Protein NDRG4

Overview
NameProtein NDRG4
Smed IDSMED30013306
Length (bp)1127
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein NDRG4 (SMED30013306) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein NDRG4 (SMED30013306) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein NDRG4 (SMED30013306) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein NDRG4 (SMED30013306) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013306

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30013306h1SMcG0006898 dd_Smed_v4_11017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013306h1SMcG0006898 dd_Smed_v4_11017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30013306h1SMcG0006898 dd_Smed_v4_11017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30013306h1SMcG0006898 dd_Smed_v4_11017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013306h1SMcG0006898 dd_Smed_v6_11017_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG1 (N-myc downstream regulated 1 [Source:HGNC Symbol;Acc:HGNC:7679])

HSP 1 Score: 113.235 bits (282), Expect = 1.706e-27
Identity = 75/287 (26.13%), Postives = 135/287 (47.04%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G +++ + G    N  +I T HD+G NHK  Y     +  M+ +       H+D PGQ D          +P+M ++A+ +  +  +  ++  +  G GAGA IL RFA+NN + V G+VLI+      G  +    ++  W      M       +V H FG E + +N      E+++ +++++   +NP NL+ FI ++ +R ++             L+CPAL V G+ +     V+   + L      DP +   L++    G+  +   +P K+AE+ +YF
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDM-------VVSHLFGKEEMQSNV-----EVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKL------DPTKTTLLKMADCGGLPQI--SQPAKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG1 (N-myc downstream regulated 1 [Source:HGNC Symbol;Acc:HGNC:7679])

HSP 1 Score: 113.235 bits (282), Expect = 1.706e-27
Identity = 75/287 (26.13%), Postives = 135/287 (47.04%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G +++ + G    N  +I T HD+G NHK  Y     +  M+ +       H+D PGQ D          +P+M ++A+ +  +  +  ++  +  G GAGA IL RFA+NN + V G+VLI+      G  +    ++  W      M       +V H FG E + +N      E+++ +++++   +NP NL+ FI ++ +R ++             L+CPAL V G+ +     V+   + L      DP +   L++    G+  +   +P K+AE+ +YF
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDM-------VVSHLFGKEEMQSNV-----EVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKL------DPTKTTLLKMADCGGLPQI--SQPAKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG2 (NDRG family member 2 [Source:HGNC Symbol;Acc:HGNC:14460])

HSP 1 Score: 101.679 bits (252), Expect = 7.022e-24
Identity = 79/289 (27.34%), Postives = 134/289 (46.37%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-AER--IYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            V TP  G +   + G   P    I T HD+G N+K  ++   +   M+ +    V +H+D PG  +      L  ++P++ ++AD I  +   LN    +  G GAGA ILAR+A+N+ D V G+VLI+      G  +    +L       TG+       ++ H F  E ++ NS     E+I  ++  +  + N  N+  +  S+ NR ++  ER     L+CP + V G+ A H   V+   + L      DP +   L++    G   +   +P K+ E+ +YF
Sbjct:   29 VETPY-GSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKL-------TGLTSSIPEMILGHLFSQEELSGNS-----ELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKL------DPTQTSFLKMADSGGQPQL--TQPGKLTEAFKYF 296          
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG2 (NDRG family member 2 [Source:HGNC Symbol;Acc:HGNC:14460])

HSP 1 Score: 101.679 bits (252), Expect = 1.632e-23
Identity = 79/293 (26.96%), Postives = 135/293 (46.08%), Query Frame = 2
Query:   47 EVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-AERI--YQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            +   V TP  G +   + G   P    I T HD+G N+K  ++   +   M+ +    V +H+D PG  +      L  ++P++ ++AD I  +   LN    +  G GAGA ILAR+A+N+ D V G+VLI+      G  +    +L       TG+       ++ H F  E ++ NS     E+I  ++  +  + N  N+  +  S+ NR ++  ER     L+CP + V G+ A H   V+   + L      DP +   L++    G   +   +P K+ E+ +YF
Sbjct:   39 QTHSVETPY-GSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKL-------TGLTSSIPEMILGHLFSQEELSGNS-----ELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKL------DPTQTSFLKMADSGGQPQL--TQPGKLTEAFKYF 310          
BLAST of Protein NDRG4 vs. Ensembl Human
Match: NDRG2 (NDRG family member 2 [Source:HGNC Symbol;Acc:HGNC:14460])

HSP 1 Score: 101.679 bits (252), Expect = 1.632e-23
Identity = 79/293 (26.96%), Postives = 135/293 (46.08%), Query Frame = 2
Query:   47 EVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-AERI--YQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            +   V TP  G +   + G   P    I T HD+G N+K  ++   +   M+ +    V +H+D PG  +      L  ++P++ ++AD I  +   LN    +  G GAGA ILAR+A+N+ D V G+VLI+      G  +    +L       TG+       ++ H F  E ++ NS     E+I  ++  +  + N  N+  +  S+ NR ++  ER     L+CP + V G+ A H   V+   + L      DP +   L++    G   +   +P K+ E+ +YF
Sbjct:   39 QTHSVETPY-GSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKL-------TGLTSSIPEMILGHLFSQEELSGNS-----ELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKL------DPTQTSFLKMADSGGQPQL--TQPGKLTEAFKYF 310          
BLAST of Protein NDRG4 vs. Ensembl Celegans
Match: ZK1073.1 (pep chromosome:WBcel235:X:16124151:16128865:-1 gene:WBGene00014213.1 transcript:ZK1073.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK1073.1)

HSP 1 Score: 221.09 bits (562), Expect = 2.165e-69
Identity = 118/319 (36.99%), Postives = 195/319 (61.13%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGN--RSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQL--KCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXXXXXRVHSLCNPLSRRLSMEQLDLPR 1003
            V    CGVL++Y+QGN      + II T+HD+G NHK + +F+ H SM  ++ + +++H+ +PGQ DN  D    +FPT+  I DD+  + D+  ++ A+ FGEG GANI+ RFAM + ++++GIVL+HCT TTAGI E  +++++  +L  + M+  A  YL+ H+FG    + S +E+ E        L+A++NP+NL+K++++F  R++++  I        AL VTG+ ASH HTV T + ++ K         KK  L+ V+ VA+V++E P+K+A SL    +G G++ G+ +  +    +   SME+ D PR
Sbjct:   11 VQAQNCGVLHVYVQGNLEERGGKTIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADF-FGDFPTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFGG--ESKSRQEYLE-------ELKATLNPKNLSKYLVAFTKRTDLSSTIGTKLETVDALLVTGSKASHLHTVYTTHKSMNK---------KKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSSSMEEADRPR 310          
BLAST of Protein NDRG4 vs. Ensembl Celegans
Match: ZK1073.1 (pep chromosome:WBcel235:X:16123942:16128815:-1 gene:WBGene00014213.1 transcript:ZK1073.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK1073.1)

HSP 1 Score: 221.09 bits (562), Expect = 2.165e-69
Identity = 118/319 (36.99%), Postives = 195/319 (61.13%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGN--RSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQL--KCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXXXXXRVHSLCNPLSRRLSMEQLDLPR 1003
            V    CGVL++Y+QGN      + II T+HD+G NHK + +F+ H SM  ++ + +++H+ +PGQ DN  D    +FPT+  I DD+  + D+  ++ A+ FGEG GANI+ RFAM + ++++GIVL+HCT TTAGI E  +++++  +L  + M+  A  YL+ H+FG    + S +E+ E        L+A++NP+NL+K++++F  R++++  I        AL VTG+ ASH HTV T + ++ K         KK  L+ V+ VA+V++E P+K+A SL    +G G++ G+ +  +    +   SME+ D PR
Sbjct:   11 VQAQNCGVLHVYVQGNLEERGGKTIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADF-FGDFPTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFGG--ESKSRQEYLE-------ELKATLNPKNLSKYLVAFTKRTDLSSTIGTKLETVDALLVTGSKASHLHTVYTTHKSMNK---------KKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSSSMEEADRPR 310          
BLAST of Protein NDRG4 vs. Ensembl Celegans
Match: Y48G10A.3 (pep chromosome:WBcel235:I:13471683:13474185:-1 gene:WBGene00013020.1 transcript:Y48G10A.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G10A.3)

HSP 1 Score: 112.079 bits (279), Expect = 9.932e-28
Identity = 76/285 (26.67%), Postives = 141/285 (49.47%), Query Frame = 2
Query:   77 GVLNIYIQGNRS-PNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-----AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G + + I G+R+ P +V + T HDLG + +  ++ F +  S+    ++    +++ PGQ  + + L     +PTM  IA  I+ + D   +   + FG G GAN+L R+A  N ++V+ +VL++C    +G  E   ++  T  L   GM      YL+ H FG + +  S     +++  ++   Q   NP +L +FI S++ R+ +          QLK P L + G  ++H      + +T++   K DP     +++    G+  VL ++P+ + ES+  F
Sbjct:   34 GAIKVSIYGDRNDPKKVPMVTFHDLGLDSESNFQNFFQFVSIAEFADKFCIYNVNAPGQEMDAQPLPENFTYPTMDGIAKTIESVADHFKLNQFIGFGVGVGANVLLRYAAQNQNRVIALVLVNCCSGKSGWVEWGYEKWNTSYLRKVGMTKFTVDYLMWHHFGRNYDRCSP----DIVRQYRVFFQHLPNPNSLAEFIESYIQRTPLPISRDGTTGVQLKVPVLQLVGAGSAH------VEDTVEVNTKLDPAHADWIKISDSCGL--VLDDRPDAVTESMMLF 306          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0078672)

HSP 1 Score: 188.348 bits (477), Expect = 4.335e-56
Identity = 90/287 (31.36%), Postives = 173/287 (60.28%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNE--VIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHI-NTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            ++T KCG L + +QG+ S  E   +  T+HDLGCNH  +++F+    M  ++ R  +IH+D+PG  DN E L +   FP++Q + +D+  + D L++++ +  GEGAGAN+LARF + +  +VLG++LI+ TG+ A + ++ +++ I+WK +    +  AES+L+ H+FG  I   N +KE  +++  +++ L  S+N +N+  ++ +FMNR ++   +   K   + +TG L+ +   V  L+  ++K         +++ ++++    +VL + P K+A+S+  F
Sbjct:   24 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQS--AESFLMYHKFGHQIVGENPDKE--KIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLT--LKGCKVDVILITGMLSPYASMVEKLHRDVEK---------ERVTILKIERAGDVLADAPGKVAQSILLF 295          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0300909)

HSP 1 Score: 188.348 bits (477), Expect = 4.335e-56
Identity = 90/287 (31.36%), Postives = 173/287 (60.28%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNE--VIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHI-NTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            ++T KCG L + +QG+ S  E   +  T+HDLGCNH  +++F+    M  ++ R  +IH+D+PG  DN E L +   FP++Q + +D+  + D L++++ +  GEGAGAN+LARF + +  +VLG++LI+ TG+ A + ++ +++ I+WK +    +  AES+L+ H+FG  I   N +KE  +++  +++ L  S+N +N+  ++ +FMNR ++   +   K   + +TG L+ +   V  L+  ++K         +++ ++++    +VL + P K+A+S+  F
Sbjct:   24 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQS--AESFLMYHKFGHQIVGENPDKE--KIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLT--LKGCKVDVILITGMLSPYASMVEKLHRDVEK---------ERVTILKIERAGDVLADAPGKVAQSILLF 295          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0078675)

HSP 1 Score: 187.963 bits (476), Expect = 6.749e-56
Identity = 90/287 (31.36%), Postives = 173/287 (60.28%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNE--VIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHI-NTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            ++T KCG L + +QG+ S  E   +  T+HDLGCNH  +++F+    M  ++ R  +IH+D+PG  DN E L +   FP++Q + +D+  + D L++++ +  GEGAGAN+LARF + +  +VLG++LI+ TG+ A + ++ +++ I+WK +    +  AES+L+ H+FG  I   N +KE  +++  +++ L  S+N +N+  ++ +FMNR ++   +   K   + +TG L+ +   V  L+  ++K         +++ ++++    +VL + P K+A+S+  F
Sbjct:   28 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQS--AESFLMYHKFGHQIVGENPDKE--KIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLT--LKGCKVDVILITGMLSPYASMVEKLHRDVEK---------ERVTILKIERAGDVLADAPGKVAQSILLF 299          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0300911)

HSP 1 Score: 186.422 bits (472), Expect = 2.042e-55
Identity = 89/289 (30.80%), Postives = 174/289 (60.21%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNE--VIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEH---INTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            ++T KCG L + +QG+ S  E   +  T+HDLGCNH  +++F+    M  ++ R  +IH+D+PG  DN E L +   FP++Q + +D+  + D L++++ +  GEGAGAN+LARF + +  +VLG++LI+ TG+ A + ++ +++ I+WK +    +  AES+L+ H+FG +   +  N +KE  +++  +++ L  S+N +N+  ++ +FMNR ++   +   K   + +TG L+ +   V  L+  ++K         +++ ++++    +VL + P K+A+S+  F
Sbjct:   24 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQS--AESFLMYHKFGHNWQIVGENPDKE--KIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLT--LKGCKVDVILITGMLSPYASMVEKLHRDVEK---------ERVTILKIERAGDVLADAPGKVAQSILLF 297          
BLAST of Protein NDRG4 vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0300907)

HSP 1 Score: 186.422 bits (472), Expect = 2.042e-55
Identity = 89/289 (30.80%), Postives = 174/289 (60.21%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNE--VIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEH---INTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            ++T KCG L + +QG+ S  E   +  T+HDLGCNH  +++F+    M  ++ R  +IH+D+PG  DN E L +   FP++Q + +D+  + D L++++ +  GEGAGAN+LARF + +  +VLG++LI+ TG+ A + ++ +++ I+WK +    +  AES+L+ H+FG +   +  N +KE  +++  +++ L  S+N +N+  ++ +FMNR ++   +   K   + +TG L+ +   V  L+  ++K         +++ ++++    +VL + P K+A+S+  F
Sbjct:   24 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEVAQS--AESFLMYHKFGHNWQIVGENPDKE--KIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLT--LKGCKVDVILITGMLSPYASMVEKLHRDVEK---------ERVTILKIERAGDVLADAPGKVAQSILLF 297          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 114.39 bits (285), Expect = 3.254e-28
Identity = 82/295 (27.80%), Postives = 137/295 (46.44%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA-ER---------IYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP+ GVL++ ++G    N  +I T HD+G NHK  +        M+ +      +H+D PGQ ++         +PTM E+A+ +  +   L I   +  G GAGA IL RFA+N    V G+VLI+      G  +    +L  W  N           L+      H +T+   E +E+I  ++ ++   IN  NL  F  S+ +R ++  ER         +  LKCPAL + G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   35 IETPR-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQESAPPFPTGFLYPTMDELAEMLPSVLTHLKINSVIGIGVGAGAYILTRFALNEPALVEGLVLINVDPCAKGWIDWAASKLSGWTSN-----------LIDIVMAHHFSTDELTENQEIIQTYRLHIAQDINQDNLALFCQSYNSRRDLEIERPVLGMNENAVKTLKCPALLIVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 309          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 114.39 bits (285), Expect = 3.254e-28
Identity = 82/295 (27.80%), Postives = 137/295 (46.44%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA-ER---------IYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP+ GVL++ ++G    N  +I T HD+G NHK  +        M+ +      +H+D PGQ ++         +PTM E+A+ +  +   L I   +  G GAGA IL RFA+N    V G+VLI+      G  +    +L  W  N           L+      H +T+   E +E+I  ++ ++   IN  NL  F  S+ +R ++  ER         +  LKCPAL + G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   35 IETPR-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQESAPPFPTGFLYPTMDELAEMLPSVLTHLKINSVIGIGVGAGAYILTRFALNEPALVEGLVLINVDPCAKGWIDWAASKLSGWTSN-----------LIDIVMAHHFSTDELTENQEIIQTYRLHIAQDINQDNLALFCQSYNSRRDLEIERPVLGMNENAVKTLKCPALLIVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 309          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg1b (N-myc downstream regulated 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1648])

HSP 1 Score: 112.464 bits (280), Expect = 1.243e-27
Identity = 77/289 (26.64%), Postives = 139/289 (48.10%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA-ERIYQ--------LKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G ++  ++G    N   I T HD+G NHK  +E    H  M  +       H+D PGQ +    L+    +P+M ++++ + ++ +   ++  +  G GAGANILARFA+ + D V G+VLI+ +    G  +    ++ +W              ++ H FG E I+ N      E+I  F++ +  +IN  NL +F+ S+ +R ++  ER  Q        L+CPAL + G+ +     V+   + +      +P     L++    G+  V  ++P K+ E+ +YF
Sbjct:   25 GRVHCTMKGVPKGNRPTILTFHDIGLNHKSCFESMFHHKDMHEILQHFAVCHVDAPGQQEGASTLSTDYTYPSMDQLSESLPMVLNHFGLKSVIGMGVGAGANILARFALKHPDMVEGLVLINMSTQAEGFMDWAAQKITSW-------THALPDTVISHLFGKEEIHNN-----HELIATFRQLITNNINQSNLQQFVKSYKSRKDLEIERPVQGGNVNTKTLQCPALLIVGDNSPAVDAVVDSNSRM------NPTTTTFLKMADCGGLPQV--DQPGKLIEAFKYF 293          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 112.464 bits (280), Expect = 1.382e-27
Identity = 78/286 (27.27%), Postives = 134/286 (46.85%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQ-LKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP+ GVL++ ++G    N  +I T HD+G NHK  +        M+ +      +H+D PGQ ++         +PTM E+A+ +  +   L I   +  G GAGA IL RFA+N    V G+VLI+      G  +    +L  W  N           L+      H +T+   E +E+I  ++ ++   IN  NL++  L    R+ +    +  L+CPAL + G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   35 IETPR-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQESAPPFPTGFLYPTMDELAEMLPSVLTHLKINSVIGIGVGAGAYILTRFALNEPALVEGLVLINVDPCAKGWIDWAASKLSGWTSN-----------LIDIVMAHHFSTDELTENQEIIQTYRLHIAQDINQDNLDQNTLIIGKRAELNWIFFSLLQCPALLIVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 300          
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Match: ndrg3a (ndrg family member 3a [Source:ZFIN;Acc:ZDB-GENE-980526-124])

HSP 1 Score: 108.612 bits (270), Expect = 3.912e-26
Identity = 80/295 (27.12%), Postives = 133/295 (45.08%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA-ER---------IYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G+   N  +I T HD+G NHK  +        M  +      +H+D PGQ +          +PTM E+A+ +  +  +L +   +  G GAGA IL RFA+ +   V G+VLI+      G  +    +L  W  N           LV      H +T    + +E+I  ++ ++   IN  NL  F  S+  R ++  ER         +  L CPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   21 IETPH-GVLHVTMRGSPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMMEITQHFAVVHVDAPGQQEGGPPFPTGYLYPTMDELAEMLPSVLTQLKVNSVIGIGVGAGAYILTRFALIHPSLVEGLVLINVDPCAEGWIDWAASKLTGWTSN-----------LVDIVMAHHFSTEELTDNQELIQTYRLHIAQDINQDNLALFCGSYNARQDLGIERPIAGLNENIVKTLTCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 295          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: kif1a (kinesin family member 1A [Source:Xenbase;Acc:XB-GENE-960470])

HSP 1 Score: 108.227 bits (269), Expect = 7.134e-26
Identity = 77/289 (26.64%), Postives = 135/289 (46.71%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSN--IAERIY-------QLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            GV+++ + GN   N  ++ T HD+G NHK  +  F     M  +       H+D PGQ +         ++PTM E+A+ +  +   LN++  +  G GAGA +L+RFA+NN   V G+VLI+      G  +    +L  W  N   +       ++   FG E + +N      +++  ++ ++   IN  NL  F+ S+ +R +  I   I+        +KCP L V G+ +     V+   + L      DP R   L++    G+   +  +P K+ E+++YF
Sbjct:   40 GVVHVTMSGNARGNRPVLLTFHDIGLNHKSCFNSFFNFDDMHEITQHFAVCHIDAPGQQEGAPSFPTGYQYPTMDELAEMLCAVLTHLNLRSIIGIGVGAGAYVLSRFALNNPLLVEGLVLINIDPCAKGWIDWAASKLSFWTSNIVEI-------VLGQLFGDEELQSN-----LDLVQTYRLHIAQDINQDNLQLFVTSYNSRKDLEIERPIFGSSTPTNTIKCPVLLVVGDSSPAVDAVVECNSRL------DPTRTTLLKMADCGGLPQAV--QPGKLTEAIKYF 308          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: kif1a (kinesin family member 1A [Source:Xenbase;Acc:XB-GENE-960470])

HSP 1 Score: 108.227 bits (269), Expect = 8.544e-26
Identity = 77/289 (26.64%), Postives = 135/289 (46.71%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSN--IAERIY-------QLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            GV+++ + GN   N  ++ T HD+G NHK  +  F     M  +       H+D PGQ +         ++PTM E+A+ +  +   LN++  +  G GAGA +L+RFA+NN   V G+VLI+      G  +    +L  W  N   +       ++   FG E + +N      +++  ++ ++   IN  NL  F+ S+ +R +  I   I+        +KCP L V G+ +     V+   + L      DP R   L++    G+   +  +P K+ E+++YF
Sbjct:   40 GVVHVTMSGNARGNRPVLLTFHDIGLNHKSCFNSFFNFDDMHEITQHFAVCHIDAPGQQEGAPSFPTGYQYPTMDELAEMLCAVLTHLNLRSIIGIGVGAGAYVLSRFALNNPLLVEGLVLINIDPCAKGWIDWAASKLSFWTSNIVEI-------VLGQLFGDEELQSN-----LDLVQTYRLHIAQDINQDNLQLFVTSYNSRKDLEIERPIFGSSTPTNTIKCPVLLVVGDSSPAVDAVVECNSRL------DPTRTTLLKMADCGGLPQAV--QPGKLTEAIKYF 308          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: slc15a5 (solute carrier family 15, member 5 [Source:Xenbase;Acc:XB-GENE-6049173])

HSP 1 Score: 102.064 bits (253), Expect = 1.485e-23
Identity = 74/287 (25.78%), Postives = 134/287 (46.69%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA-ERIY------QLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G++++ + G    N  +I T HD+G NHK  +        M  +       H+D PGQ +          +P+M ++A+ +  +  +L ++  +  G GAGA IL RFA+N+   V G+VLI+      G  +    ++  W      M       ++ H F  + +++N      E++  +++++   IN  NL  F+ S+ +R ++  ER +       LKCPAL V G+ +     V+   + L      DP +   L++    G   V+  +P K+AE+ +YF
Sbjct:   24 GIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQHFSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVIQQLGLKSVLGLGIGAGAYILTRFALNHPSMVEGLVLININPCAEGWMDWAATKISGWTHALPDM-------VISHLFSKDEVHSN-----HELVETYRQHIVQDINQNNLQLFVKSYNSRRDLEIERPFPGSNTVTLKCPALLVVGDSSPAVDAVVDCNSKL------DPTKTTLLKMSDCGGFPQVV--QPAKLAEAFKYF 290          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: slc15a5 (solute carrier family 15, member 5 [Source:Xenbase;Acc:XB-GENE-6049173])

HSP 1 Score: 102.064 bits (253), Expect = 1.546e-23
Identity = 74/287 (25.78%), Postives = 134/287 (46.69%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA-ERIY------QLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G++++ + G    N  +I T HD+G NHK  +        M  +       H+D PGQ +          +P+M ++A+ +  +  +L ++  +  G GAGA IL RFA+N+   V G+VLI+      G  +    ++  W      M       ++ H F  + +++N      E++  +++++   IN  NL  F+ S+ +R ++  ER +       LKCPAL V G+ +     V+   + L      DP +   L++    G   V+  +P K+AE+ +YF
Sbjct:   46 GIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQHFSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVIQQLGLKSVLGLGIGAGAYILTRFALNHPSMVEGLVLININPCAEGWMDWAATKISGWTHALPDM-------VISHLFSKDEVHSN-----HELVETYRQHIVQDINQNNLQLFVKSYNSRRDLEIERPFPGSNTVTLKCPALLVVGDSSPAVDAVVDCNSKL------DPTKTTLLKMSDCGGFPQVV--QPAKLAEAFKYF 312          
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Match: slc15a5 (solute carrier family 15, member 5 [Source:Xenbase;Acc:XB-GENE-6049173])

HSP 1 Score: 102.064 bits (253), Expect = 1.577e-23
Identity = 74/287 (25.78%), Postives = 134/287 (46.69%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA-ERIY------QLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G++++ + G    N  +I T HD+G NHK  +        M  +       H+D PGQ +          +P+M ++A+ +  +  +L ++  +  G GAGA IL RFA+N+   V G+VLI+      G  +    ++  W      M       ++ H F  + +++N      E++  +++++   IN  NL  F+ S+ +R ++  ER +       LKCPAL V G+ +     V+   + L      DP +   L++    G   V+  +P K+AE+ +YF
Sbjct:   30 GIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQHFSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVIQQLGLKSVLGLGIGAGAYILTRFALNHPSMVEGLVLININPCAEGWMDWAATKISGWTHALPDM-------VISHLFSKDEVHSN-----HELVETYRQHIVQDINQNNLQLFVKSYNSRRDLEIERPFPGSNTVTLKCPALLVVGDSSPAVDAVVDCNSKL------DPTKTTLLKMSDCGGFPQVV--QPAKLAEAFKYF 296          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg1 (N-myc downstream regulated gene 1 [Source:MGI Symbol;Acc:MGI:1341799])

HSP 1 Score: 114.005 bits (284), Expect = 6.135e-28
Identity = 76/287 (26.48%), Postives = 135/287 (47.04%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G L++ + G    N  +I T HD+G NHK  Y        M+ +       H+D PGQ D      +   +P+M ++A+ +  +  +  ++  +  G GAGA IL RFA+NN + V G+VL++      G  +    ++  W      M       +V H FG E I+ N      E+++ +++++   +NP NL+ FI ++ +R ++             L+CPAL V G+ +     V+   + L      DP +   L++    G+  +   +P K+AE+ +YF
Sbjct:   42 GSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGWTQALPDM-------VVSHLFGKEEIHNNV-----EVVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKL------DPTKTTLLKMADCGGLPQI--SQPAKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg2 (N-myc downstream regulated gene 2 [Source:MGI Symbol;Acc:MGI:1352498])

HSP 1 Score: 107.071 bits (266), Expect = 1.670e-25
Identity = 82/293 (27.99%), Postives = 137/293 (46.76%), Query Frame = 2
Query:   47 EVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-AERIYQ--LKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            +   V TP  G +   + G   P    IFT HD+G N+K  ++       M+ +    V +H+D PG  +      L  ++P++ ++AD I  I   LN    +  G GAGA IL+R+A+N+ D V G+VLI+      G  +    +L       TG+       ++ H F  E ++ NS     E+I  ++  +Q + N  N+  +  S+ NR ++  ER  +  LKCP + V G+ A H   V+   + L      DP +   L++    G   +   +P K+ E+ +YF
Sbjct:   39 QTHSVETPY-GSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKL-------TGLTSSIPDMILGHLFSQEELSGNS-----ELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKL------DPTQTSFLKMADSGGQPQL--TQPGKLTEAFKYF 310          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg2 (N-myc downstream regulated gene 2 [Source:MGI Symbol;Acc:MGI:1352498])

HSP 1 Score: 106.686 bits (265), Expect = 1.694e-25
Identity = 82/289 (28.37%), Postives = 136/289 (47.06%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-AERIYQ--LKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            V TP  G +   + G   P    IFT HD+G N+K  ++       M+ +    V +H+D PG  +      L  ++P++ ++AD I  I   LN    +  G GAGA IL+R+A+N+ D V G+VLI+      G  +    +L       TG+       ++ H F  E ++ NS     E+I  ++  +Q + N  N+  +  S+ NR ++  ER  +  LKCP + V G+ A H   V+   + L      DP +   L++    G   +   +P K+ E+ +YF
Sbjct:   29 VETPY-GSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKL-------TGLTSSIPDMILGHLFSQEELSGNS-----ELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKL------DPTQTSFLKMADSGGQPQL--TQPGKLTEAFKYF 296          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg3 (N-myc downstream regulated gene 3 [Source:MGI Symbol;Acc:MGI:1352499])

HSP 1 Score: 102.449 bits (254), Expect = 8.064e-24
Identity = 78/296 (26.35%), Postives = 137/296 (46.28%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA----------ERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  G++++ I+G    N  +I T HD+G NHK  +  F     M+ +       H+D PGQ +         ++PTM E+A+ +  +   L+++  +  G GAGA IL+RFA+N+ + V G+VLI+      G  +    +L  +  N   +       ++ H FG E +  N      ++I  ++ ++   IN  NL  F+ S+  R ++            R+  LKC  L V G+ +     V+   + L      DP     L++    G+  V+  +P K+ E+ +YF
Sbjct:   35 IETPH-GMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLSGFTTNIVDI-------ILAHHFGQEELQAN-----LDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRL------DPINTTLLKMADCGGLPQVV--QPGKLTEAFKYF 309          
BLAST of Protein NDRG4 vs. Ensembl Mouse
Match: Ndrg3 (N-myc downstream regulated gene 3 [Source:MGI Symbol;Acc:MGI:1352499])

HSP 1 Score: 102.064 bits (253), Expect = 8.765e-24
Identity = 78/296 (26.35%), Postives = 137/296 (46.28%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA----------ERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  G++++ I+G    N  +I T HD+G NHK  +  F     M+ +       H+D PGQ +         ++PTM E+A+ +  +   L+++  +  G GAGA IL+RFA+N+ + V G+VLI+      G  +    +L  +  N   +       ++ H FG E +  N      ++I  ++ ++   IN  NL  F+ S+  R ++            R+  LKC  L V G+ +     V+   + L      DP     L++    G+  V+  +P K+ E+ +YF
Sbjct:   35 IETPH-GMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLSGFTTNIVDI-------ILAHHFGQEELQAN-----LDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRL------DPINTTLLKMADCGGLPQVV--QPGKLTEAFKYF 309          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|O02485|YDJ1_CAEEL (Uncharacterized protein ZK1073.1 OS=Caenorhabditis elegans OX=6239 GN=ZK1073.1 PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.753e-68
Identity = 118/319 (36.99%), Postives = 195/319 (61.13%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGN--RSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQL--KCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXXXXXRVHSLCNPLSRRLSMEQLDLPR 1003
            V    CGVL++Y+QGN      + II T+HD+G NHK + +F+ H SM  ++ + +++H+ +PGQ DN  D    +FPT+  I DD+  + D+  ++ A+ FGEG GANI+ RFAM + ++++GIVL+HCT TTAGI E  +++++  +L  + M+  A  YL+ H+FG    + S +E+ E        L+A++NP+NL+K++++F  R++++  I        AL VTG+ ASH HTV T + ++ K         KK  L+ V+ VA+V++E P+K+A SL    +G G++ G+ +  +    +   SME+ D PR
Sbjct:   11 VQAQNCGVLHVYVQGNLEERGGKTIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADF-FGDFPTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFGG--ESKSRQEYLE-------ELKATLNPKNLSKYLVAFTKRTDLSSTIGTKLETVDALLVTGSKASHLHTVYTTHKSMNK---------KKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSSSMEEADRPR 310          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|Q6JE36|NDRG1_RAT (Protein NDRG1 OS=Rattus norvegicus OX=10116 GN=Ndrg1 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.180e-27
Identity = 76/287 (26.48%), Postives = 136/287 (47.39%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G L++ + G    N  +I T HD+G NHK  Y        M+ +       H+D PGQ D      +   +P+M ++A+ +  +  +  ++  +  G GAGA IL RFA+NN + V G+VL++      G  +    ++  W      M       +V H FG E I++N      E+++ +++++   +NP NL+ FI ++ +R ++             L+CPAL V G+ +     V+   + L      DP +   L++    G+  +   +P K+AE+ +YF
Sbjct:   42 GSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHKFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGWTQALPDM-------VVSHLFGKEEIHSNV-----EVVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKL------DPTKTTLLKMADCGGLPQI--SQPAKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|Q62433|NDRG1_MOUSE (Protein NDRG1 OS=Mus musculus OX=10090 GN=Ndrg1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 4.292e-27
Identity = 76/287 (26.48%), Postives = 135/287 (47.04%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G L++ + G    N  +I T HD+G NHK  Y        M+ +       H+D PGQ D      +   +P+M ++A+ +  +  +  ++  +  G GAGA IL RFA+NN + V G+VL++      G  +    ++  W      M       +V H FG E I+ N      E+++ +++++   +NP NL+ FI ++ +R ++             L+CPAL V G+ +     V+   + L      DP +   L++    G+  +   +P K+AE+ +YF
Sbjct:   42 GSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGWTQALPDM-------VVSHLFGKEEIHNNV-----EVVHTYRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKL------DPTKTTLLKMADCGGLPQI--SQPAKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|Q92597|NDRG1_HUMAN (Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 8.193e-27
Identity = 75/287 (26.13%), Postives = 135/287 (47.04%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G +++ + G    N  +I T HD+G NHK  Y     +  M+ +       H+D PGQ D          +P+M ++A+ +  +  +  ++  +  G GAGA IL RFA+NN + V G+VLI+      G  +    ++  W      M       +V H FG E + +N      E+++ +++++   +NP NL+ FI ++ +R ++             L+CPAL V G+ +     V+   + L      DP +   L++    G+  +   +P K+AE+ +YF
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDM-------VVSHLFGKEEMQSNV-----EVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKL------DPTKTTLLKMADCGGLPQI--SQPAKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Match: sp|Q4R4Q3|NDRG1_MACFA (Protein NDRG1 OS=Macaca fascicularis OX=9541 GN=Ndrg1 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 8.526e-27
Identity = 75/287 (26.13%), Postives = 136/287 (47.39%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKE-FPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI-------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            G +++ + G    N  +I T HD+G NHK  Y     +  M+ +       H+D PGQ D          +P+M ++A+ +  +  +  ++  +  G GAGA IL RFA+NN + V G+VLI+      G  +    ++  W      M       +V H FG E +++N      E+++ +++++   +NP NL+ FI ++ +R ++             L+CPAL V G+ +     V+   + L      DP +   L++    G+  +   +P K+AE+ +YF
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDM-------VVSHLFGKEEMHSNV-----EVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKL------DPTKTTLLKMADCGGLPQI--SQPAKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. TrEMBL
Match: C1L4M7 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 4.580e-116
Identity = 162/292 (55.48%), Postives = 215/292 (73.63%), Query Frame = 2
Query:   35 MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            M  I+ + V T  CG LN+++QG R+ N V   T+HDLGCNH E   FL H SM+ L NRC WIH+D+PGQGD + DL     FP++Q++A+ +  + + L +QH V+FGEGAGANIL R  M   D VLG VLIHCTGTTAG+ E++RDRLI WKLNT GMNP AESYL++HRFG   +   E E RE++  F+++L+ +INPRNLNK+I+SFM+R+ I E++ Q++CP LF+TG LASHNHTV+ LYN L   V++DP    K+EL+Q++ VANVL E+PEK+A+ LQYF
Sbjct:    1 MSAIQHEVVDTESCGKLNVFMQGPRNTN-VAFLTVHDLGCNHNEMVHFLAHESMEPLANRCTWIHVDVPGQGDGESDLPPDYTFPSVQQLAEGMSEVCNALRLQHIVVFGEGAGANILVRLVMLRYDLVLGAVLIHCTGTTAGLSESLRDRLIGWKLNTVGMNPAAESYLLMHRFGSAADAEDEVELREVLVKFRQSLRTAINPRNLNKYIMSFMSRTKILEQVDQMRCPVLFLTGTLASHNHTVLRLYNALLSAVRNDPILQGKVELVQIDNVANVLSEQPEKVADCLQYF 291          
BLAST of Protein NDRG4 vs. TrEMBL
Match: C7TZF8 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_003869 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.591e-116
Identity = 177/329 (53.80%), Postives = 234/329 (71.12%), Query Frame = 2
Query:   35 MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXX--XXXRVHSLCNPLS--RRLSMEQLDLPRG 1006
            M  I+ + V T  CG LN+++QG R+ N V   T+HDLGCNH E   FL H SM+ L NRC WIH+D+PGQGD + DL     FP++Q++A+ +  + + L +QH V+FGEGAGANIL R  M   D VLG VLIHCTGTTAG+ E++RDRLI WKLNT GMNP AESYL++HRFG   +   E E RE++  F+++L+ +INPRNLNK+I+SFM+R+ I E + Q++CP L +TG LASHNHTV+ LYN L   V++DP    K+EL+Q++ VANVL E+PEK+A+ LQYF+QGLGL      R  S   P++  R LSME+ D P+G
Sbjct:    1 MSAIQHEVVDTESCGKLNVFMQGPRNTN-VAFLTVHDLGCNHNEMVHFLAHESMEPLANRCTWIHVDVPGQGDGESDLPPDYTFPSVQQLAEGMSEVCNALRLQHIVVFGEGAGANILVRLVMLRYDLVLGAVLIHCTGTTAGLSESLRDRLIGWKLNTVGMNPAAESYLLMHRFGSAADAEDEVELREVLVKFRQSLRTAINPRNLNKYIMSFMSRTKILEHVDQIRCPVLLLTGTLASHNHTVLRLYNALLSAVRNDPILQGKVELVQIDNVANVLSEQPEKVADCLQYFIQGLGLAGGLVNRRMSSTIPVARNRSLSMEEYDQPKG 328          
BLAST of Protein NDRG4 vs. TrEMBL
Match: A0A3Q0KUE1 (Family S33 non-peptidase homologue (S33 family) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 7.417e-116
Identity = 177/329 (53.80%), Postives = 235/329 (71.43%), Query Frame = 2
Query:   35 MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXX--XXXRVHSLCNPLS--RRLSMEQLDLPRG 1006
            M  +E + V T  CG +N++IQG R+  +V   T+HDLGCNH E   FL H SM+ L NRC W+H+D+PGQGD + DL     FP++Q++A+ +  + + L +Q+ V+FGEGAGANIL R  M   D VLG VLIHCTGTTAG+ E +RDRLI WKLNT GMNP AESYL++HRFG   ++  E E RE++  F+++L+ +INPRNLNKFI+SFM+R+ I E + Q++CP LF+TG LASHNHTV  LYN +   V++DP    K+ELIQ++ VANVL E+PEK+AESLQ+F+QGLGL      R  S   P++  R LSME+ D P+G
Sbjct:    1 MSGVEHQVVNTESCGKINVFIQGPRN-TKVAFLTVHDLGCNHNEIVNFLAHESMEPLVNRCTWVHVDVPGQGDGESDLPADYTFPSVQQLAEGMSEVCNALRLQYVVVFGEGAGANILVRLVMLRYDIVLGAVLIHCTGTTAGLSENLRDRLIGWKLNTVGMNPAAESYLLMHRFGSAADSEDEVEVREVLIKFRQSLRTAINPRNLNKFIMSFMSRTKILEHVDQIRCPVLFLTGALASHNHTVFRLYNAVLSAVRNDPNLQGKVELIQLDNVANVLSEQPEKVAESLQFFIQGLGLAGGLVSRRMSSTIPVARNRSLSMEEYDQPKG 328          
BLAST of Protein NDRG4 vs. TrEMBL
Match: Q5DF09 (SJCHGC02626 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 9.421e-116
Identity = 176/328 (53.66%), Postives = 233/328 (71.04%), Query Frame = 2
Query:   35 MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXX--XXXRVHSLCNPLS--RRLSMEQLDLPR 1003
            M  I+ + V T  CG LN+++QG R+ N V   T+HDLGCNH E   FL H SM+ L NRC WIH+D+PGQGD + DL     FP++Q++A+ +  + + L +QH V+FGEGAGANIL R  M   D VLG VLIHCTGTTAG+ E++RDRLI WKLNT GMNP AESYL++HRFG   +   E E RE++  F+++L+ +INPRNLNK+I+SFM+R+ I E + Q++CP L +TG LASHNHTV+ LYN L   V++DP    K+EL+Q++ VANVL E+PEK+A+ LQYF+QGLGL      R  S   P++  R LSME+ D P+
Sbjct:    1 MSAIQHEVVDTESCGKLNVFMQGPRNTN-VAFLTVHDLGCNHNEMVHFLAHESMEPLANRCTWIHVDVPGQGDGESDLPPDYTFPSVQQLAEGMSEVCNALRLQHIVVFGEGAGANILVRLVMLRYDLVLGAVLIHCTGTTAGLSESLRDRLIGWKLNTVGMNPAAESYLLMHRFGSAADAEDEVELREVLVKFRQSLRTAINPRNLNKYIMSFMSRTKILEHVDQIRCPVLLLTGTLASHNHTVLRLYNALLSAVRNDPILQGKVELVQIDNVANVLSEQPEKVADCLQYFIQGLGLAGGLVNRRMSSTIPVARNRSLSMEEYDQPK 327          
BLAST of Protein NDRG4 vs. TrEMBL
Match: A0A4Z2D724 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_003869 PE=4 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 8.239e-115
Identity = 161/292 (55.14%), Postives = 213/292 (72.95%), Query Frame = 2
Query:   35 MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            M  I+ + V T  CG LN+++QG R+ N V   T+HDLGCNH E   FL H SM+ L NRC WIH+D+PGQGD + DL     FP++Q++A+ +  + + L +QH V+FGEGAGANIL R  M   D VLG VLIHCTGTTAG+ E++RDRLI WKLNT GMNP AESYL++HRFG   +   E E RE++  F+++L+ +INPRNLNK+I+SFM+R+ I E + Q++CP L +TG LASHNHTV+ LYN L   V++DP    K+EL+Q++ VANVL E+PEK+A+ LQYF
Sbjct:    1 MSAIQHEVVDTESCGKLNVFMQGPRNTN-VAFLTVHDLGCNHNEMVHFLAHESMEPLANRCTWIHVDVPGQGDGESDLPPDYTFPSVQQLAEGMSEVCNALRLQHIVVFGEGAGANILVRLVMLRYDLVLGAVLIHCTGTTAGLSESLRDRLIGWKLNTVGMNPAAESYLLMHRFGSAADAEDEVELREVLVKFRQSLRTAINPRNLNKYIMSFMSRTKILEHVDQIRCPVLLLTGTLASHNHTVLRLYNALLSAVRNDPILQGKVELVQIDNVANVLSEQPEKVADCLQYF 291          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 120.168 bits (300), Expect = 1.764e-30
Identity = 84/295 (28.47%), Postives = 137/295 (46.44%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI----------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G    N  +I T HD+G NHK  +        M+ +      +H+D PGQ +N     +  ++PTM E+A+ +  +  +L I   +  G GAGA IL R A+N    V G+VLI+      G  +    +L  W  N           LV    G H +T+   E +E+I  ++ ++   IN  NL  F  S+  R ++           E +  LKCPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   21 IETPH-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQENAPPFPSGYQYPTMDELAEMLPSVLTQLKINSVIGIGVGAGAYILTRLALNQSTLVEGLVLINVDPCAKGWMDWAASKLSGWTSN-----------LVDIVMGHHFSTDELTENQEIIQTYRLHIAQDINQDNLALFCNSYNGRRDLEIERPILGINEETVNTLKCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 295          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 120.168 bits (300), Expect = 4.752e-30
Identity = 84/295 (28.47%), Postives = 137/295 (46.44%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI----------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G    N  +I T HD+G NHK  +        M+ +      +H+D PGQ +N     +  ++PTM E+A+ +  +  +L I   +  G GAGA IL R A+N    V G+VLI+      G  +    +L  W  N           LV    G H +T+   E +E+I  ++ ++   IN  NL  F  S+  R ++           E +  LKCPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   71 IETPH-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQENAPPFPSGYQYPTMDELAEMLPSVLTQLKINSVIGIGVGAGAYILTRLALNQSTLVEGLVLINVDPCAKGWMDWAASKLSGWTSN-----------LVDIVMGHHFSTDELTENQEIIQTYRLHIAQDINQDNLALFCNSYNGRRDLEIERPILGINEETVNTLKCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 345          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 120.168 bits (300), Expect = 5.538e-30
Identity = 84/295 (28.47%), Postives = 137/295 (46.44%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI----------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G    N  +I T HD+G NHK  +        M+ +      +H+D PGQ +N     +  ++PTM E+A+ +  +  +L I   +  G GAGA IL R A+N    V G+VLI+      G  +    +L  W  N           LV    G H +T+   E +E+I  ++ ++   IN  NL  F  S+  R ++           E +  LKCPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   82 IETPH-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQENAPPFPSGYQYPTMDELAEMLPSVLTQLKINSVIGIGVGAGAYILTRLALNQSTLVEGLVLINVDPCAKGWMDWAASKLSGWTSN-----------LVDIVMGHHFSTDELTENQEIIQTYRLHIAQDINQDNLALFCNSYNGRRDLEIERPILGINEETVNTLKCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 356          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 120.168 bits (300), Expect = 6.460e-30
Identity = 84/295 (28.47%), Postives = 137/295 (46.44%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI----------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G    N  +I T HD+G NHK  +        M+ +      +H+D PGQ +N     +  ++PTM E+A+ +  +  +L I   +  G GAGA IL R A+N    V G+VLI+      G  +    +L  W  N           LV    G H +T+   E +E+I  ++ ++   IN  NL  F  S+  R ++           E +  LKCPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:  106 IETPH-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQENAPPFPSGYQYPTMDELAEMLPSVLTQLKINSVIGIGVGAGAYILTRLALNQSTLVEGLVLINVDPCAKGWMDWAASKLSGWTSN-----------LVDIVMGHHFSTDELTENQEIIQTYRLHIAQDINQDNLALFCNSYNGRRDLEIERPILGINEETVNTLKCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 380          
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 120.168 bits (300), Expect = 6.465e-30
Identity = 84/295 (28.47%), Postives = 137/295 (46.44%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI----------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G    N  +I T HD+G NHK  +        M+ +      +H+D PGQ +N     +  ++PTM E+A+ +  +  +L I   +  G GAGA IL R A+N    V G+VLI+      G  +    +L  W  N           LV    G H +T+   E +E+I  ++ ++   IN  NL  F  S+  R ++           E +  LKCPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:  106 IETPH-GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQENAPPFPSGYQYPTMDELAEMLPSVLTQLKINSVIGIGVGAGAYILTRLALNQSTLVEGLVLINVDPCAKGWMDWAASKLSGWTSN-----------LVDIVMGHHFSTDELTENQEIIQTYRLHIAQDINQDNLALFCNSYNGRRDLEIERPILGINEETVNTLKCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 380          
BLAST of Protein NDRG4 vs. Ensembl Nematostella
Match: EDO32493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY2])

HSP 1 Score: 146.747 bits (369), Expect = 5.610e-41
Identity = 106/333 (31.83%), Postives = 165/333 (49.55%), Query Frame = 2
Query:   35 MVEIEVKQVTTPKCGVLNIYIQGNRSPNEV----------IIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNN--DDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI--------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXXXXXRVHSLCNPLS 967
            M E   KQ    K G L +YI+G  + ++           ++ T HDLG NHK  +E+FL H  +K +++R V  HLD PGQ    E+L N  ++PT+ E+AD +  + D   +   V FG G+GANIL   A+ +   +++LG++L+   G T+  KE    ++  W+LN  G      +YL  H    H    + K   E++  F   ++ +INP NL  F+ S+M+R NI         ++        + VTG  + H       +  L       P   KK  +++ +   +VL+EKP+ +AE L  F+QGLGLV  LR  S+    S
Sbjct:    1 MSEETPKQERVEKVGDLTVYIEGEEAKDKTDEKENVKKKDVMITFHDLGMNHKTCFEKFLMHEDIKSIKDRFVIYHLDAPGQETGAENLSNDYQYPTINELADMVGKVLDHFALDDVVCFGVGSGANILCHLALASKWKERILGLILVEPCGATSSFKEWGEAKVKKWQLNAKGFTEGTANYLKWH----HFERKTGKPNIELMENFCDEMKKNINPHNLAAFLNSYMHRPNILNEAKQSVKDKSVSTTAYIMVVTGEHSPHKEQSEQFFRVLS------PVDRKKYSILKPDCGTSVLEEKPDTMAEGLLLFIQGLGLVPTLRTRSMSRTSS 323          
BLAST of Protein NDRG4 vs. Ensembl Nematostella
Match: EDO40164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S803])

HSP 1 Score: 116.316 bits (290), Expect = 1.024e-29
Identity = 80/271 (29.52%), Postives = 138/271 (50.92%), Query Frame = 2
Query:  128 IFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIAD-DIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNI--------AERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            I T HD+G NH   +  F     ++ L       H+D PGQ + ++ L     +PTM+E+AD  +  +  +L+I   +  G GAGAN+L R+ +   D V  +VL++ +   +G  E    ++   +L+  G+    E YL+ H FGE     +++E  ++ + +K +L++ +NP NL  FI S++ R+NI              LKCP L VTG  + H   V+   + L      DP+  + +++    G+   L+E+P K+A++L  F
Sbjct:   10 IVTFHDIGQNHTSAFLGFFNFVDVQPLLEHFCIYHIDAPGQENCEKQLPETFVYPTMEELADFVVHEVVKQLSISRFIGLGVGAGANVLCRYGLMYPDFVDALVLVNLSVGKSGWIEWGYQKVCVRQLHNKGLTTFVEDYLLWHHFGE----KTKEENLDLSSAYKDSLRSLLNPHNLALFINSYITRTNIDIVRPVEGGPNPRSLKCPTLLVTGTFSPHGDDVVESNSRL------DPKISEYMKVSDCGGMP--LEEQPAKVAQALILF 268          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ENSORLT00000006023.2 (protein NDRG1 [Source:NCBI gene;Acc:101156766])

HSP 1 Score: 115.931 bits (289), Expect = 7.372e-29
Identity = 78/295 (26.44%), Postives = 142/295 (48.14%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFG-EHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAER---------IYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            V TP  G L+  + G    N  +I T HD+G NHK  +E    H  M+ +       H++ PGQ +  + L  L  +PT+ ++++ +  +     ++  +  G GAGA ILARFA+N+ D V G+VLI+      G+ +++ +++  W              L+ H FG E I  N      +++  ++  + A++N  N+++F  S+ NR+ +  +         +  LKC  L V G+ +     V+   + L      +P +   L++    G+  V  ++P K+ E+L+YF
Sbjct:   21 VETPY-GDLHCIMTGTPKANRPVILTFHDVGLNHKSCFETLFNHEDMQEIVKHLPVCHVEAPGQQEAAKSLPTLYTYPTVDQLSEALPAVLKNFGLRSVIGLGVGAGAYILARFALNHPDLVDGLVLINVNPNAEGLMDSVANKITDW-------TQTLPDKLIAHLFGQEEIQKN-----YDLVATYRHYITATMNQSNVSQFFRSYNNRTTLDVQRPVSGGNINVRTLKCSTLLVVGDNSPAVEAVVDCNSKL------NPNKTTLLKMADCGGLPQV--DQPAKVTEALKYF 294          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ndrg3a (NDRG family member 3 [Source:NCBI gene;Acc:101162117])

HSP 1 Score: 112.849 bits (281), Expect = 8.838e-28
Identity = 80/295 (27.12%), Postives = 133/295 (45.08%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA----------ERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G    N  +I T HD+G NHK  +     +  M+ +      +H+D PGQ +          +PTM E+++ +  +   L I   +  G GAG+ IL RFA+NN   V G+VLI       G  +    +L  W  N           LV      H +T+   E +E+I  ++ ++   IN  NL  F  S+  R ++           + +  L CPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   21 IETPH-GVLHVTMRGVPKGNRPVILTYHDIGLNHKSCFNTLFNYEDMQEITQHFAVVHVDAPGQQEGAPPFPTGYRYPTMDELSEMLPSVMTRLKINSVIGIGVGAGSYILTRFALNNPALVEGLVLIDVDPCAEGWIDWAASKLSGWTSN-----------LVDIVMAHHFSTDELTENQELIQTYRLHIAQDINQDNLALFCGSYQYRQDLGIERPVVGLNEDTVNTLTCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 295          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ndrg3a (NDRG family member 3 [Source:NCBI gene;Acc:101162117])

HSP 1 Score: 113.235 bits (282), Expect = 9.043e-28
Identity = 80/295 (27.12%), Postives = 133/295 (45.08%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA----------ERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G    N  +I T HD+G NHK  +     +  M+ +      +H+D PGQ +          +PTM E+++ +  +   L I   +  G GAG+ IL RFA+NN   V G+VLI       G  +    +L  W  N           LV      H +T+   E +E+I  ++ ++   IN  NL  F  S+  R ++           + +  L CPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   34 IETPH-GVLHVTMRGVPKGNRPVILTYHDIGLNHKSCFNTLFNYEDMQEITQHFAVVHVDAPGQQEGAPPFPTGYRYPTMDELSEMLPSVMTRLKINSVIGIGVGAGSYILTRFALNNPALVEGLVLIDVDPCAEGWIDWAASKLSGWTSN-----------LVDIVMAHHFSTDELTENQELIQTYRLHIAQDINQDNLALFCGSYQYRQDLGIERPVVGLNEDTVNTLTCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: ndrg3a (NDRG family member 3 [Source:NCBI gene;Acc:101162117])

HSP 1 Score: 112.849 bits (281), Expect = 1.200e-27
Identity = 80/295 (27.12%), Postives = 133/295 (45.08%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA----------ERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            + TP  GVL++ ++G    N  +I T HD+G NHK  +     +  M+ +      +H+D PGQ +          +PTM E+++ +  +   L I   +  G GAG+ IL RFA+NN   V G+VLI       G  +    +L  W  N           LV      H +T+   E +E+I  ++ ++   IN  NL  F  S+  R ++           + +  L CPAL V G+ +     V+   + L      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   34 IETPH-GVLHVTMRGVPKGNRPVILTYHDIGLNHKSCFNTLFNYEDMQEITQHFAVVHVDAPGQQEGAPPFPTGYRYPTMDELSEMLPSVMTRLKINSVIGIGVGAGSYILTRFALNNPALVEGLVLIDVDPCAEGWIDWAASKLSGWTSN-----------LVDIVMAHHFSTDELTENQELIQTYRLHIAQDINQDNLALFCGSYQYRQDLGIERPVVGLNEDTVNTLTCPALLVVGDTSPAVEAVVECNSRL------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 308          
BLAST of Protein NDRG4 vs. Ensembl Medaka
Match: NDRG3 (protein NDRG3 [Source:NCBI gene;Acc:101163152])

HSP 1 Score: 110.153 bits (274), Expect = 7.853e-27
Identity = 78/289 (26.99%), Postives = 134/289 (46.37%), Query Frame = 2
Query:   77 GVLNIYIQGNRSPNEVIIFTIHDLGCNHKE-YEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIA-ER---------IYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYF 907
            GVL++ ++G    N   I T HD+G NHK  +     +  M  +      +H+D PGQ +N        ++PTM E+A+ +  +  +L I+  +  G GAGA IL R A+N    V G+VLI+      G  +    +L  W  N           LV    G H +++   E +E+I  ++ ++   +   NL  F  S+ +R+ +  ER         +  L+CPAL V G+ +     V+   + +      +P +   L++    G+  V+  +P K+AE+ +YF
Sbjct:   27 GVLHVTMRGVAKGNRPTILTYHDIGLNHKSCFNSLFNYEDMLEVTQHFSVLHVDAPGQQENAPVFPTGYQYPTMDELAEMLPSVLTQLQIKSVIGIGVGAGAYILTRLALNEPGLVEGLVLINVDPCAKGWVDWAASKLSGWTSN-----------LVDIIMGHHFSSDELTENKEIIQTYRLHISQDVPQENLAMFYNSYDSRTELQMERPVAGLNENTVTTLRCPALLVVGDTSPAVDAVVECNSRM------NPTKTTLLKMADCGGLPQVV--QPGKLAEAFKYF 296          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000065324.1 (SMESG000065324.1)

HSP 1 Score: 335.88 bits (860), Expect = 6.307e-114
Identity = 173/319 (54.23%), Postives = 226/319 (70.85%), Query Frame = 2
Query:   68 PKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXXXXXRVHSLCNPLSRRLSMEQLDLPRGPDSLSS 1024
            PK G +N+YIQG R P E II T+HDLGCNH +YE+FL +  M  L  + VWIH+D+PGQGD DEDL    FP+M++IA D++ +  ++ + + +LFGEGAGANILARFA+N++  VLG +LIHC G+TA + E+++D++I WKLN+ GMNP AESYLV+HRFG   N  +E E + +I  FK NL+ SINP+NL KFI SFM R N+ ERI +L  P LF+TG  A H   V  L  TL K  K   +++ K EL+Q++GVANVL E PEK+  SLQYFLQGLGLV  LR+ +    ++RR+SME  D PRG  S SS
Sbjct:   15 PKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLE-TNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLK-TKPADQKV-KFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSS 330          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000065324.1 (SMESG000065324.1)

HSP 1 Score: 331.257 bits (848), Expect = 5.187e-112
Identity = 173/323 (53.56%), Postives = 226/323 (69.97%), Query Frame = 2
Query:   68 PKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHI----NTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXXXXXXXXRVHSLCNPLSRRLSMEQLDLPRGPDSLSS 1024
            PK G +N+YIQG R P E II T+HDLGCNH +YE+FL +  M  L  + VWIH+D+PGQGD DEDL    FP+M++IA D++ +  ++ + + +LFGEGAGANILARFA+N++  VLG +LIHC G+TA + E+++D++I WKLN+ GMNP AESYLV+HRFG       N  +E E + +I  FK NL+ SINP+NL KFI SFM R N+ ERI +L  P LF+TG  A H   V  L  TL K  K   +++ K EL+Q++GVANVL E PEK+  SLQYFLQGLGLV  LR+ +    ++RR+SME  D PRG  S SS
Sbjct:   15 PKMGAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLE-TNFPSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNLGERIAKLNTPTLFITGAAAIHCKNVHLLQETLLK-TKPADQKV-KFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNLRLSNEPIKINRRMSMEDYDRPRGTGSFSS 334          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000021236.1 (SMESG000021236.1)

HSP 1 Score: 306.605 bits (784), Expect = 1.627e-102
Identity = 146/326 (44.79%), Postives = 226/326 (69.33%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXX---XXXXXXXXRVHSLCNPLS-RRLSMEQLDLPRGPDSLS 1021
            + T  CG L  YI+G RS NEV I T+HD+GCNH +Y  FL+H+SM+ L  RCVW ++ +PGQ  ND DL +   +PTMQ+IADD+      L+I H ++FGEGAGANILAR AM+ D+++LG VL++C G+T  + E+++D++I WKL+T GM    E+YLVVHRFG   N  S+++   MIN +K+ L+ + N +NL+ ++ S+MNRSN+ ++   ++CP LF++G+LA++   V  LY  +Q F+K++P+R + +E ++++  ANVL E+ +++AESLQYFLQ    +G     R+ S   P+  R++SME+ D P+G  +++
Sbjct:    4 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTIRCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDSPKGASNIT 329          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000021236.1 (SMESG000021236.1)

HSP 1 Score: 290.426 bits (742), Expect = 1.457e-95
Identity = 150/364 (41.21%), Postives = 228/364 (62.64%), Query Frame = 2
Query:   59 VTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDL-NLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDRLITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQASINPRNLNKFILSFMNRSNIAER---IYQ-----------------------------------LKCPALFVTGNLASHNHTVMTLYNTLQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFXXXX---XXXXXXRVHSLCNPLS-RRLSMEQLDLPRGPDSLS 1021
            + T  CG L  YI+G RS NEV I T+HD+GCNH +Y  FL+H+SM+ L  RCVW ++ +PGQ  ND DL +   +PTMQ+IADD+      L+I H ++FGEGAGANILAR AM+ D+++LG VL++C G+T  + E+++D++I WKL+T GM    E+YLVVHRFG   N  S+++   MIN +K+ L+ + N +NL+ ++ S+MNRSN+ ++   I Q                                   +KCP LF++G+LA++   V  LY  +Q F+K++P+R + +E ++++  ANVL E+ +++AESLQYFLQG    G     R+ S   P+  R++SME+ D P+G  +++
Sbjct:    4 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPAIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDSPKGASNIT 367          
BLAST of Protein NDRG4 vs. Planmine SMEST
Match: SMESG000055204.1 (SMESG000055204.1)

HSP 1 Score: 255.758 bits (652), Expect = 1.342e-85
Identity = 120/123 (97.56%), Postives = 123/123 (100.00%), Query Frame = 2
Query:   35 MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAMN 403
            MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKH+RNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFA++
Sbjct:    1 MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHIRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAVS 123          
The following BLAST results are available for this feature:
BLAST of Protein NDRG4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NDRG11.706e-2726.13N-myc downstream regulated 1 [Source:HGNC Symbol;A... [more]
NDRG11.706e-2726.13N-myc downstream regulated 1 [Source:HGNC Symbol;A... [more]
NDRG27.022e-2427.34NDRG family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
NDRG21.632e-2326.96NDRG family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
NDRG21.632e-2326.96NDRG family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZK1073.12.165e-6936.99pep chromosome:WBcel235:X:16124151:16128865:-1 gen... [more]
ZK1073.12.165e-6936.99pep chromosome:WBcel235:X:16123942:16128815:-1 gen... [more]
Y48G10A.39.932e-2826.67pep chromosome:WBcel235:I:13471683:13474185:-1 gen... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG20824.335e-5631.36gene:FBgn0027608 transcript:FBtr0078672[more]
CG20824.335e-5631.36gene:FBgn0027608 transcript:FBtr0300909[more]
CG20826.749e-5631.36gene:FBgn0027608 transcript:FBtr0078675[more]
CG20822.042e-5530.80gene:FBgn0027608 transcript:FBtr0300911[more]
CG20822.042e-5530.80gene:FBgn0027608 transcript:FBtr0300907[more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndrg3b3.254e-2827.80ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3b3.254e-2827.80ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg1b1.243e-2726.64N-myc downstream regulated 1b [Source:ZFIN;Acc:ZDB... [more]
ndrg3b1.382e-2727.27ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3a3.912e-2627.12ndrg family member 3a [Source:ZFIN;Acc:ZDB-GENE-98... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1a7.134e-2626.64kinesin family member 1A [Source:Xenbase;Acc:XB-GE... [more]
kif1a8.544e-2626.64kinesin family member 1A [Source:Xenbase;Acc:XB-GE... [more]
slc15a51.485e-2325.78solute carrier family 15, member 5 [Source:Xenbase... [more]
slc15a51.546e-2325.78solute carrier family 15, member 5 [Source:Xenbase... [more]
slc15a51.577e-2325.78solute carrier family 15, member 5 [Source:Xenbase... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ndrg16.135e-2826.48N-myc downstream regulated gene 1 [Source:MGI Symb... [more]
Ndrg21.670e-2527.99N-myc downstream regulated gene 2 [Source:MGI Symb... [more]
Ndrg21.694e-2528.37N-myc downstream regulated gene 2 [Source:MGI Symb... [more]
Ndrg38.064e-2426.35N-myc downstream regulated gene 3 [Source:MGI Symb... [more]
Ndrg38.765e-2426.35N-myc downstream regulated gene 3 [Source:MGI Symb... [more]
back to top
BLAST of Protein NDRG4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O02485|YDJ1_CAEEL2.753e-6836.99Uncharacterized protein ZK1073.1 OS=Caenorhabditis... [more]
sp|Q6JE36|NDRG1_RAT2.180e-2726.48Protein NDRG1 OS=Rattus norvegicus OX=10116 GN=Ndr... [more]
sp|Q62433|NDRG1_MOUSE4.292e-2726.48Protein NDRG1 OS=Mus musculus OX=10090 GN=Ndrg1 PE... [more]
sp|Q92597|NDRG1_HUMAN8.193e-2726.13Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=... [more]
sp|Q4R4Q3|NDRG1_MACFA8.526e-2726.13Protein NDRG1 OS=Macaca fascicularis OX=9541 GN=Nd... [more]
back to top
BLAST of Protein NDRG4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1L4M74.580e-11655.48Uncharacterized protein OS=Schistosoma japonicum O... [more]
C7TZF84.591e-11653.80Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A3Q0KUE17.417e-11653.80Family S33 non-peptidase homologue (S33 family) OS... [more]
Q5DF099.421e-11653.66SJCHGC02626 protein OS=Schistosoma japonicum OX=61... [more]
A0A4Z2D7248.239e-11555.14Uncharacterized protein OS=Schistosoma japonicum O... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndrg3b1.764e-3028.47ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3b4.752e-3028.47ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3b5.538e-3028.47ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3b6.460e-3028.47ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3b6.465e-3028.47ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein NDRG4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein NDRG4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO324935.610e-4131.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401641.024e-2929.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein NDRG4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006023.27.372e-2926.44protein NDRG1 [Source:NCBI gene;Acc:101156766][more]
ndrg3a8.838e-2827.12NDRG family member 3 [Source:NCBI gene;Acc:1011621... [more]
ndrg3a9.043e-2827.12NDRG family member 3 [Source:NCBI gene;Acc:1011621... [more]
ndrg3a1.200e-2727.12NDRG family member 3 [Source:NCBI gene;Acc:1011621... [more]
NDRG37.853e-2726.99protein NDRG3 [Source:NCBI gene;Acc:101163152][more]
back to top
BLAST of Protein NDRG4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065324.16.307e-11454.23SMESG000065324.1[more]
SMESG000065324.15.187e-11253.56SMESG000065324.1[more]
SMESG000021236.11.627e-10244.79SMESG000021236.1[more]
SMESG000021236.11.457e-9541.21SMESG000021236.1[more]
SMESG000055204.11.342e-8597.56SMESG000055204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013306 ID=SMED30013306|Name=Protein NDRG4|organism=Schmidtea mediterranea sexual|type=transcript|length=1127bp
CTAATACGAATTTAAGATTCTATTTCGTTGAAATATGGTTGAAATTGAAG
TTAAGCAAGTTACTACTCCTAAATGTGGAGTTCTTAATATTTATATTCAA
GGAAACAGGTCGCCAAATGAAGTTATTATATTTACCATTCATGATCTTGG
TTGTAATCATAAAGAATATGAACAATTTCTTGAACACACTTCAATGAAGC
ACCTTAGAAATCGATGCGTTTGGATTCATTTGGATATTCCTGGGCAAGGG
GATAACGATGAAGATTTGAACTTAAAAGAATTTCCAACGATGCAAGAAAT
TGCTGATGATATAAAAGTAATTTTTGACGAATTAAATATTCAGCATGCTG
TGCTGTTTGGTGAAGGAGCCGGAGCTAATATTCTTGCGCGATTTGCTATG
AACAATGATGATAAAGTCTTGGGAATTGTTTTGATTCATTGTACAGGAAC
AACTGCGGGTATAAAAGAGGCGATTAGGGATCGATTAATCACCTGGAAAC
TGAATACAACTGGCATGAATCCAGTTGCAGAAAGCTATTTGGTTGTTCAC
AGATTCGGGGAACATATAAATACTAATAGTGAGAAAGAGTTTCGGGAAAT
GATAAATGGGTTCAAGAGAAATTTGCAAGCCTCTATTAATCCTAGAAATC
TCAACAAATTCATTTTGTCGTTTATGAACCGTTCTAATATTGCGGAGAGG
ATTTATCAATTGAAATGCCCAGCCTTATTTGTGACTGGAAACCTCGCATC
TCACAACCACACTGTTATGACTTTATATAATACGTTGCAAAAATTTGTTA
AAGATGATCCTGAACGTATTAAGAAGCTCGAATTGATCCAGGTCAATGGA
GTTGCTAATGTATTAAAAGAAAAACCAGAGAAAATCGCGGAATCATTACA
ATATTTCCTTCAAGGTTTAGGATTAGTTGGTGGATTACGAGTTCACAGCT
TATGCAATCCGTTATCAAGGCGATTATCCATGGAACAGCTTGACTTGCCA
CGAGGACCAGATTCGCTATCCTCCATCCGAAAAGGATCAATGCCAATTCA
ACATTAAAAAAATTATCTAATTTCATTACTAGTTAGAGTTGATGATTAAA
ACCCACTAAACATTTTCATAATTTATG
back to top

protein sequence of SMED30013306-orf-1

>SMED30013306-orf-1 ID=SMED30013306-orf-1|Name=SMED30013306-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MVEIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLE
HTSMKHLRNRCVWIHLDIPGQGDNDEDLNLKEFPTMQEIADDIKVIFDEL
NIQHAVLFGEGAGANILARFAMNNDDKVLGIVLIHCTGTTAGIKEAIRDR
LITWKLNTTGMNPVAESYLVVHRFGEHINTNSEKEFREMINGFKRNLQAS
INPRNLNKFILSFMNRSNIAERIYQLKCPALFVTGNLASHNHTVMTLYNT
LQKFVKDDPERIKKLELIQVNGVANVLKEKPEKIAESLQYFLQGLGLVGG
LRVHSLCNPLSRRLSMEQLDLPRGPDSLSSIRKGSMPIQH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0008017microtubule binding
GO:0017137Rab GTPase binding
GO:0043015gamma-tubulin binding
GO:0045296cadherin binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005886plasma membrane
GO:0005913cell-cell adherens junction
GO:0015630microtubule cytoskeleton
GO:0016020membrane
GO:0043209myelin sheath
GO:0048471perinuclear region of cytoplasm
GO:0055038recycling endosome membrane
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0008285negative regulation of cell proliferation
GO:0030330DNA damage response, signal transduction by p53 class mediator
GO:0032287peripheral nervous system myelin maintenance
GO:0042127regulation of cell proliferation
GO:0045576mast cell activation
GO:0071456cellular response to hypoxia
GO:0090232positive regulation of spindle checkpoint
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR004142NDRG
IPR029058AB_hydrolase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004142NDRGPFAMPF03096Ndrcoord: 10..298
e-value: 4.7E-73
score: 245.4
IPR004142NDRGPANTHERPTHR11034N-MYC DOWNSTREAM REGULATEDcoord: 7..323
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 1..294
e-value: 2.6E-64
score: 219.4
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 15..236
NoneNo IPR availablePANTHERPTHR11034:SF40BCDNA.GH02439coord: 7..323