SAFB-like, transcription modulator

Overview
NameSAFB-like, transcription modulator
Smed IDSMED30013303
Length (bp)2146
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SAFB-like, transcription modulator (SMED30013303) t-SNE clustered cells

Violin plots show distribution of expression levels for SAFB-like, transcription modulator (SMED30013303) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SAFB-like, transcription modulator (SMED30013303) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SAFB-like, transcription modulator (SMED30013303) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013303

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013303SMESG000004509.1 SmedASXL_014259SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30013303SMESG000004509.1 dd_Smed_v4_3681_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013303SMESG000004509.1 dd_Smed_v4_3681_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013303SMESG000004509.1 dd_Smed_v4_3681_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013303SMESG000004509.1 dd_Smed_v4_3681_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013303SMESG000004509.1 Contig50907newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013303SMESG000004509.1 Contig50907uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30013303SMESG000004509.1 dd_Smed_v6_3681_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SAFB-like, transcription modulator vs. Ensembl Human
Match: SLTM (SAFB like transcription modulator [Source:HGNC Symbol;Acc:HGNC:20709])

HSP 1 Score: 93.9745 bits (232), Expect = 4.989e-19
Identity = 43/102 (42.16%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK 1010
            +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   CIA+L +TE  G +IS+     D   SK+++ + N   SSS S G K
Sbjct:  386 IWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISVEKVKGDP--SKKEMKKENDEKSSSRSSGDK 485          
BLAST of SAFB-like, transcription modulator vs. Ensembl Human
Match: SLTM (SAFB like transcription modulator [Source:HGNC Symbol;Acc:HGNC:20709])

HSP 1 Score: 86.6557 bits (213), Expect = 2.887e-17
Identity = 33/72 (45.83%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   CIA+L +TE  G +IS+
Sbjct:  368 IWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISV 439          
BLAST of SAFB-like, transcription modulator vs. Ensembl Human
Match: SAFB (scaffold attachment factor B [Source:HGNC Symbol;Acc:HGNC:10520])

HSP 1 Score: 83.9593 bits (206), Expect = 4.845e-16
Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  669 KEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND 938
            KEE  ++      WV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + +++  +A  CI +L +TE  G +IS+    N+
Sbjct:  327 KEEKGRSSCGRNFWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELHGKMISVEKAKNE 416          
BLAST of SAFB-like, transcription modulator vs. Ensembl Human
Match: SAFB (scaffold attachment factor B [Source:HGNC Symbol;Acc:HGNC:10520])

HSP 1 Score: 83.5741 bits (205), Expect = 7.558e-16
Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  669 KEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND 938
            KEE  ++      WV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + +++  +A  CI +L +TE  G +IS+    N+
Sbjct:  396 KEEKGRSSCGRNFWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELHGKMISVEKAKNE 485          
BLAST of SAFB-like, transcription modulator vs. Ensembl Human
Match: SAFB (scaffold attachment factor B [Source:HGNC Symbol;Acc:HGNC:10520])

HSP 1 Score: 83.5741 bits (205), Expect = 7.818e-16
Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  669 KEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND 938
            KEE  ++      WV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + +++  +A  CI +L +TE  G +IS+    N+
Sbjct:  396 KEEKGRSSCGRNFWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELHGKMISVEKAKNE 485          
BLAST of SAFB-like, transcription modulator vs. Ensembl Celegans
Match: F32B4.4 (pep chromosome:WBcel235:I:11521830:11526629:1 gene:WBGene00009314.1 transcript:F32B4.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32B4.4)

HSP 1 Score: 50.447 bits (119), Expect = 5.449e-6
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 3
Query:  696 KTELWVTNIAEDVKAVELKELFGNYGKVVSAKV----VMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITN-DMNDKTISKEKVVRNNSPVSSSASWGSKS 1013
            KT +W+  +    KA  +K+L   YGKV+ +K+      +A      CF  IQ A     +  + +L Q  ++G ++ +     +  T S EK+ R    V+ +AS  S S
Sbjct:  324 KTSIWIRGMTPATKASSVKQLASQYGKVIQSKIFNSKAADANGDVKNCFALIQFADVTAMELAMTSLHQKNYQGRVLRVEKVSESHLTSSAEKLAREKH-VAEAASTMSTS 433          
BLAST of SAFB-like, transcription modulator vs. Ensembl Celegans
Match: F32B4.4 (pep chromosome:WBcel235:I:11517558:11526629:1 gene:WBGene00009314.1 transcript:F32B4.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32B4.4)

HSP 1 Score: 50.0618 bits (118), Expect = 6.129e-6
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 3
Query:  696 KTELWVTNIAEDVKAVELKELFGNYGKVVSAKV----VMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITN-DMNDKTISKEKVVRNNSPVSSSASWGSKS 1013
            KT +W+  +    KA  +K+L   YGKV+ +K+      +A      CF  IQ A     +  + +L Q  ++G ++ +     +  T S EK+ R    V+ +AS  S S
Sbjct:  395 KTSIWIRGMTPATKASSVKQLASQYGKVIQSKIFNSKAADANGDVKNCFALIQFADVTAMELAMTSLHQKNYQGRVLRVEKVSESHLTSSAEKLAREKH-VAEAASTMSTS 504          
BLAST of SAFB-like, transcription modulator vs. Ensembl Fly
Match: Saf-B (gene:FBgn0039229 transcript:FBtr0084700)

HSP 1 Score: 82.0333 bits (201), Expect = 1.106e-15
Identity = 31/72 (43.06%), Postives = 46/72 (63.89%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            LWV+ ++   +A +LK +F  +GKV+ AKVV N + P   C+G + ++S  DA  CI NL +TE  G IIS+
Sbjct:  314 LWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENLHRTELHGRIISV 385          
BLAST of SAFB-like, transcription modulator vs. Ensembl Zebrafish
Match: sltm (SAFB-like, transcription modulator [Source:ZFIN;Acc:ZDB-GENE-040426-2647])

HSP 1 Score: 86.2705 bits (212), Expect = 2.940e-18
Identity = 34/72 (47.22%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            LWV+ ++ + KA +LK LFG YGKV SAKVV NA++P   C+G + ++S  +   CI++LD+TE  G  IS+
Sbjct:  157 LWVSGLSSNTKAADLKNLFGKYGKVFSAKVVTNARSPGAKCYGLVTMSSSAEVARCISHLDRTELHGQQISV 228          
BLAST of SAFB-like, transcription modulator vs. Ensembl Zebrafish
Match: sltm (SAFB-like, transcription modulator [Source:ZFIN;Acc:ZDB-GENE-040426-2647])

HSP 1 Score: 88.1965 bits (217), Expect = 1.675e-17
Identity = 34/72 (47.22%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            LWV+ ++ + KA +LK LFG YGKV SAKVV NA++P   C+G + ++S  +   CI++LD+TE  G  IS+
Sbjct:  323 LWVSGLSSNTKAADLKNLFGKYGKVFSAKVVTNARSPGAKCYGLVTMSSSAEVARCISHLDRTELHGQQISV 394          
BLAST of SAFB-like, transcription modulator vs. Ensembl Zebrafish
Match: safb (scaffold attachment factor B [Source:ZFIN;Acc:ZDB-GENE-030131-698])

HSP 1 Score: 82.8037 bits (203), Expect = 8.062e-16
Identity = 37/99 (37.37%), Postives = 57/99 (57.58%), Query Frame = 3
Query:  624 QSRDTENDMAKIESRKEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            Q +  E D +     K++     S   LWV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + + S  +A  CI++L +TE  G +IS+
Sbjct:  360 QKKSEEEDASTKPESKDDKGGASSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMCSIEEATKCISHLHRTELHGRMISV 458          
BLAST of SAFB-like, transcription modulator vs. Ensembl Xenopus
Match: irak4 (interleukin 1 receptor associated kinase 4 [Source:Xenbase;Acc:XB-GENE-492219])

HSP 1 Score: 104.375 bits (259), Expect = 2.027e-22
Identity = 91/327 (27.83%), Postives = 153/327 (46.79%), Query Frame = 3
Query:   60 LKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGDD-----VLNVD-------------ESDESQGESLNSITDDQIPNEVPDPEDDRADFVSPKETLKDENIGADQSTVLTIEDAIKMKTPHEIENDSMI-----VNINDEDD----NESMSHSPNDENVNSLQAINNNNR----ELDNGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEE---------SLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            L+  +L  EL++R L  +G+K+ L SRL +AIE+E GD       +N D             E+DES  E+  S+ +D + +E+   E+   +  S  +   D+N+    S  +  EDAI +    + + D ++     V I D +     +E  +  P D   +    ++ N +    E   GD    +  E     +   ++ D+     SS     Q++ +  D  + +S  +E              S   LWV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  D   CI++L +TE  G  IS+
Sbjct:   33 LRVIDLKTELKRRGLDVSGVKNVLMSRLKQAIEEEGGDTDNIEITVNSDTPKKNSKNKGRKMEADESGCEA--SVEEDSVKSELTIKEE--METSSSLKEADDDNV----SVTIQAEDAITL----DCDGDDLLETGKNVKIADSETSKPKDEQEASDPKDGLEDQKDVMSENQKDEKEESGKGDAVKKDGREASKKTESGEKDKDSQKKGASSTGATGQAKSSSKDAKESKSASKEDKGKNCSTSGTSGSSTRNLWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSADVARCISHLHRTELHGQQISV 347          
BLAST of SAFB-like, transcription modulator vs. Ensembl Xenopus
Match: SAFB (scaffold attachment factor B [Source:HGNC Symbol;Acc:HGNC:10520])

HSP 1 Score: 92.0485 bits (227), Expect = 9.007e-19
Identity = 91/333 (27.33%), Postives = 158/333 (47.45%), Query Frame = 3
Query:   51 VSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGD-DVLNVDESDESQ----------------GESLNSITDDQ-----IPNEVPDPEDDRADFVS-PKETLKDENIGADQSTVLTIEDAIKMKTPHEIENDSMIVNINDEDDNESMSHSPNDENVN------------SLQAINNNNRELDNGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTE--------LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            +S L+  +L AEL+KR++ T G K  L  RL +AIE E G+ D + V     S+                 +S++ I  +      +  + P+ E+   D  S  KE  K+E++     TV + +  + +      E ++  +   D DD ES   + + EN +            S QA  N +++LD+      E   +   D E+ ++N+    E +S   +  + + +  M+ +E   E+++    K +        LWV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + ++S  DA  CI++L +TE  G +IS+
Sbjct:   23 LSELRVIDLKAELKKRNVDTGGNKSVLMERLRKAIEDEGGNPDEIPVSSDTPSKKTPKRSGRGVYNSPPINKSVHIILGENDESEPLKEDAPEVEESVKDEGSLEKEKSKEEDVFV---TVESADSTLDLDGESNQEGETEEIKTLDSDDRESNEQNTSKENADIDMVDLDKANDQSSQAQQNLDKDLDS-----EEKPADEAKDTEEPKKNEECGEEEASAPKESSANEDDQKMSSVEDEIEKNISNDDKGQIDANSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSSSEDATKCISHLHRTELHGRMISV 347          
BLAST of SAFB-like, transcription modulator vs. Ensembl Xenopus
Match: SAFB (scaffold attachment factor B [Source:HGNC Symbol;Acc:HGNC:10520])

HSP 1 Score: 92.0485 bits (227), Expect = 1.311e-18
Identity = 93/352 (26.42%), Postives = 159/352 (45.17%), Query Frame = 3
Query:   51 VSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKG--DDV---------------LNVDESDESQGESLNSITDDQIPNEVPDPEDD-----------------RADFVSPKETLKDENI-----GADQSTVLTIEDA---IKMKTPHEIENDSMIVNINDEDDNESMSHSPNDENVN------------SLQAINNNNRELDNGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTE--------LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            +S L+  +L AEL+KR++ T G K  L  RL +AIE E G  D++                 V + +E +   L   + D   NE P  E +                 + D    +E++KDE         ++   +T+E A   + +      E ++  +   D DD ES   + + EN +            S QA  N +++LD+      E   +   D E+ ++N+    E +S   +  + + +  M+ +E   E+++    K +        LWV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + ++S  DA  CI++L +TE  G +IS+
Sbjct:   23 LSELRVIDLKAELKKRNVDTGGNKSVLMERLRKAIEDEGGNPDEIPVSSDTPSKKTPKRSGRVRKIEEGEDNGLEDDSGDNQENEDPGTEQENESVHIILGENDESEPLKEDAPEVEESVKDEGSLEKEKSKEEDVFVTVESADSTLDLDGESNQEGETEEIKTLDSDDRESNEQNTSKENADIDMVDLDKANDQSSQAQQNLDKDLDS-----EEKPADEAKDTEEPKKNEECGEEEASAPKESSANEDDQKMSSVEDEIEKNISNDDKGQIDANSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSSSEDATKCISHLHRTELHGRMISV 369          
BLAST of SAFB-like, transcription modulator vs. Ensembl Xenopus
Match: SAFB (scaffold attachment factor B [Source:HGNC Symbol;Acc:HGNC:10520])

HSP 1 Score: 91.6633 bits (226), Expect = 1.368e-18
Identity = 91/333 (27.33%), Postives = 158/333 (47.45%), Query Frame = 3
Query:   51 VSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGD-DVLNVDESDESQ----------------GESLNSITDDQ-----IPNEVPDPEDDRADFVS-PKETLKDENIGADQSTVLTIEDAIKMKTPHEIENDSMIVNINDEDDNESMSHSPNDENVN------------SLQAINNNNRELDNGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTE--------LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            +S L+  +L AEL+KR++ T G K  L  RL +AIE E G+ D + V     S+                 +S++ I  +      +  + P+ E+   D  S  KE  K+E++     TV + +  + +      E ++  +   D DD ES   + + EN +            S QA  N +++LD+      E   +   D E+ ++N+    E +S   +  + + +  M+ +E   E+++    K +        LWV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + ++S  DA  CI++L +TE  G +IS+
Sbjct:   23 LSELRVIDLKAELKKRNVDTGGNKSVLMERLRKAIEDEGGNPDEIPVSSDTPSKKTPKRSGRGVYNSPPINKSVHIILGENDESEPLKEDAPEVEESVKDEGSLEKEKSKEEDVFV---TVESADSTLDLDGESNQEGETEEIKTLDSDDRESNEQNTSKENADIDMVDLDKANDQSSQAQQNLDKDLDS-----EEKPADEAKDTEEPKKNEECGEEEASAPKESSANEDDQKMSSVEDEIEKNISNDDKGQIDANSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSSSEDATKCISHLHRTELHGRMISV 347          
BLAST of SAFB-like, transcription modulator vs. Ensembl Xenopus
Match: irak4 (interleukin 1 receptor associated kinase 4 [Source:Xenbase;Acc:XB-GENE-492219])

HSP 1 Score: 91.6633 bits (226), Expect = 1.928e-18
Identity = 57/171 (33.33%), Postives = 87/171 (50.88%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND------KTISKEKVVRNNSPVSSSASWGSKSIHSHF----EDNTNISNLEKVDERKLSKTPLNSPTSTHIKNKIDSTEKDRRPSYREKPNNAS 1187
            LWV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  D   CI++L +TE  G  IS+    ND      K  S EK+    +     +S G KS  +      +D  +    EK D ++L K   +S   +     + S E  ++   R+KP   S
Sbjct:  343 LWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSADVARCISHLHRTELHGQQISVEKVKNDPSKRDIKKDSDEKLGSGRTSGERKSSGGDKSSKTQSSVKKDDRRSSDKQEKKDGKELKK---DSKEKSESGTTVASPESSKKNEERKKPGGKS 510          
BLAST of SAFB-like, transcription modulator vs. Ensembl Mouse
Match: Sltm (SAFB-like, transcription modulator [Source:MGI Symbol;Acc:MGI:1913910])

HSP 1 Score: 93.5893 bits (231), Expect = 4.583e-19
Identity = 42/102 (41.18%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK 1010
            +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   C+A+L +TE  G +IS+     D   SK+++ + N   SSS S G K
Sbjct:  386 IWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCVAHLHRTELHGQLISVEKVKGDP--SKKEMKKENDEKSSSRSAGDK 485          
BLAST of SAFB-like, transcription modulator vs. Ensembl Mouse
Match: Sltm (SAFB-like, transcription modulator [Source:MGI Symbol;Acc:MGI:1913910])

HSP 1 Score: 93.5893 bits (231), Expect = 4.654e-19
Identity = 42/102 (41.18%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK 1010
            +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   C+A+L +TE  G +IS+     D   SK+++ + N   SSS S G K
Sbjct:  368 IWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCVAHLHRTELHGQLISVEKVKGDP--SKKEMKKENDEKSSSRSAGDK 467          
BLAST of SAFB-like, transcription modulator vs. Ensembl Mouse
Match: Sltm (SAFB-like, transcription modulator [Source:MGI Symbol;Acc:MGI:1913910])

HSP 1 Score: 91.6633 bits (226), Expect = 9.774e-19
Identity = 42/102 (41.18%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK 1010
            +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   C+A+L +TE  G +IS+     D   SK+++ + N   SSS S G K
Sbjct:  386 IWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCVAHLHRTELHGQLISVEKVKGDP--SKKEMKKENDEKSSSRSAGDK 485          
BLAST of SAFB-like, transcription modulator vs. Ensembl Mouse
Match: Safb (scaffold attachment factor B [Source:MGI Symbol;Acc:MGI:2146974])

HSP 1 Score: 82.0333 bits (201), Expect = 1.379e-15
Identity = 32/84 (38.10%), Postives = 53/84 (63.10%), Query Frame = 3
Query:  669 KEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            +EE  ++      WV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + +++  +A  CI++L +TE  G +IS+
Sbjct:  418 REEKGRSSCGRNFWVSGLSSTTRATDLKNLFSRYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCISHLHKTELHGKMISV 501          
BLAST of SAFB-like, transcription modulator vs. Ensembl Mouse
Match: Safb (scaffold attachment factor B [Source:MGI Symbol;Acc:MGI:2146974])

HSP 1 Score: 82.0333 bits (201), Expect = 1.413e-15
Identity = 32/84 (38.10%), Postives = 53/84 (63.10%), Query Frame = 3
Query:  669 KEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            +EE  ++      WV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + +++  +A  CI++L +TE  G +IS+
Sbjct:  418 REEKGRSSCGRNFWVSGLSSTTRATDLKNLFSRYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCISHLHKTELHGKMISV 501          
BLAST of SAFB-like, transcription modulator vs. UniProt/SwissProt
Match: sp|Q9NWH9|SLTM_HUMAN (SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 2.396e-18
Identity = 43/102 (42.16%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK 1010
            +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   CIA+L +TE  G +IS+     D   SK+++ + N   SSS S G K
Sbjct:  386 IWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISVEKVKGDP--SKKEMKKENDEKSSSRSSGDK 485          
BLAST of SAFB-like, transcription modulator vs. UniProt/SwissProt
Match: sp|Q8CH25|SLTM_MOUSE (SAFB-like transcription modulator OS=Mus musculus OX=10090 GN=Sltm PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.206e-18
Identity = 42/102 (41.18%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK 1010
            +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   C+A+L +TE  G +IS+     D   SK+++ + N   SSS S G K
Sbjct:  386 IWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCVAHLHRTELHGQLISVEKVKGDP--SKKEMKKENDEKSSSRSAGDK 485          
BLAST of SAFB-like, transcription modulator vs. UniProt/SwissProt
Match: sp|Q498L2|SLTM_XENLA (SAFB-like transcription modulator OS=Xenopus laevis OX=8355 GN=sltm PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.470e-17
Identity = 36/78 (46.15%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND 938
            LWV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  D   CI++L +TE  G  IS+    ND
Sbjct:  347 LWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSADVARCISHLHRTELHGQQISVEKVKND 424          
BLAST of SAFB-like, transcription modulator vs. UniProt/SwissProt
Match: sp|Q15424|SAFB1_HUMAN (Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4)

HSP 1 Score: 83.5741 bits (205), Expect = 3.754e-15
Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  669 KEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND 938
            KEE  ++      WV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + +++  +A  CI +L +TE  G +IS+    N+
Sbjct:  396 KEEKGRSSCGRNFWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELHGKMISVEKAKNE 485          
BLAST of SAFB-like, transcription modulator vs. UniProt/SwissProt
Match: sp|Q5R452|SAFB1_PONAB (Scaffold attachment factor B1 OS=Pongo abelii OX=9601 GN=SAFB PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.951e-15
Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 3
Query:  669 KEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND 938
            KEE  ++      WV+ ++   +A +LK LF  YGKVV AKVV NA++P   C+G + +++  +A  CI +L +TE  G +IS+    N+
Sbjct:  396 KEEKGRSSCGRNFWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELHGKMISVEKAKNE 485          
BLAST of SAFB-like, transcription modulator vs. TrEMBL
Match: F6YIJ1 (Interleukin 1 receptor associated kinase 4 OS=Xenopus tropicalis OX=8364 GN=klhl24 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.183e-19
Identity = 91/327 (27.83%), Postives = 153/327 (46.79%), Query Frame = 3
Query:   60 LKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGDD-----VLNVD-------------ESDESQGESLNSITDDQIPNEVPDPEDDRADFVSPKETLKDENIGADQSTVLTIEDAIKMKTPHEIENDSMI-----VNINDEDD----NESMSHSPNDENVNSLQAINNNNR----ELDNGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEE---------SLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            L+  +L  EL++R L  +G+K+ L SRL +AIE+E GD       +N D             E+DES  E+  S+ +D + +E+   E+   +  S  +   D+N+    S  +  EDAI +    + + D ++     V I D +     +E  +  P D   +    ++ N +    E   GD    +  E     +   ++ D+     SS     Q++ +  D  + +S  +E              S   LWV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  D   CI++L +TE  G  IS+
Sbjct:   33 LRVIDLKTELKRRGLDVSGVKNVLMSRLKQAIEEEGGDTDNIEITVNSDTPKKNSKNKGRKMEADESGCEA--SVEEDSVKSELTIKEE--METSSSLKEADDDNV----SVTIQAEDAITL----DCDGDDLLETGKNVKIADSETSKPKDEQEASDPKDGLEDQKDVMSENQKDEKEESGKGDAVKKDGREASKKTESGEKDKDSQKKGASSTGATGQAKSSSKDAKESKSASKEDKGKNCSTSGTSGSSTRNLWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSADVARCISHLHRTELHGQQISV 347          
BLAST of SAFB-like, transcription modulator vs. TrEMBL
Match: F6ZFY9 (SAFB like transcription modulator OS=Macaca mulatta OX=9544 GN=SLTM PE=4 SV=3)

HSP 1 Score: 100.523 bits (249), Expect = 5.677e-18
Identity = 101/375 (26.93%), Postives = 177/375 (47.20%), Query Frame = 3
Query:   51 VSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGDD-----VLNVD--------------ESDESQGESLNSITDDQIPNEVPDPEDDRADFVSPKETL-------------KDENIGADQSTVLTIEDAIKMKTPHEIENDSMI-----VNIND------EDDNESMSHSPNDENVN-SLQAINNNNRELD--NGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTE---------LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK 1010
            ++ L+  +L +EL++R+L   G+K  L SRL +AIE+E GD       ++ D              E+DE  G++  S+ DD    +  + E+++        T              +D+NI    S  +  EDAI +    + + D ++     V I D      +D  ++++ SP  E+ +  + A + + ++ D   GD    E  E     +  ++E DT     SS     Q++ +  +    ++  ++   + S T          +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   CIA+L +TE  G +IS+     D   SK+++ + N   SSS S G K
Sbjct:   22 ITDLRVIDLKSELKRRNLDITGVKTVLISRLKQAIEEEGGDPDNIELTVSTDTPNKKPTKGKGKKHEADELSGDA--SVEDDAFIKDGEEEENEKGSLAEADHTAHEEMEAHTTVKEAEDDNI----SVTIQAEDAITL----DFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMNANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSSTGASGQAKSSSKESKDSKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISVEKVKGDP--SKKEMKKENDEKSSSRSSGDK 384          
BLAST of SAFB-like, transcription modulator vs. TrEMBL
Match: A0A4Y2FGE8 (Scaffold attachment factor B1 OS=Araneus ventricosus OX=182803 GN=Safb PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.001e-16
Identity = 69/217 (31.80%), Postives = 110/217 (50.69%), Query Frame = 3
Query:  345 LTIEDAIKMKTPHEI---ENDSMIVNINDE--------DDNESMSHSP-------NDENVNSLQA-----INNNNRELDNGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLK--TQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            LT+ED IK+ T  +I   +NDS+IVN +D         ++ ES++  P       N ENV S  A     +  N+ E+ +   +    + ++  D+     ND    E + D++   +  +     K  + K+E +K  T S   LWV+ +AE  +A +LK LF  +GKV  AK+V NA+ P   C+G I +AS  +A  C+  L+ TE  G II++
Sbjct:  166 LTVEDVIKLDTSIKIKASDNDSLIVNPDDTQSDIDSSVNERESINEDPTADEGAENSENVESESAEKNDVLQENDIEMKDATVKDSNSTVDISKDNNIPSGNDKPSLEQTDDASSTVTAKSPEKRTKSSADKDEHIKRVTASSKNLWVSGLAEKTRAKDLKALFSKFGKVSGAKIVTNARTPGSRCYGFITMASSEEALICVDKLNHTELHGKIITV 382          
BLAST of SAFB-like, transcription modulator vs. TrEMBL
Match: A0A3P8X292 (Scaffold attachment factor B OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.328e-16
Identity = 100/354 (28.25%), Postives = 164/354 (46.33%), Query Frame = 3
Query:   51 VSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKG--DDVL----------NV-------DESDESQGE-------SLNSITDDQIPNEVPDPEDDRADFVSPK----------ETLKDEN---IGA------------------DQSTVLTIEDAIKMKTPH---EIENDSMIVNINDEDDNESMSHSPNDENVNSLQAINNNNR----ELDNGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            +S L+  +L AEL+KR+L T G+K  L  RL +AI++E G  D+++          NV       ++S + Q E        +N + + +  N +P  +DD +D               E L DEN    G+                  +Q+     E+A+  K      E + D +     +  D +++     D    SLQA++ N +    E  N + E  +  EE   +++   ++ +   E SS     Q ++ END AK E + E++    S   LWV+ ++   +A +LK LF  YGKVV AKVV NAK+P   C+G + ++S  +A  CI +L +TE  G +IS+
Sbjct:   12 LSELRVIDLKAELKKRNLDTTGVKSVLSERLKKAIQEEGGNPDEIILTPDSLPKKANVTPKRTTREDSQDDQEEMHEMDLFDMNVLDETENDNGIPAEDDDESDLFQGNSDVLLNEDDIEDLGDENDKVAGSCLSEPLNEDQSHATSPDEEQAATTGEEEAVCDKAASGDAESDQDVLETEAKEVGDGQNIPEETMDAENTSLQAVSLNEQGSLSETVNSEIESKKGEEEEKTEEKAAADSASTVKECSSVEGDDQKKE-END-AKTEVKDEKA--AASSRNLWVSGLSSTTRATDLKTLFSKYGKVVGAKVVTNAKSPGARCYGFVTMSSTEEATKCIGHLHRTELHGRMISV 361          
BLAST of SAFB-like, transcription modulator vs. TrEMBL
Match: G3TJU2 (SAFB like transcription modulator OS=Loxodonta africana OX=9785 GN=SLTM PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.979e-16
Identity = 50/128 (39.06%), Postives = 77/128 (60.16%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSKSIHSHFEDNTNISNLEKVDERKLSKT 1088
            +WV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   CIA+L +TE  G +IS+     D   SK+++ + N   SSS S G K+  S     T  S ++K D+R   K+
Sbjct:  386 IWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSGTEVSRCIAHLHRTELHGQLISVEKVKGDP--SKKELKKENDEKSSSRSSGDKTNMSERSSKTQAS-VKKEDKRSSEKS 510          
BLAST of SAFB-like, transcription modulator vs. Ensembl Cavefish
Match: sltm (SAFB-like, transcription modulator [Source:ZFIN;Acc:ZDB-GENE-040426-2647])

HSP 1 Score: 88.1965 bits (217), Expect = 1.449e-17
Identity = 34/72 (47.22%), Postives = 49/72 (68.06%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            LWV+ ++ + KA +LK LFG YGKV SAKVV NA++P   C+G + ++S  +   CI++LD TE  G  IS+
Sbjct:  375 LWVSGLSSNTKAADLKNLFGKYGKVFSAKVVTNARSPGAKCYGLVTMSSSAEVARCISHLDHTELHGQQISV 446          
BLAST of SAFB-like, transcription modulator vs. Ensembl Cavefish
Match: safb (scaffold attachment factor B2 [Source:NCBI gene;Acc:103042131])

HSP 1 Score: 83.9593 bits (206), Expect = 2.885e-16
Identity = 44/125 (35.20%), Postives = 73/125 (58.40%), Query Frame = 3
Query:  576 ENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTE----------LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            E D    E +++S++++    E D  K +S  E+S KT++K +          LWV+ ++   +A +LK +F  YGKVV AKVV NA++P   C+G + ++S  +A  CI +L +TE  G +IS+
Sbjct:  325 EEDKKTEESAAESSEVKESSVEGDDQK-KSGDEKSDKTEAKDDKGSAAASGRNLWVSGLSSTTRATDLKNIFSKYGKVVGAKVVTNARSPGARCYGFVTMSSTEEATKCINHLHRTELHGRMISV 448          
BLAST of SAFB-like, transcription modulator vs. Ensembl Cavefish
Match: safb (scaffold attachment factor B2 [Source:NCBI gene;Acc:103042131])

HSP 1 Score: 83.5741 bits (205), Expect = 3.626e-16
Identity = 44/125 (35.20%), Postives = 73/125 (58.40%), Query Frame = 3
Query:  576 ENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTE----------LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            E D    E +++S++++    E D  K +S  E+S KT++K +          LWV+ ++   +A +LK +F  YGKVV AKVV NA++P   C+G + ++S  +A  CI +L +TE  G +IS+
Sbjct:  331 EEDKKTEESAAESSEVKESSVEGDDQK-KSGDEKSDKTEAKDDKGSAAASGRNLWVSGLSSTTRATDLKNIFSKYGKVVGAKVVTNARSPGARCYGFVTMSSTEEATKCINHLHRTELHGRMISV 454          
BLAST of SAFB-like, transcription modulator vs. Ensembl Sea Lamprey
Match: sltm (SAFB-like, transcription modulator [Source:ZFIN;Acc:ZDB-GENE-040426-2647])

HSP 1 Score: 84.3445 bits (207), Expect = 4.144e-17
Identity = 32/78 (41.03%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND 938
            LWV++++   KA +LK  F  YGKV+ AK+V NA++P   C+G + +A+  +A  CI++L +TE  G +IS+    ND
Sbjct:  163 LWVSSLSSSTKATDLKNAFSKYGKVIGAKIVTNARSPGARCYGFVTMATVEEATKCISHLHRTELHGRMISVERAKND 240          
BLAST of SAFB-like, transcription modulator vs. Ensembl Nematostella
Match: EDO39140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAZ9])

HSP 1 Score: 80.8777 bits (198), Expect = 1.018e-15
Identity = 34/101 (33.66%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  705 LWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGS 1007
            LWV N++   +A +LK  F  YGKVV AK+V N+K P   CFG + + +  +A  CI +L +TE  G  I++     D+    +      +P  ++   GS
Sbjct:  346 LWVANLSSITRAADLKTRFSQYGKVVGAKIVTNSKAPGAQCFGLVTMTTSEEAAKCIQHLHRTELHGRAITVDRAKGDRVSQTQGSASKKTPGKAADKKGS 446          
BLAST of SAFB-like, transcription modulator vs. Ensembl Medaka
Match: safb (scaffold attachment factor B2 [Source:NCBI gene;Acc:101158935])

HSP 1 Score: 87.8113 bits (216), Expect = 1.741e-17
Identity = 44/116 (37.93%), Postives = 65/116 (56.03%), Query Frame = 3
Query:  582 DTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQ---SKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
            D+   E SS     Q + +E+   K ES+ E++       S   LWV+ ++   +A +LK LF  YGKVV AKVV NAK+P   C+G + ++S  +A  CI  L +TE  G +IS+
Sbjct:  320 DSALKESSSVEGDDQKKSSEDKDGKAESKDEKAAGGGAAASSRNLWVSGLSSTTRATDLKSLFSKYGKVVGAKVVTNAKSPGARCYGFVTMSSSEEATKCIGQLHRTELHGKMISV 435          
BLAST of SAFB-like, transcription modulator vs. Ensembl Medaka
Match: sltm (SAFB like transcription modulator [Source:NCBI gene;Acc:101161618])

HSP 1 Score: 87.4261 bits (215), Expect = 2.585e-17
Identity = 43/104 (41.35%), Postives = 60/104 (57.69%), Query Frame = 3
Query:  627 SRDTENDMAKIESRKEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMND 938
            SRD +   AK E  K     + S   LWV+ ++ + KA +LK LFG YGKV+SAKVV NA++P   C+G + ++S  +   CI +LD TE  G  I +    ND
Sbjct:  290 SRDRDGKAAKDE--KAAGSNSSSSQNLWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGSKCYGLVTMSSSTEVTRCITHLDCTELHGQEIYVKRAKND 391          
BLAST of SAFB-like, transcription modulator vs. Planmine SMEST
Match: SMESG000004509.1 (SMESG000004509.1)

HSP 1 Score: 1177.93 bits (3046), Expect = 0.000e+0
Identity = 634/653 (97.09%), Postives = 636/653 (97.40%), Query Frame = 3
Query:   45 MNVSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGDDVLNVDESDESQGESLNSITDDQIPNEVPDPEDDRADFVSPKETLKDENIGADQSTVLTIEDAIKMKTPHEIENDSMIVNINDEDDNESMSHSPNDENVNSLQAINNNNRELDNGXXXXXXXXXXXXXXXXXNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSKSIHSHFEDNTNISNLEKVDERKLSKTPLNSPTSTHIKNKIDSTEKDRRPSYREKPNNASGYYKPKEFSDRGAMSRRGNRPQYNDDRRQDYADRSGKPYYKXXXXXXXXXXXXXXXXXXXXXXXXKPRENRDNYNSHSFDSRYVPSHRDSGRDKYPRPDYGSDRVHKAPANYNDYRNRPNKYEGYDEYERKDKRPIYDRTAPREIDSYSSSKRDIYKRPRLEETDEYLQSKKRKPEFINEKPQYYRSIDSPKKPYYSEKDYRKPEYKSRRVEYPNDYPSKSDREIYPHRRNAADYPIRRESYDGFSPERHLSRSNHYRKDPYAQNTDFGGRS 2003
            MNVSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGDDVLNVDESDESQGESLNSITDDQI NEVPDPEDDRADF+SPKETLKDENIGADQSTVLTIEDAIKMKTPHEIENDSMIVNINDEDDNESMSHSPNDENVNSLQAINNNNRELDNGDHEIIEISEEVVIDDEDNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK               +KVDERKLSKTPLNSPTSTHIKNKIDSTEKDRRPSYREKPNNASGYYKPKEFSDRGAMSRRGNRPQYNDDRRQDYADRSGKPYYKSSNVNYNSTSGNSYNNSRNRESFSKPRENRDNYNSHSFDSRYVPSHRDSGRDKYPRPDYGSDRVHKAPANYNDYRNRPNKYEGYDEYERKDKRPIYDRTAPREIDSYSSSKRDIYKRPRLEETDEYLQSKKRKPEFINEKPQYYRSIDSPKKPYYSEKDYRKPEYKSRRVEYPNDYPSKSDREIYPHRRNAADYPIRRESYDGFSPERHLSRSNHYRKDPY QNTDFGGRS
Sbjct:    1 MNVSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGDDVLNVDESDESQGESLNSITDDQIHNEVPDPEDDRADFISPKETLKDENIGADQSTVLTIEDAIKMKTPHEIENDSMIVNINDEDDNESMSHSPNDENVNSLQAINNNNRELDNGDHEIIEISEEVVIDDEDNQENDTNYNELSSDSNQLQSRDTENDMAKIESRKEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKTISKEKVVRNNSPVSSSASWGSK---------------KKVDERKLSKTPLNSPTSTHIKNKIDSTEKDRRPSYREKPNNASGYYKPKEFSDRGAMSRRGNRPQYNDDRRQDYADRSGKPYYKSSNVNYNSTSGNSYNNSRNRESFSKPRENRDNYNSHSFDSRYVPSHRDSGRDKYPRPDYGSDRVHKAPANYNDYRNRPNKYEGYDEYERKDKRPIYDRTAPREIDSYSSSKRDIYKRPRLEETDEYLQSKKRKPEFINEKPQYYRSIDSPKKPYYSEKDYRKPEYKSRRVEYPNDYPSKSDREIYPHRRNAADYPIRRESYDGFSPERHLSRSNHYRKDPYVQNTDFGGRS 638          
BLAST of SAFB-like, transcription modulator vs. Planmine SMEST
Match: SMESG000033438.1 (SMESG000033438.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.350e-8
Identity = 28/77 (36.36%), Postives = 40/77 (51.95%), Query Frame = 3
Query:  690 QSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKVVMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISI 920
             S T+L+V NI       EL  LF  YG+++   +V N        FG I ++S  +A   I  LD TEF GN+I++
Sbjct:    1 MSGTKLFVGNIPNGTSKEELSRLFSKYGEILEVTIVKN--------FGFIHMSSEEEANHAIELLDGTEFAGNVINV 69          
The following BLAST results are available for this feature:
BLAST of SAFB-like, transcription modulator vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLTM4.989e-1942.16SAFB like transcription modulator [Source:HGNC Sym... [more]
SLTM2.887e-1745.83SAFB like transcription modulator [Source:HGNC Sym... [more]
SAFB4.845e-1637.78scaffold attachment factor B [Source:HGNC Symbol;A... [more]
SAFB7.558e-1637.78scaffold attachment factor B [Source:HGNC Symbol;A... [more]
SAFB7.818e-1637.78scaffold attachment factor B [Source:HGNC Symbol;A... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F32B4.45.449e-627.93pep chromosome:WBcel235:I:11521830:11526629:1 gene... [more]
F32B4.46.129e-627.93pep chromosome:WBcel235:I:11517558:11526629:1 gene... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Saf-B1.106e-1543.06gene:FBgn0039229 transcript:FBtr0084700[more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sltm2.940e-1847.22SAFB-like, transcription modulator [Source:ZFIN;Ac... [more]
sltm1.675e-1747.22SAFB-like, transcription modulator [Source:ZFIN;Ac... [more]
safb8.062e-1637.37scaffold attachment factor B [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
irak42.027e-2227.83interleukin 1 receptor associated kinase 4 [Source... [more]
SAFB9.007e-1927.33scaffold attachment factor B [Source:HGNC Symbol;A... [more]
SAFB1.311e-1826.42scaffold attachment factor B [Source:HGNC Symbol;A... [more]
SAFB1.368e-1827.33scaffold attachment factor B [Source:HGNC Symbol;A... [more]
irak41.928e-1833.33interleukin 1 receptor associated kinase 4 [Source... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sltm4.583e-1941.18SAFB-like, transcription modulator [Source:MGI Sym... [more]
Sltm4.654e-1941.18SAFB-like, transcription modulator [Source:MGI Sym... [more]
Sltm9.774e-1941.18SAFB-like, transcription modulator [Source:MGI Sym... [more]
Safb1.379e-1538.10scaffold attachment factor B [Source:MGI Symbol;Ac... [more]
Safb1.413e-1538.10scaffold attachment factor B [Source:MGI Symbol;Ac... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NWH9|SLTM_HUMAN2.396e-1842.16SAFB-like transcription modulator OS=Homo sapiens ... [more]
sp|Q8CH25|SLTM_MOUSE3.206e-1841.18SAFB-like transcription modulator OS=Mus musculus ... [more]
sp|Q498L2|SLTM_XENLA1.470e-1746.15SAFB-like transcription modulator OS=Xenopus laevi... [more]
sp|Q15424|SAFB1_HUMAN3.754e-1537.78Scaffold attachment factor B1 OS=Homo sapiens OX=9... [more]
sp|Q5R452|SAFB1_PONAB3.951e-1537.78Scaffold attachment factor B1 OS=Pongo abelii OX=9... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F6YIJ13.183e-1927.83Interleukin 1 receptor associated kinase 4 OS=Xeno... [more]
F6ZFY95.677e-1826.93SAFB like transcription modulator OS=Macaca mulatt... [more]
A0A4Y2FGE81.001e-1631.80Scaffold attachment factor B1 OS=Araneus ventricos... [more]
A0A3P8X2921.328e-1628.25Scaffold attachment factor B OS=Cynoglossus semila... [more]
G3TJU21.979e-1639.06SAFB like transcription modulator OS=Loxodonta afr... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sltm1.449e-1747.22SAFB-like, transcription modulator [Source:ZFIN;Ac... [more]
safb2.885e-1635.20scaffold attachment factor B2 [Source:NCBI gene;Ac... [more]
safb3.626e-1635.20scaffold attachment factor B2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sltm4.144e-1741.03SAFB-like, transcription modulator [Source:ZFIN;Ac... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO391401.018e-1533.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
safb1.741e-1737.93scaffold attachment factor B2 [Source:NCBI gene;Ac... [more]
sltm2.585e-1741.35SAFB like transcription modulator [Source:NCBI gen... [more]
back to top
BLAST of SAFB-like, transcription modulator vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000004509.10.000e+097.09SMESG000004509.1[more]
SMESG000033438.11.350e-836.36SMESG000033438.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013303 ID=SMED30013303|Name=SAFB-like, transcription modulator|organism=Schmidtea mediterranea sexual|type=transcript|length=2146bp
TCATTTTTTTTATTTGTAAACATTGTTAATTATTTTTTTTGAAAATGAAT
GTTTCTCGTTTGAAGAAACCAGAACTTATAGCCGAATTAGAGAAGCGATC
ATTACCGACTAATGGTCTTAAAGATGAACTAAAATCTAGATTAATTGAAG
CAATAGAAAAAGAAAAAGGAGATGATGTTCTAAATGTTGATGAATCCGAT
GAAAGTCAAGGTGAATCGTTAAATTCAATTACCGACGATCAAATTCCTAA
TGAGGTACCAGATCCCGAAGATGATCGTGCTGACTTTGTTTCCCCTAAAG
AAACATTAAAAGATGAAAATATTGGTGCTGATCAATCAACAGTATTAACA
ATTGAAGACGCCATTAAAATGAAAACTCCTCATGAAATCGAAAATGATTC
AATGATAGTCAATATTAATGACGAGGATGACAATGAATCTATGTCACATT
CACCTAATGATGAAAATGTCAATTCATTACAAGCAATCAATAACAATAAT
CGTGAATTGGATAATGGCGATCATGAAATAATTGAAATCAGCGAGGAAGT
TGTAATAGATGATGAAGATAATCAAGAAAATGATACCAATTATAATGAAT
TATCATCCGACAGTAATCAACTTCAATCACGAGATACAGAAAATGACATG
GCAAAAATCGAATCAAGAAAAGAAGAATCTTTGAAAACACAATCTAAAAC
AGAATTATGGGTGACTAATATAGCTGAGGATGTTAAAGCGGTTGAGCTGA
AAGAGTTATTTGGTAACTATGGCAAAGTGGTATCAGCAAAAGTAGTAATG
AATGCTAAAAATCCTTCCGGCACTTGTTTCGGGTGCATTCAATTGGCCAG
TCCAGGTGATGCAAAGGCTTGCATTGCAAATCTGGATCAAACTGAATTCC
GTGGAAATATTATTTCAATTACTAATGACATGAATGATAAAACTATTTCT
AAAGAGAAAGTCGTTAGAAATAATTCACCGGTTAGCTCAAGCGCTTCATG
GGGATCTAAAAGTATTCATTCTCATTTTGAAGATAACACCAATATTTCAA
ATCTAGAGAAAGTAGATGAAAGAAAATTATCAAAAACTCCTTTGAATTCG
CCAACATCAACGCATATTAAAAACAAAATTGATTCAACTGAAAAAGACAG
GCGACCATCTTATCGAGAAAAGCCAAACAATGCAAGTGGATACTATAAAC
CAAAAGAGTTTTCTGATAGAGGTGCAATGAGTAGAAGAGGTAATCGACCA
CAGTATAATGATGATAGACGTCAAGATTATGCCGATAGAAGTGGAAAACC
TTATTATAAAAGTAGTAATGTCAATTACAATTCTACTAGTGGAAATTCGT
ATAATAACAGCAGAAATCGAGAATCCTTTTCTAAACCACGCGAAAATCGA
GATAACTACAATTCTCATTCGTTTGATTCTCGGTATGTTCCGTCGCATCG
AGACAGTGGTAGAGATAAATATCCTCGACCCGATTATGGAAGTGATAGAG
TGCATAAAGCACCTGCCAATTATAATGATTATCGCAATCGCCCTAACAAA
TATGAAGGCTACGATGAGTATGAAAGAAAAGACAAAAGGCCAATTTATGA
TAGAACAGCACCGCGTGAAATTGATAGTTACTCCAGCTCTAAACGAGATA
TTTATAAAAGACCAAGACTCGAAGAAACCGATGAATATCTTCAATCTAAG
AAACGAAAGCCCGAATTTATCAACGAAAAACCGCAATATTATCGTTCTAT
CGACTCACCAAAAAAGCCGTATTATTCAGAAAAGGATTATCGGAAACCTG
AATATAAATCCAGAAGAGTTGAATACCCCAATGATTATCCTTCCAAATCC
GACAGGGAAATCTATCCACATAGACGCAACGCAGCCGATTACCCGATTCG
TCGAGAAAGTTATGATGGATTCTCTCCAGAAAGACATTTAAGTCGTTCAA
ATCATTACAGAAAAGATCCATATGCACAGAATACAGATTTCGGGGGTCGA
TCAAGACGTTATTGAATTGAAAAATATAAAAAATATCGGGCAGTTATTAA
ATTCATTACATTGTCTCAATCTAAATAAATATTATTGTCGTTGGTGAATT
AAATTTTGATAACACTTTTTTGTATTTATAAGTCGAGAGTTCCTCG
back to top

protein sequence of SMED30013303-orf-1

>SMED30013303-orf-1 ID=SMED30013303-orf-1|Name=SMED30013303-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=657bp
MNVSRLKKPELIAELEKRSLPTNGLKDELKSRLIEAIEKEKGDDVLNVDE
SDESQGESLNSITDDQIPNEVPDPEDDRADFVSPKETLKDENIGADQSTV
LTIEDAIKMKTPHEIENDSMIVNINDEDDNESMSHSPNDENVNSLQAINN
NNRELDNGDHEIIEISEEVVIDDEDNQENDTNYNELSSDSNQLQSRDTEN
DMAKIESRKEESLKTQSKTELWVTNIAEDVKAVELKELFGNYGKVVSAKV
VMNAKNPSGTCFGCIQLASPGDAKACIANLDQTEFRGNIISITNDMNDKT
ISKEKVVRNNSPVSSSASWGSKSIHSHFEDNTNISNLEKVDERKLSKTPL
NSPTSTHIKNKIDSTEKDRRPSYREKPNNASGYYKPKEFSDRGAMSRRGN
RPQYNDDRRQDYADRSGKPYYKSSNVNYNSTSGNSYNNSRNRESFSKPRE
NRDNYNSHSFDSRYVPSHRDSGRDKYPRPDYGSDRVHKAPANYNDYRNRP
NKYEGYDEYERKDKRPIYDRTAPREIDSYSSSKRDIYKRPRLEETDEYLQ
SKKRKPEFINEKPQYYRSIDSPKKPYYSEKDYRKPEYKSRRVEYPNDYPS
KSDREIYPHRRNAADYPIRRESYDGFSPERHLSRSNHYRKDPYAQNTDFG
GRSRRY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036361SAP_dom_sf
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR003034SAP_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003034SAP domainSMARTSM00513sap_9coord: 3..37
e-value: 6.0E-5
score: 32.4
IPR003034SAP domainPFAMPF02037SAPcoord: 4..37
e-value: 5.6E-9
score: 35.6
IPR003034SAP domainPROSITEPS50800SAPcoord: 3..37
score: 8.867
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 220..293
e-value: 6.7E-14
score: 62.2
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 221..290
e-value: 3.6E-12
score: 45.9
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 219..297
score: 11.469
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 124..307
e-value: 1.5E-18
score: 69.2
IPR036361SAP domain superfamilyGENE3DG3DSA:1.10.720.30coord: 1..45
e-value: 3.4E-7
score: 31.8
IPR036361SAP domain superfamilySUPERFAMILYSSF68906SAP domaincoord: 2..40
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 547..656
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..198
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 339..533
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 573..638
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 41..78
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 500..533
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 360..375
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 420..442
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 443..485
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..214
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 547..561
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 199..214
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 52..67
NoneNo IPR availablePANTHERPTHR15683SCAFFOLD ATTACHMENT FACTOR B-RELATEDcoord: 7..365
NoneNo IPR availablePANTHERPTHR15683:SF8SCAFFOLD ATTACHMENT FACTOR B, ISOFORM Bcoord: 7..365
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 215..295