NYVFTA+EF+ESFLYM
Sbjct:   35 QLKPTPMKKRDLDKQTSYSDILEHLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSEDTGTVIIGLMQKDMRQRNLDFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVSEEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMESFLYM 734          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 1246.49 bits (3224), Expect = 0.000e+0
Identity = 619/700 (88.43%), Postives = 657/700 (93.86%), Query Frame = 2
Query:  395 QAKHTPKKKEDVGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            Q K TP KK D+ +QTSY D+LE LKGTGKLWEDPDFPADTSSVFVSKASKGYREF WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTY G+LVFMHSADNNEFWSALLEKAYAKMCGIYESL+GGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSE+TGTVIIGLMQKDMRQRNL FLVIGYVIYKLKDPNCGLLNKSFFKFSTT+AKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEK NK+  LD++NGKT IAKHLR+TD VD  +  +E+       ++ALEK+LE+LF  MAGPMEVINACQLRDILNA+L KD+KNFKGFDLE+CRS++AL+D DHTGKMEF +F+ +W ++++WKTAFKDFD D NGVFD +EFRNAL NVGL+VSN LFKV+ NRY DPE GVI FEDFIMAVIRLTNAFETMELQP+D+E NYVFTA+EF+ESFLYM
Sbjct:   35 QLKPTPMKKRDLDKQTSYSDILEHLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSEDTGTVIIGLMQKDMRQRNLDFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDEVKVKNEK-------ILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMESFLYM 727          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 620/700 (88.57%), Postives = 654/700 (93.43%), Query Frame = 2
Query:  395 QAKHTPKKKEDVGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            Q K TP KK D+ +QTSY D+LE LKGTGKLWEDPDFPADTSSVFVSKASKGYREF WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTY G+LVFMHSADNNEFWSALLEKAYAKMCGIYESL+GGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSE+TGTVIIGLMQKDMRQRNL FLVIGYVIYKLKDPNCGLLNKSFFKFSTT+AKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEK NK+  LD++NGKT IAKHL              E KVKNEK++ALEK+LE+LF  MAGPMEVINACQLRDILNA+L KD+KNFKGFDLE+CRS++AL+D DHTGKMEF +F+ +W ++++WKTAFKDFD D NGVFD +EFRNAL NVGL+VSN LFKV+ NRY DPE GVI FEDFIMAVIRLTNAFETMELQP+D+E NYVFTA+EF+ESFLYM
Sbjct:   35 QLKPTPMKKRDLDKQTSYSDILEHLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSEDTGTVIIGLMQKDMRQRNLDFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHL--------------EVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMESFLYM 720          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 361/703 (51.35%), Postives = 478/703 (67.99%), Query Frame = 2
Query:  428 VGQQTSYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDK-NYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES--AKIEGVMANGLISGHAYSITDVQKVK---QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNED-LSGKR--RWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQR---NLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNG--KTNIAKHLRDTDDVDSDQPVSEESXXXXXXXXXXXXXXXXXFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLESFLYM 2494
            VG    Y ++   L+G  KL+EDPDFPA   S++ S+  +  R+  WKRP +IC+NP+  ++G SRFDV+QG LGDCWLLA VA LSL+  +F  VVP+DQ+F K +Y G FRFRFWRFG W EV+VDDRLPTY  KLV+MHS D+NEFWSALLEKAYAK+ G YESL GGS  EA+EDFTGG+ E   + +KE P  L++ M K   + +LMGC+IE+   K E  + NGLI GHAYSITDV+ V          ++L+R+RNPWGNE EWKG WSD SPEW  IS++++  +   F +DGEFWM++ DF KNF K+EICHLGP+SL  D L GK+  RWEMCIE+G W K +NAGGCRNF+D+F TNPQFRV+VVDPD++D EN GT+IIGLMQKDMR+R    + F  IGY IY+LKD N G L+ ++FK++ ++AK+P FIN REVCGRHKLP G YVI+PSTF PN+EA+F++RIFSEKPN++  LD +     T   K +   DD                        L + FN +AG    I+A +L+DILN    KD K F GF +E  +S+VA+ DYD +GK+ F +F  +W D+++WK AFK FD D +G F+ +E R  L +VG  +SN +   +  R+ + E G++ F+D+I+  +RL   FET + QP D +   +F  D F++  +Y+
Sbjct:   95 VGPSQDYNNVKNSLRG--KLYEDPDFPAVNESLYFSQ--RPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDM-KKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTEPEKVVSPADDAQ-------------------IMALRQSFNQIAGQDLEIDAYELQDILNTAFKKDFK-FDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKE-GLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQCIMYV 771          
The following BLAST results are available for this feature:
BLAST of Calpain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN91.486e-17443.05calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486][more]
CAPN35.979e-16740.32calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN37.213e-16539.35calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN23.234e-15840.18calpain 2 [Source:HGNC Symbol;Acc:HGNC:1479][more]
CAPN36.384e-15736.86calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
back to top
BLAST of Calpain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clp-15.827e-14248.43Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-15.827e-14248.43Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-15.827e-14248.43Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-12.266e-14148.63Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-13.161e-14148.42Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
back to top
BLAST of Calpain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CalpB0.000e+043.88gene:FBgn0025866 transcript:FBtr0076343[more]
CalpB0.000e+043.88gene:FBgn0025866 transcript:FBtr0304675[more]
CalpA7.240e-16350.71gene:FBgn0012051 transcript:FBtr0086530[more]
CalpA1.489e-15851.02gene:FBgn0012051 transcript:FBtr0112869[more]
CalpA1.489e-15851.02gene:FBgn0012051 transcript:FBtr0086529[more]
back to top
BLAST of Calpain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn93.517e-17542.57calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
capn3b2.247e-16842.86calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn3a2.977e-16841.06calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
capn3b4.672e-16642.61calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn3b2.139e-16141.92calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
back to top
BLAST of Calpain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN31.129e-17140.03calpain 3 [Source:NCBI gene;Acc:100497532][more]
tgfbrap14.952e-17042.15transforming growth factor beta receptor associate... [more]
tgfbrap12.583e-16842.15transforming growth factor beta receptor associate... [more]
CAPN36.727e-16538.18calpain 3 [Source:NCBI gene;Acc:100497532][more]
CAPN33.790e-16437.71calpain 3 [Source:NCBI gene;Acc:100497532][more]
back to top
BLAST of Calpain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capn92.577e-17041.07calpain 9 [Source:MGI Symbol;Acc:MGI:1920897][more]
Capn34.487e-16640.32calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn31.500e-16239.34calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn36.792e-15837.81calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn87.795e-15639.80calpain 8 [Source:MGI Symbol;Acc:MGI:2181366][more]
back to top
BLAST of Calpain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27730|CAN_SCHMA0.000e+046.48Calpain OS=Schistosoma mansoni OX=6183 PE=2 SV=1[more]
sp|Q9VT65|CANB_DROME0.000e+043.88Calpain-B OS=Drosophila melanogaster OX=7227 GN=Ca... [more]
sp|O35920|CAN9_RAT4.447e-17542.58Calpain-9 OS=Rattus norvegicus OX=10116 GN=Capn9 P... [more]
sp|O14815|CAN9_HUMAN7.134e-17443.05Calpain-9 OS=Homo sapiens OX=9606 GN=CAPN9 PE=1 SV... [more]
sp|Q9D805|CAN9_MOUSE1.802e-16941.07Calpain-9 OS=Mus musculus OX=10090 GN=Capn9 PE=2 S... [more]
back to top
BLAST of Calpain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GW140.000e+054.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GXB30.000e+054.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DE360.000e+053.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JIV80.000e+053.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2R2MIP40.000e+049.65calpain-A OS=Lingula unguis OX=7574 GN=LOC10615677... [more]
back to top
BLAST of Calpain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:552621.368e-16041.11calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
capn3b8.283e-15739.83calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn1a2.864e-15337.66calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
si:dkeyp-50d11.24.372e-15238.78si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-... [more]
zgc:552629.622e-15139.25calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
back to top
BLAST of Calpain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn93.123e-16544.71calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
capn3a9.669e-15637.57calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
ENSPMAT00000003998.18.059e-15538.35pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 g... [more]
capn1a2.873e-12135.90calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc... [more]
ENSPMAT00000007888.11.350e-10235.63pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1... [more]
back to top
BLAST of Calpain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calpain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401930.000e+044.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486331.855e-16339.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348608.598e-10638.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485362.525e-10238.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379915.090e-3929.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calpain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn3a1.825e-17041.93calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3a3.081e-16942.73calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3a1.946e-16842.41calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3b1.688e-16340.08calpain-3 [Source:NCBI gene;Acc:101169329][more]
capn92.315e-16240.09calpain 9 [Source:NCBI gene;Acc:101158662][more]
back to top
BLAST of Calpain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062902.10.000e+099.15SMESG000062902.1[more]
SMESG000062904.10.000e+089.71SMESG000062904.1[more]
SMESG000062904.10.000e+088.43SMESG000062904.1[more]
SMESG000062904.10.000e+088.57SMESG000062904.1[more]
SMESG000039299.10.000e+051.35SMESG000039299.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013312 ID=SMED30013312|Name=Calpain|organism=Schmidtea mediterranea sexual|type=transcript|length=2680bp
TTGTTCATTTTTTTCCGAAAGCGCCAATCTGGATACCCTCGGCAACAGTT
CTTGCTAAACAATTGCTGTTGATAAATAATGTTTTTCATTAAAATTCTGT
TAAGTTCAAAAACAGGACAGAGCAAAGATGTGTTGGTTCATTGAAGCCAT
TCATATTTACACGCTTGATTCTATTGAATGGACAAGTCAGGTCGGTTGGT
ACCAACACAAATAGAGAAAAATAGCATTTTATATTCAAATTAAATTTTTG
CTGTTTATTTTTTACTGAACATTCATTTTGTCCAAAGCGTTAATGAGTTC
TTCGAAAAGTGTAACAACGAAAGTGACATCAACCAAGACGACCAGGATTG
GGGGAGGCACTACTACGACAACGACGAAAACTGCGTCAAAAGTACAAGCC
AAACATACACCAAAGAAAAAGGAAGATGTGGGTCAACAAACTTCATATTT
TGATCTACTGGAACAGTTGAAAGGAACTGGGAAATTGTGGGAAGATCCAG
ATTTTCCAGCAGATACTTCTTCTGTATTTGTCAGTAAAGCTAGTAAAGGA
TATCGGGAATTTGTGTGGAAACGACCAAAGGACATTTGTAAAAATCCGCA
ATTATTTGCTGATGGTGTCAGTAGATTTGATGTTCAACAAGGAGCGCTAG
GAGACTGTTGGCTTCTAGCTGTGGTGGCTTCTTTATCTCTGTATGAACCG
ATCTTTAAAAATGTAGTTCCAACTGATCAAGATTTTGATAAAAACTATAT
TGGAGCGTTTCGATTTCGATTCTGGAGATTTGGTAAATGGGTTGAAGTAG
TTGTTGATGACCGTTTACCGACGTACGGGGGGAAATTAGTGTTCATGCAT
TCAGCCGATAACAATGAGTTCTGGTCTGCACTTTTGGAGAAGGCATATGC
CAAAATGTGTGGCATATACGAATCGCTAAGTGGGGGCAGTCAGATTGAGG
CCATGGAAGATTTCACTGGAGGTTTATGTGAAACTATTAAGTTGAATGAA
AAAGAAAGACCAGTCGGACTCTACAACCAAATGCTTAAATTTGCAAAGCA
GTCAACTTTAATGGGATGTGCAATTGAATCAGCTAAAATCGAGGGCGTCA
TGGCAAACGGTTTAATTTCAGGTCATGCGTATAGTATCACGGATGTTCAA
AAGGTTAAACAAACTGATGGAACTGTGGTGGAGTTGGTTCGAGTTCGAAA
TCCGTGGGGAAATGAAAAAGAATGGAAAGGAAAATGGTCTGATAGCTCTC
CTGAGTGGGAAACGATTTCTAAAAGTGAAAAAGAAAGGCTTTGCTCGAAT
TTTGCTAATGATGGAGAGTTTTGGATGACGTTTGATGATTTTGCAAAAAA
CTTTACGAAAATTGAAATTTGTCATTTGGGGCCGGAAAGTTTAAATGAAG
ATCTGAGTGGTAAGAGACGGTGGGAAATGTGCATAGAAGATGGCTCATGG
TGTAAAAATATAAATGCGGGAGGCTGTAGAAATTTCATTGATTCTTTTGT
TACTAATCCCCAATTTCGGGTGGAAGTTGTAGATCCAGACGATGAGGATA
GTGAGAACACGGGAACTGTCATTATCGGTCTAATGCAGAAAGATATGAGA
CAAAGAAACTTAGGTTTTTTGGTCATTGGCTATGTAATTTATAAACTGAA
AGATCCAAATTGTGGATTATTGAATAAATCATTCTTTAAGTTCTCAACAA
CTATTGCAAAATCTCCTGGATTTATTAACCAACGAGAAGTCTGTGGAAGG
CATAAGTTACCCACGGGTCATTATGTGATTATCCCATCAACATTCAATCC
TAACGAAGAAGCCAATTTTATGCTGAGAATTTTCAGTGAGAAACCAAATA
AAACCGATACACTGGACATAAAGAATGGTAAAACGAACATTGCTAAACAC
TTGAGAGATACCGACGATGTTGATTCTGATCAGCCCGTTTCGGAAGAATC
AAAAGTTAAGAACGAGAAATTAGTGGCCTTGGAAAAGGAATTAGAAAAAT
TATTTAATGATATGGCCGGACCGATGGAAGTTATAAATGCGTGTCAATTA
AGGGATATATTAAACGCGATACTGGTGAAAGATATAAAGAATTTTAAAGG
TTTCGATCTAGAATTATGCAGAAGTCTGGTAGCATTAGAAGATTACGACC
ACACTGGTAAAATGGAATTTAAGGATTTTATGAAAATTTGGAAAGACATA
AAAGTGTGGAAGACCGCATTCAAAGATTTTGATTGTGATGGAAACGGAGT
TTTTGACTGTTTCGAATTTAGAAATGCACTGATCAATGTCGGACTGTCCG
TAAGTAATGCATTGTTTAAAGTTGTTGCCAATCGCTATATAGATCCTGAA
AAAGGTGTAATAACATTCGAAGATTTCATAATGGCAGTAATTAGACTAAC
GAATGCCTTTGAAACTATGGAACTTCAGCCGGAAGATGATGAAGGGAATT
ATGTATTCACAGCTGACGAATTCTTGGAATCATTTCTCTATATGTGATTT
ATTTCAATTCTTCTTCTATTGTTAAATTACCAAACTAGTTTAAATGGAAA
TTTTTGACTTCTGCTGCGCTTTATCAGTAATATATAATATTTAAATGCTG
TAATCGAACTGGAAATTGTTTATTAAATTAATTTTTGCATGTCTCAAATA
ATTTTTTTAAAATAATAATGTGTAAAGAAA
back to top

protein sequence of SMED30013312-orf-1

>SMED30013312-orf-1 ID=SMED30013312-orf-1|Name=SMED30013312-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=735bp
MSSSKSVTTKVTSTKTTRIGGGTTTTTTKTASKVQAKHTPKKKEDVGQQT
SYFDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICK
NPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDK
NYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEK
AYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKF
AKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVR
VRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDF
AKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFID
SFVTNPQFRVEVVDPDDEDSENTGTVIIGLMQKDMRQRNLGFLVIGYVIY
KLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPST
FNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVS
EESKVKNEKLVALEKELEKLFNDMAGPMEVINACQLRDILNAILVKDIKN
FKGFDLELCRSLVALEDYDHTGKMEFKDFMKIWKDIKVWKTAFKDFDCDG
NGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVI
RLTNAFETMELQPEDDEGNYVFTADEFLESFLYM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004198calcium-dependent cysteine-type endopeptidase activity
GO:0005509calcium ion binding
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033883C2_III
IPR036213Calpain_III_sf
IPR038765Papain-like_cys_pep_sf
IPR022684Calpain_cysteine_protease
IPR022683Calpain_III
IPR001300Peptidase_C2_calpain_cat
IPR022682Calpain_domain_III
IPR011992EF-hand-dom_pair
IPR000169Pept_cys_AS
IPR002048EF_hand_dom
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 553..573
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 227..372
e-value: 2.8E-49
score: 168.2
NoneNo IPR availableGENE3DG3DSA:2.60.120.380coord: 376..525
e-value: 4.2E-49
score: 168.4
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 568..734
e-value: 4.8E-35
score: 122.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..35
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..50
NoneNo IPR availablePANTHERPTHR10183:SF396CALPAIN-A-RELATEDcoord: 49..699
NoneNo IPR availablePANTHERPTHR10183CALPAINcoord: 49..699
IPR022684Peptidase C2, calpain familyPRINTSPR00704CALPAINcoord: 182..205
score: 75.69
coord: 339..360
score: 61.36
coord: 152..177
score: 66.54
coord: 391..408
score: 62.22
coord: 488..516
score: 56.09
coord: 92..114
score: 49.28
coord: 116..132
score: 69.02
coord: 50..73
score: 32.92
coord: 207..234
score: 57.14
IPR001300Peptidase C2, calpain, catalytic domainSMARTSM00230cys_prot_2coord: 47..371
e-value: 3.4E-161
score: 551.5
IPR001300Peptidase C2, calpain, catalytic domainPFAMPF00648Peptidase_C2coord: 66..361
e-value: 2.4E-125
score: 417.5
IPR001300Peptidase C2, calpain, catalytic domainPROSITEPS50203CALPAIN_CATcoord: 65..363
score: 76.481
IPR001300Peptidase C2, calpain, catalytic domainCDDcd00044CysPccoord: 63..361
e-value: 1.02333E-127
score: 380.524
IPR022683Peptidase C2, calpain, domain IIISMARTSM007202calcoord: 376..522
e-value: 6.0E-57
score: 205.2
IPR022682Peptidase C2, calpain, large subunit, domain IIIPFAMPF01067Calpain_IIIcoord: 384..518
e-value: 1.8E-43
score: 148.2
IPR000169Cysteine peptidase, cysteine active sitePROSITEPS00139THIOL_PROTEASE_CYScoord: 116..127
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 634..669
score: 12.868
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 688..705
score: 6.089
IPR033883Calpain subdomain IIICDDcd00214Calpain_IIIcoord: 375..521
e-value: 2.59054E-52
score: 176.335
IPR036213Calpain large subunit, domain III superfamilySUPERFAMILYSSF49758Calpain large subunit, middle domain (domain III)coord: 377..522
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 48..370
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 565..730