sn1-specific diacylglycerol lipase beta

Overview
Namesn1-specific diacylglycerol lipase beta
Smed IDSMED30013286
Length (bp)3658
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of sn1-specific diacylglycerol lipase beta (SMED30013286) t-SNE clustered cells

Violin plots show distribution of expression levels for sn1-specific diacylglycerol lipase beta (SMED30013286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of sn1-specific diacylglycerol lipase beta (SMED30013286) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for sn1-specific diacylglycerol lipase beta (SMED30013286) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30013286h1SMcG0021548 SmedASXL_037154SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30013286h1SMcG0021548 SmedASXL_014928SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30013286h1SMcG0021548 dd_Smed_v4_13306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013286h1SMcG0021548 dd_Smed_v4_13306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30013286h1SMcG0021548 dd_Smed_v4_13306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30013286h1SMcG0021548 dd_Smed_v4_13306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013286h1SMcG0021548 dd_Smed_v4_13306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013286h1SMcG0021548 dd_Smed_v4_13306_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013286h1SMcG0021548 dd_Smed_v6_13306_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30013286h1SMcG0021548 SMED30023344smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30013286h1SMcG0021548 Contig41234uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013286h1SMcG0021548 Contig41234newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Human
Match: DAGLA (diacylglycerol lipase alpha [Source:HGNC Symbol;Acc:HGNC:1165])

HSP 1 Score: 156.377 bits (394), Expect = 8.705e-42
Identity = 122/486 (25.10%), Postives = 214/486 (44.03%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRY-----SLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCV-----SFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
             I+ +S +G I+    R  + + +Y++L +   E I +IV      +Y      L        +++ N +++      L+  + + C+ +D  GR  + V L ATK+                     W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+++ N +  +   +                   + Y+   A A+YGWP++L+       R   C GLC           C CC C         +   ++  C C+  AI    H   EN+  V     S ++  + +PF++A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P LKC+A+SPP G
Sbjct:   75 AIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVTLGMVVCNWVVI------LSVCITVLCV-FDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKE-------------------VCYYMLFALAAYGWPMYLM-------RKPAC-GLCQ------LARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAI--RRHFLDENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAILSFLLRPQYPTLKCFAYSPPGG 502          

HSP 2 Score: 36.5798 bits (83), Expect = 8.705e-42
Identity = 17/55 (30.91%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  + + FL+    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Human
Match: DAGLB (diacylglycerol lipase beta [Source:HGNC Symbol;Acc:HGNC:28923])

HSP 1 Score: 152.14 bits (383), Expect = 1.854e-37
Identity = 124/476 (26.05%), Postives = 220/476 (46.22%), Query Frame = 1
Query:  259 TISTIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFL--TAYLIIFCITYDQLG---------------RHGSDVIL--LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDAN--LIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            T+S IM +S +G I     R  +   +YI+L + F E + + +  A      +     C++ ++ N II   +  ++   A ++   I +D LG                H S  +L  L T  T++W+ R+K + C    +D  R A  S A +F++   +++LV SD  AG+ LL +Q  N  +                     NQ+   ++ H   + +                      ++DL ++  +    +++   A A+YGWP+++  +           GLC            I  DC +S + D  L+   +   +CH  +IL+ T L+  + + VSF++K +  PF +A+ H  E +++++RGT SL+D+LTD+ A   +++V E      LAH G+  AA+ + +++  + I+    +    YRL+I GHSLG G A +L+      +P ++CYAFSPP G
Sbjct:   31 TVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAW-----VADGVQCDRTVV-NGIIATVVVSWIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQLLNGLKTAATSVWETRIKLLCCCIGKDDHTRVAFSSTAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRN---------------------NQEPAQVVCHAPGSSQ----------------------EADLDAELENC---HHYMQFAAAAYGWPLYIYRNP--------LTGLCR-----------IGGDCCRSRTTDYDLVGGDQ--LNCHFGSILHTTGLQYRDFIHVSFHDKVYELPFLVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDV-ECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRG 432          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Human
Match: DAGLB (diacylglycerol lipase beta [Source:HGNC Symbol;Acc:HGNC:28923])

HSP 1 Score: 151.754 bits (382), Expect = 3.794e-37
Identity = 122/476 (25.63%), Postives = 220/476 (46.22%), Query Frame = 1
Query:  259 TISTIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFL--TAYLIIFCITYDQLG---------------RHGSDVIL--LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDAN--LIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            T+S IM +S +G I     R  +   +YI+L + F E + + +  A      +     C++ ++ N II   +  ++   A ++   I +D LG                H S  +L  L T  T++W+ R+K + C    +D  R A  S A +F++   +++LV SD  AG+ LL +Q  N  +                     NQ+   ++ H   + +                      ++DL ++  +    +++   A A+YGWP+++                  ++  +  C   I  DC +S + D  L+   +   +CH  +IL+ T L+  + + VSF++K +  PF +A+ H  E +++++RGT SL+D+LTD+ A   +++V E      LAH G+  AA+ + +++  + I+    +    YRL+I GHSLG G A +L+      +P ++CYAFSPP G
Sbjct:   72 TVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAW-----VADGVQCDRTVV-NGIIATVVVSWIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQLLNGLKTAATSVWETRIKLLCCCIGKDDHTRVAFSSTAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRN---------------------NQEPAQVVCHAPGSSQ----------------------EADLDAELENC---HHYMQFAAAAYGWPLYIY-----------------RNPLTGLCR--IGGDCCRSRTTDYDLVGGDQ--LNCHFGSILHTTGLQYRDFIHVSFHDKVYELPFLVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDV-ECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRG 473          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Human
Match: DAGLB (diacylglycerol lipase beta [Source:HGNC Symbol;Acc:HGNC:28923])

HSP 1 Score: 104.76 bits (260), Expect = 2.016e-22
Identity = 58/165 (35.15%), Postives = 99/165 (60.00%), Query Frame = 1
Query: 1135 KSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDAN--LIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            +S + D  L+   +   +CH  +IL+ T L+  + + VSF++K +  PF +A+ H  E +++++RGT SL+D+LTD+ A   +++V E      LAH G+  AA+ + +++  + I+    +    YRL+I GHSLG G A +L+      +P ++CYAFSPP G
Sbjct:  183 RSRTTDYDLVGGDQ--LNCHFGSILHTTGLQYRDFIHVSFHDKVYELPFLVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDV-ECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRG 344          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Celegans
Match: dagl-2 (DiAcylGlycerol Lipase homolog [Source:UniProtKB/TrEMBL;Acc:Q65ZK3])

HSP 1 Score: 127.872 bits (320), Expect = 6.928e-30
Identity = 122/477 (25.58%), Postives = 207/477 (43.40%), Query Frame = 1
Query:  277 IMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIIL---YCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKKTNIWKHRLKWILCIKKVNDEE--RNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSN------SNDQ-----KLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM-------------DANLIEVFE-DGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPP 1617
            ++SA+G IM    R  IP  +YI+L +   E  L+I+A  I+   S    + C+   I    I+   + I       +I+F +T ++L    S    +A K    W  R++    I K+  +   R ALD  A + +S   +S+LV SD  AG+ L       AY                               H  NN+  Y  + + ++E                  W +++   YF   A   YGWP ++L++   KS  +    L C     C  + C+     +        SN +     K + V++  C C+  A++        +L  +SF N+ +  PF +   H+ + I+++IRG+ SL D++TD+             DA L E  E D       H GML +A+ +   + +  I++++   N +Y+L++ GHSLGAG+  +L+     E+P++ CYAF+PP
Sbjct:   76 VISARGTIMNSQPRKLIPRLLYIRLPIFIAEIALTILA-TIHAFKSTNGGEGCDFATIARVTIILEWFLIFTAFAGLVIVFHLTENELEDSAS----IAQKS---WSRRMR----IFKIGQDHSMRVALDDLAILISSFFVDSDLVPSDVVAGLLL-------AY-------------------------------HSPNNQ--YPPVKDKEHES--------------VPKWMNLKDAEYFLHHATCVYGWPTYILYNCGLKSIYRLFRKLQCCGRMRCAQSPCVVQQQRRERIELTELSNGKLVKKGKSMVVEDNCCYCNTAAVVLANEARNIDLQFMSFRNRVYEVPFAVIADHDKKSIVITIRGSCSLIDLVTDLSLEDELMTVDVDQDATLREDEEIDKRGDVRVHRGMLRSARYVFDTLNKNKILNDLFISNPSYQLVVCGHSLGAGVGSLLTMLLKQEYPSVICYAFAPP 486          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Celegans
Match: dagl-2 (DiAcylGlycerol Lipase homolog [Source:UniProtKB/TrEMBL;Acc:Q65ZK3])

HSP 1 Score: 125.946 bits (315), Expect = 2.377e-29
Identity = 120/466 (25.75%), Postives = 202/466 (43.35%), Query Frame = 1
Query:  277 IMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIIL---YCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKKTNIWKHRLKWILCIKKVNDEE--RNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM-------------DANLIEVFE-DGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPP 1617
            ++SA+G IM    R  IP  +YI+L +   E  L+I+A  I+   S    + C+   I    I+   + I       +I+F +T ++L    S    +A K    W  R++    I K+  +   R ALD  A + +S   +S+LV SD  AG+ L       AY                               H  NN+  Y  + + ++E                  W +++   YF   A   YGWP ++L++   KS  +    L C       C +  C           K + V++  C C+  A++        +L  +SF N+ +  PF +   H+ + I+++IRG+ SL D++TD+             DA L E  E D       H GML +A+ +   + +  I++++   N +Y+L++ GHSLGAG+  +L+     E+P++ CYAF+PP
Sbjct:   76 VISARGTIMNSQPRKLIPRLLYIRLPIFIAEIALTILA-TIHAFKSTNGGEGCDFATIARVTIILEWFLIFTAFAGLVIVFHLTENELEDSAS----IAQKS---WSRRMR----IFKIGQDHSMRVALDDLAILISSFFVDSDLVPSDVVAGLLL-------AY-------------------------------HSPNNQ--YPPVKDKEHES--------------VPKWMNLKDAEYFLHHATCVYGWPTYILYNCGLKSIYRLFRKLQC-------CGRMRCAQ--------GKSMVVEDNCCYCNTAAVVLANEARNIDLQFMSFRNRVYEVPFAVIADHDKKSIVITIRGSCSLIDLVTDLSLEDELMTVDVDQDATLREDEEIDKRGDVRVHRGMLRSARYVFDTLNKNKILNDLFISNPSYQLVVCGHSLGAGVGSLLTMLLKQEYPSVICYAFAPP 460          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Celegans
Match: dagl-2 (DiAcylGlycerol Lipase homolog [Source:UniProtKB/TrEMBL;Acc:Q65ZK3])

HSP 1 Score: 123.25 bits (308), Expect = 1.958e-28
Identity = 119/467 (25.48%), Postives = 201/467 (43.04%), Query Frame = 1
Query:  277 IMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRY-SLIPNKFCEQILIPNKIIL---YCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKKTNIWKHRLKWILCIKKVNDEE--RNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM-------------DANLIEVFE-DGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPP 1617
            ++SA+G IM    R  IP  +YI+L +   E  L+I+A    +   S    + C+   I    I+   + I       +I+F +T ++L    S    +A K    W  R++    I K+  +   R ALD  A + +S   +S+LV SD  AG+ L       AY                               H  NN+  Y  + + ++E                  W +++   YF   A   YGWP ++L++   KS  +    L C       C +  C           K + V++  C C+  A++        +L  +SF N+ +  PF +   H+ + I+++IRG+ SL D++TD+             DA L E  E D       H GML +A+ +   + +  I++++   N +Y+L++ GHSLGAG+  +L+     E+P++ CYAF+PP
Sbjct:   76 VISARGTIMNSQPRKLIPRLLYIRLPIFIAEIALTILATIHAFILESTNGGEGCDFATIARVTIILEWFLIFTAFAGLVIVFHLTENELEDSAS----IAQKS---WSRRMR----IFKIGQDHSMRVALDDLAILISSFFVDSDLVPSDVVAGLLL-------AY-------------------------------HSPNNQ--YPPVKDKEHES--------------VPKWMNLKDAEYFLHHATCVYGWPTYILYNCGLKSIYRLFRKLQC-------CGRMRCAQ--------GKSMVVEDNCCYCNTAAVVLANEARNIDLQFMSFRNRVYEVPFAVIADHDKKSIVITIRGSCSLIDLVTDLSLEDELMTVDVDQDATLREDEEIDKRGDVRVHRGMLRSARYVFDTLNKNKILNDLFISNPSYQLVVCGHSLGAGVGSLLTMLLKQEYPSVICYAFAPP 462          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Fly
Match: inaE (gene:FBgn0261244 transcript:FBtr0073826)

HSP 1 Score: 138.272 bits (347), Expect = 3.497e-33
Identity = 96/353 (27.20%), Postives = 164/353 (46.46%), Query Frame = 1
Query:  583 WKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDA-NLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKN-----YRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            W HR + + C    ++  RN+    A + +    E ++V SD  AG+ LL K     +   E    + + K+G     S            +N+ +NY    +F   V                    I ++Y+    A+ +YGWP++++    N+S++   +             KC  C C  S+  +     +++  C C+  A+     L   ++V  +++     +PFF+AI +    +++SIRGT S+KDILTD++A   +   +     +L H GM+ AA  I+ K+QEEN+I   L  N +     + L++ GHSLGAG A IL+     E P L+C+++SPP G
Sbjct:  206 WDHRCRLLFCCMGSSERNRNSFTDIARLLSDFFRELDVVPSDVVAGLVLLRK-----FQRLEREAIVRQRKNGTYEFLSGVPITERTQFLALNDAKNY----DFFQTV--------------------IHYMYF----AQGAYGWPMYVII---NRSKMWHLVPEL----------KCFGCCCGTSDDTE----VIQDNCCLCNYAALKKTLQLGDIDIVYATYHVDVGETPFFVAIDYTHRAVVISIRGTLSMKDILTDLNAEGEVLPLQPPRDDWLGHKGMVQAAIYIRNKLQEENLIERALQRNPDRQTHTFDLVLVGHSLGAGTAAILAILLKPEHPTLQCFSYSPPGG 508          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Fly
Match: inaE (gene:FBgn0261244 transcript:FBtr0340291)

HSP 1 Score: 138.658 bits (348), Expect = 4.565e-33
Identity = 96/353 (27.20%), Postives = 164/353 (46.46%), Query Frame = 1
Query:  583 WKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDA-NLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKN-----YRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            W HR + + C    ++  RN+    A + +    E ++V SD  AG+ LL K     +   E    + + K+G     S            +N+ +NY    +F   V                    I ++Y+    A+ +YGWP++++    N+S++   +             KC  C C  S+  +     +++  C C+  A+     L   ++V  +++     +PFF+AI +    +++SIRGT S+KDILTD++A   +   +     +L H GM+ AA  I+ K+QEEN+I   L  N +     + L++ GHSLGAG A IL+     E P L+C+++SPP G
Sbjct:  206 WDHRCRLLFCCMGSSERNRNSFTDIARLLSDFFRELDVVPSDVVAGLVLLRK-----FQRLEREAIVRQRKNGTYEFLSGVPITERTQFLALNDAKNY----DFFQTV--------------------IHYMYF----AQGAYGWPMYVII---NRSKMWHLVPEL----------KCFGCCCGTSDDTE----VIQDNCCLCNYAALKKTLQLGDIDIVYATYHVDVGETPFFVAIDYTHRAVVISIRGTLSMKDILTDLNAEGEVLPLQPPRDDWLGHKGMVQAAIYIRNKLQEENLIERALQRNPDRQTHTFDLVLVGHSLGAGTAAILAILLKPEHPTLQCFSYSPPGG 508          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Fly
Match: inaE (gene:FBgn0261244 transcript:FBtr0073825)

HSP 1 Score: 138.272 bits (347), Expect = 5.427e-33
Identity = 96/353 (27.20%), Postives = 164/353 (46.46%), Query Frame = 1
Query:  583 WKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDA-NLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKN-----YRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            W HR + + C    ++  RN+    A + +    E ++V SD  AG+ LL K     +   E    + + K+G     S            +N+ +NY    +F   V                    I ++Y+    A+ +YGWP++++    N+S++   +             KC  C C  S+  +     +++  C C+  A+     L   ++V  +++     +PFF+AI +    +++SIRGT S+KDILTD++A   +   +     +L H GM+ AA  I+ K+QEEN+I   L  N +     + L++ GHSLGAG A IL+     E P L+C+++SPP G
Sbjct:  206 WDHRCRLLFCCMGSSERNRNSFTDIARLLSDFFRELDVVPSDVVAGLVLLRK-----FQRLEREAIVRQRKNGTYEFLSGVPITERTQFLALNDAKNY----DFFQTV--------------------IHYMYF----AQGAYGWPMYVII---NRSKMWHLVPEL----------KCFGCCCGTSDDTE----VIQDNCCLCNYAALKKTLQLGDIDIVYATYHVDVGETPFFVAIDYTHRAVVISIRGTLSMKDILTDLNAEGEVLPLQPPRDDWLGHKGMVQAAIYIRNKLQEENLIERALQRNPDRQTHTFDLVLVGHSLGAGTAAILAILLKPEHPTLQCFSYSPPGG 508          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Fly
Match: inaE (gene:FBgn0261244 transcript:FBtr0290303)

HSP 1 Score: 138.658 bits (348), Expect = 6.094e-33
Identity = 98/359 (27.30%), Postives = 165/359 (45.96%), Query Frame = 1
Query:  583 WKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKF------CMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDA-NLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKN-----YRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            W HR + + C    ++  RN+    A + +    E ++V SD  AG+ LL K     +   E    + + K+G     S            +N+ +NY    +F   V                    I ++Y+    A+ +YGWP++++    N+S++        C G CC                    S+D ++I  ++  C C+  A+     L   ++V  +++     +PFF+AI +    +++SIRGT S+KDILTD++A   +   +     +L H GM+ AA  I+ K+QEEN+I   L  N +     + L++ GHSLGAG A IL+     E P L+C+++SPP G
Sbjct:  206 WDHRCRLLFCCMGSSERNRNSFTDIARLLSDFFRELDVVPSDVVAGLVLLRK-----FQRLEREAIVRQRKNGTYEFLSGVPITERTQFLALNDAKNY----DFFQTV--------------------IHYMYF----AQGAYGWPMYVII---NRSKMWHLVPELKCFGCCC------------------GTSDDTEVI--QDNCCLCNYAALKKTLQLGDIDIVYATYHVDVGETPFFVAIDYTHRAVVISIRGTLSMKDILTDLNAEGEVLPLQPPRDDWLGHKGMVQAAIYIRNKLQEENLIERALQRNPDRQTHTFDLVLVGHSLGAGTAAILAILLKPEHPTLQCFSYSPPGG 508          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Fly
Match: inaE (gene:FBgn0261244 transcript:FBtr0340290)

HSP 1 Score: 137.887 bits (346), Expect = 1.934e-32
Identity = 98/353 (27.76%), Postives = 166/353 (47.03%), Query Frame = 1
Query:  583 WKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDA-NLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKN-----YRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            W HR + + C    ++  RN+    A + +    E ++V SD  AG+ LL K     +   E    + + K+G     S            +N+ +NY    +F   V                    I ++Y+    A+ +YGWP++++    N+S++   +             KC  C C    S+D ++I  ++  C C+  A+     L   ++V  +++     +PFF+AI +    +++SIRGT S+KDILTD++A   +   +     +L H GM+ AA  I+ K+QEEN+I   L  N +     + L++ GHSLGAG A IL+     E P L+C+++SPP G
Sbjct:  206 WDHRCRLLFCCMGSSERNRNSFTDIARLLSDFFRELDVVPSDVVAGLVLLRK-----FQRLEREAIVRQRKNGTYEFLSGVPITERTQFLALNDAKNY----DFFQTV--------------------IHYMYF----AQGAYGWPMYVII---NRSKMWHLVPEL----------KCFGCCC--GTSDDTEVI--QDNCCLCNYAALKKTLQLGDIDIVYATYHVDVGETPFFVAIDYTHRAVVISIRGTLSMKDILTDLNAEGEVLPLQPPRDDWLGHKGMVQAAIYIRNKLQEENLIERALQRNPDRQTHTFDLVLVGHSLGAGTAAILAILLKPEHPTLQCFSYSPPGG 508          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Zebrafish
Match: daglb (diacylglycerol lipase, beta [Source:ZFIN;Acc:ZDB-GENE-070619-2])

HSP 1 Score: 160.999 bits (406), Expect = 9.852e-45
Identity = 121/479 (25.26%), Postives = 210/479 (43.84%), Query Frame = 1
Query:  259 TISTIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYE---AILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFC------ITYDQLGRHGSDVIL--------------LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSGY-LAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            T+  I+ +SAQG IM +  R  +P  +Y++  + F E   A L  V  + N       +  C+    P ++    IG  +++++I+        + +D LG  G    L                +  + +W++RL+ + C    +D  R A  S A + +    +++LV SD  AG+ LL                                          + E++ +      +EV L    S+  + DL+   +++    ++   A A+YGWP+++  +              CK S  C              S   +   V      CH  +IL  T L+  + + +SF+N+ +  PFF+A+ H+ E +++++RGT SLKD+LTD+ A    +  +G SG   AH G+  AA  I +++  + I+    +    Y+L++TGHSLGAG A +L+   +   P L+CYAFSPP G
Sbjct:   72 TLCAIVYVSAQGTIMNQGPRRSMPLLVYLRAVLYFPEFVWACLGAVWVSDN-------SSGCQ----PEEVG-AVIGAVVSSWVILLAMAVGVLVVFDPLGSPGPSRGLRDLQSSESSQLFSSAQSVASRVWENRLRLLCCCLPQDDNHRAAFSSIAQLVSGFFMDTDLVPSDIAAGLALL------------------------------------------HQEQDKMEQCRDPDEV-LTHSPSSPIREDLE---QELEKSAHYMQFAAAAYGWPLYVYSNPLTG---------VCKLSGDC------------CGSRHAEYDLVGGDALGCHFTSILQSTGLQYRDFIHISFHNQIYEVPFFVALDHKREAVLVAVRGTLSLKDVLTDLSAECENLSVEGVSGSCYAHKGISQAAHFIYKRLVHDGILSQAFSIAPEYKLVVTGHSLGAGTASLLAVLLHSSQPTLECYAFSPPGG 471          

HSP 2 Score: 41.2022 bits (95), Expect = 9.852e-45
Identity = 19/42 (45.24%), Postives = 26/42 (61.90%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLF--IIVAYVYFN 223
            MP L++FGR+W IA+DD V+   +E  IR    I+   VY N
Sbjct:    1 MPGLLVFGRRWRIASDDLVFPGAFELFIRAVWWIVTLVVYTN 42          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Zebrafish
Match: dagla (diacylglycerol lipase, alpha [Source:ZFIN;Acc:ZDB-GENE-070619-1])

HSP 1 Score: 164.466 bits (415), Expect = 4.723e-44
Identity = 131/488 (26.84%), Postives = 227/488 (46.52%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCI------TYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKE-RFCSCHEKAILNE---THLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM--DANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            S IM +S +G I+    R  + + +YI+L +   E + ++V  A   +Y     + C  I   N      +G     +L+IF +      T+D  GR  + V L AT++                   + W  RLK+ +C  +  D + +A    A++FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+++   KN   +A                  + + Y+   A A+YGWP++LL       R   C GLC +  ++C CN  +      S S   + + V+E   C C+  AI  +     L++  +V  S ++  + +PFF+A+ H  + +++SIRGT S KD LTD+  D+  + V E+    +L H GM+ +A+ IK+K+++E I+      ++     +Y L+I GHSLGAG A ILS     ++P+L+CY++SPP G
Sbjct:   74 SAIMWLSMRGSILYTQPREAVQYVLYIRLAILLVELVYAVVGIAWLVQY----YQPCPDITAKN----LALGIVACNWLVIFSVCFTMMCTFDPTGR--TFVKLKATRRRQRNLTTYTLRHRLEEGQASSWSRRLKFFMCCTRAKDTQSDAYSEVASLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRSAILDQANNDVLAFLSGMPVTRNTKYLDL---KNSTEMAM----------------YKEVCYYMLFAMAAYGWPVYLL-------RKPAC-GLC-RLVSTCSCNTSV------SGSRLSQSVTVEEDNCCGCNVLAIRRQFLDRDLKEVQIVYTSCHDAVYETPFFVAVDHAKKKVVISIRGTLSPKDALTDLTGDSERLPV-EEQHGTWLGHKGMVYSAEYIKKKLEQEMILSQAFGRDLSKGTMHYGLVIVGHSLGAGTAAILSFLLRPQYPSLQCYSYSPPGG 502          

HSP 2 Score: 35.4242 bits (80), Expect = 4.723e-44
Identity = 14/55 (25.45%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  +F+ F++     ++++ V F    +   +C+  L
Sbjct:    1 MPGMVLFRRRWSVGSDDLVLPAFFLFVLHCIWLVVLSVVLFGLPYSSEQSCSVTL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Zebrafish
Match: dagla (diacylglycerol lipase, alpha [Source:ZFIN;Acc:ZDB-GENE-070619-1])

HSP 1 Score: 164.466 bits (415), Expect = 4.723e-44
Identity = 131/488 (26.84%), Postives = 227/488 (46.52%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCI------TYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKE-RFCSCHEKAILNE---THLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM--DANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            S IM +S +G I+    R  + + +YI+L +   E + ++V  A   +Y     + C  I   N      +G     +L+IF +      T+D  GR  + V L AT++                   + W  RLK+ +C  +  D + +A    A++FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+++   KN   +A                  + + Y+   A A+YGWP++LL       R   C GLC +  ++C CN  +      S S   + + V+E   C C+  AI  +     L++  +V  S ++  + +PFF+A+ H  + +++SIRGT S KD LTD+  D+  + V E+    +L H GM+ +A+ IK+K+++E I+      ++     +Y L+I GHSLGAG A ILS     ++P+L+CY++SPP G
Sbjct:   74 SAIMWLSMRGSILYTQPREAVQYVLYIRLAILLVELVYAVVGIAWLVQY----YQPCPDITAKN----LALGIVACNWLVIFSVCFTMMCTFDPTGR--TFVKLKATRRRQRNLTTYTLRHRLEEGQASSWSRRLKFFMCCTRAKDTQSDAYSEVASLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRSAILDQANNDVLAFLSGMPVTRNTKYLDL---KNSTEMAM----------------YKEVCYYMLFAMAAYGWPVYLL-------RKPAC-GLC-RLVSTCSCNTSV------SGSRLSQSVTVEEDNCCGCNVLAIRRQFLDRDLKEVQIVYTSCHDAVYETPFFVAVDHAKKKVVISIRGTLSPKDALTDLTGDSERLPV-EEQHGTWLGHKGMVYSAEYIKKKLEQEMILSQAFGRDLSKGTMHYGLVIVGHSLGAGTAAILSFLLRPQYPSLQCYSYSPPGG 502          

HSP 2 Score: 35.4242 bits (80), Expect = 4.723e-44
Identity = 14/55 (25.45%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  +F+ F++     ++++ V F    +   +C+  L
Sbjct:    1 MPGMVLFRRRWSVGSDDLVLPAFFLFVLHCIWLVVLSVVLFGLPYSSEQSCSVTL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Zebrafish
Match: BX248389.1 (diacylglycerol lipase, alpha [Source:NCBI gene;Acc:569398])

HSP 1 Score: 159.844 bits (403), Expect = 1.210e-42
Identity = 126/487 (25.87%), Postives = 219/487 (44.97%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCI------TYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNE---THLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM--DANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            S IM +S +G I+    R  + + +YI+L +   E + ++V  A   +Y     + C  I   N      +G     +L+IF +      T+D  GR  + V L AT++                   + W  RLK+ +C  +  D + +A    A++FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+++   KN   +A                  + + Y+   A A+YGWP++LL     K     C  L C            C  C   +   Q +   ++  C C+  AI  +     L++  +V  S ++  + +PFF+A+ H  + +++SIRGT S KD LTD+  D+  + V E+    +L H GM+ +A+ IK+K+++E I+      ++     +Y L+I GHSLGAG A ILS     ++P+L+CY++SPP G
Sbjct:   74 SAIMWLSMRGSILYTQPREAVQYVLYIRLAILLVELVYAVVGIAWLVQY----YQPCPDITAKN----LALGIVACNWLVIFSVCFTMMCTFDPTGR--TFVKLKATRRRQRNLTTYTLRHRLEEGQASSWSRRLKFFMCCTRAKDTQSDAYSEVASLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRSAILDQANNDVLAFLSGMPVTRNTKYLDL---KNSTEMAM----------------YKEVCYYMLFAMAAYGWPVYLL----RKPACGLCRLLRC------------CSACLYVSRLSQSVTVEEDNCCGCNVLAIRRQFLDRDLKEVQIVYTSCHDAVYETPFFVAVDHAKKKVVISIRGTLSPKDALTDLTGDSERLPV-EEQHGTWLGHKGMVYSAEYIKKKLEQEMILSQAFGRDLSKGTMHYGLVIVGHSLGAGTAAILSFLLRPQYPSLQCYSYSPPGG 500          

HSP 2 Score: 35.4242 bits (80), Expect = 1.210e-42
Identity = 14/55 (25.45%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  +F+ F++     ++++ V F    +   +C+  L
Sbjct:    1 MPGMVLFRRRWSVGSDDLVLPAFFLFVLHCIWLVVLSVVLFGLPYSSEQSCSVTL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Zebrafish
Match: dagla (diacylglycerol lipase, alpha [Source:ZFIN;Acc:ZDB-GENE-070619-1])

HSP 1 Score: 158.688 bits (400), Expect = 2.342e-42
Identity = 133/499 (26.65%), Postives = 233/499 (46.69%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCI------TYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKIS-------TGNKSD----LKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKE-RFCSCHEKAILNE---THLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM--DANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            S IM +S +G I+    R  + + +YI+L +   E + ++V  A   +Y     + C  I   N      +G     +L+IF +      T+D  GR  + V L AT++                   + W  RLK+ +C  +  D + +A    A++FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+++ N     ++ D  S        G        L+++    + + Y+   A A+YGWP++LL       R   C GLC +  ++C CN  +      S S   + + V+E   C C+  AI  +     L++  +V  S ++  + +PFF+A+ H  + +++SIRGT S KD LTD+  D+  + V E+    +L H GM+ +A+ IK+K+++E I+      ++     +Y L+I GHSLGAG A ILS     ++P+L+CY++SPP G
Sbjct:   74 SAIMWLSMRGSILYTQPREAVQYVLYIRLAILLVELVYAVVGIAWLVQY----YQPCPDITAKN----LALGIVACNWLVIFSVCFTMMCTFDPTGR--TFVKLKATRRRQRNLTTYTLRHRLEEGQASSWSRRLKFFMCCTRAKDTQSDAYSEVASLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRSAILDQANNDVLAFLSGMPVTRNTKYLDLKN-----SVFDDCSICVFCFCMGLFMIVCFCLQTEMAMYKEVCYYMLFAMAAYGWPVYLL-------RKPAC-GLC-RLVSTCSCNTSV------SGSRLSQSVTVEEDNCCGCNVLAIRRQFLDRDLKEVQIVYTSCHDAVYETPFFVAVDHAKKKVVISIRGTLSPKDALTDLTGDSERLPV-EEQHGTWLGHKGMVYSAEYIKKKLEQEMILSQAFGRDLSKGTMHYGLVIVGHSLGAGTAAILSFLLRPQYPSLQCYSYSPPGG 527          

HSP 2 Score: 35.4242 bits (80), Expect = 2.342e-42
Identity = 14/55 (25.45%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  +F+ F++     ++++ V F    +   +C+  L
Sbjct:    1 MPGMVLFRRRWSVGSDDLVLPAFFLFVLHCIWLVVLSVVLFGLPYSSEQSCSVTL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Xenopus
Match: cxxc4 (CXXC finger protein 4 [Source:Xenbase;Acc:XB-GENE-479477])

HSP 1 Score: 147.517 bits (371), Expect = 6.020e-39
Identity = 122/497 (24.55%), Postives = 215/497 (43.26%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKL---FMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIF--CIT----YDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDE------------NKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
             I+ +S +G I+    R  + + +Y++L    + F  AI+ IV  A  Y         C  +   N      +G  +  +++I   CIT    +D  GR  + V L ATK+                   + W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +  +  Y+++ N +                   + +  + + Y+   A A+YGWP++L+ +                +R +F  G+  +    C CN        K +  D+ +  V   + SCH                     +  + +PFF+A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P+LKC+A+SPP G
Sbjct:   75 AIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLAQYY-------TSCNDVTAKN----VTLGMVVCNWVVILSVCITVLCVFDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQASSWTRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRKTKYLDLKNAQ-------------------EMQRYKEVCYYMLFALAAYGWPMYLIRNPTCGICRLAGAFTIVSARPRFAPGVTIEEDNCCGCNAIAI----KRHFLDENMNMVDIVYTSCH---------------------DAVYETPFFVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLARGTKHYELIVVGHSLGAGTAAILSFLLRPQYPSLKCFAYSPPGG 500          

HSP 2 Score: 35.8094 bits (81), Expect = 6.020e-39
Identity = 16/55 (29.09%), Postives = 30/55 (54.55%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIR--LFIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V    + F++    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVFRRRWSVGSDDLVLPGIFLFVLHSTWFVILSVVLFGLTYNPHETCSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Xenopus
Match: cxxc4 (CXXC finger protein 4 [Source:Xenbase;Acc:XB-GENE-479477])

HSP 1 Score: 146.362 bits (368), Expect = 1.544e-38
Identity = 122/501 (24.35%), Postives = 215/501 (42.91%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKL---FMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIF--CIT----YDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDE----------------NKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
             I+ +S +G I+    R  + + +Y++L    + F  AI+ IV  A  Y         C  +   N      +G  +  +++I   CIT    +D  GR  + V L ATK+                   + W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +  +  Y+++ N +                   + +  + + Y+   A A+YGWP++L+ +                    +R +F  G+  +    C CN        K +  D+ +  V   + SCH                     +  + +PFF+A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P+LKC+A+SPP G
Sbjct:   75 AIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLAQYY-------TSCNDVTAKN----VTLGMVVCNWVVILSVCITVLCVFDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQASSWTRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRKTKYLDLKNAQ-------------------EMQRYKEVCYYMLFALAAYGWPMYLIRNPTCGICRLAGACSSCCCLCSARPRFAPGVTIEEDNCCGCNAIAI----KRHFLDENMNMVDIVYTSCH---------------------DAVYETPFFVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLARGTKHYELIVVGHSLGAGTAAILSFLLRPQYPSLKCFAYSPPGG 504          

HSP 2 Score: 35.8094 bits (81), Expect = 1.544e-38
Identity = 16/55 (29.09%), Postives = 30/55 (54.55%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIR--LFIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V    + F++    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVFRRRWSVGSDDLVLPGIFLFVLHSTWFVILSVVLFGLTYNPHETCSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Xenopus
Match: cxxc4 (CXXC finger protein 4 [Source:Xenbase;Acc:XB-GENE-479477])

HSP 1 Score: 146.747 bits (369), Expect = 1.513e-36
Identity = 123/501 (24.55%), Postives = 219/501 (43.71%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKL---FMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIF--CIT----YDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDE----------------NKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
             I+ +S +G I+    R  + + +Y++L    + F  AI+ IV  A  Y         C  +   N      +G  +  +++I   CIT    +D  GR  + V L ATK+                   + W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +  +  Y+++ N +                   + +  + + Y+   A A+YGWP++L+ +                    +R +F  G+  +    C CN                 I +K  F        L+E ++   ++V  S ++  + +PFF+A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P+LKC+A+SPP G
Sbjct:   75 AIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIMGIVWLAQYY-------TSCNDVTAKN----VTLGMVVCNWVVILSVCITVLCVFDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQASSWTRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRKTKYLDLKNAQ-------------------EMQRYKEVCYYMLFALAAYGWPMYLIRNPTCGICRLAGACSSCCCLCSARPRFAPGVTIEEDNCCGCNA----------------IAIKRHF--------LDE-NMNMVDIVYTSCHDAVYETPFFVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLARGTKHYELIVVGHSLGAGTAAILSFLLRPQYPSLKCFAYSPPGG 504          

HSP 2 Score: 28.4906 bits (62), Expect = 1.513e-36
Identity = 14/55 (25.45%), Postives = 28/55 (50.91%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIR--LFIIVAYVYFNFHENMINNCNSKL 262
            MP +++   +W++ +DD V    + F++    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVCRCRWSVGSDDLVLPGIFLFVLHSTWFVILSVVLFGLTYNPHETCSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Xenopus
Match: cxxc4 (CXXC finger protein 4 [Source:Xenbase;Acc:XB-GENE-479477])

HSP 1 Score: 145.976 bits (367), Expect = 2.403e-36
Identity = 123/501 (24.55%), Postives = 219/501 (43.71%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKL---FMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIF--CIT----YDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDE----------------NKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
             I+ +S +G I+    R  + + +Y++L    + F  AI+ IV  A  Y         C  +   N      +G  +  +++I   CIT    +D  GR  + V L ATK+                   + W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +  +  Y+++ N +                   + +  + + Y+   A A+YGWP++L+ +                    +R +F  G+  +    C CN                 I +K  F        L+E ++   ++V  S ++  + +PFF+A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P+LKC+A+SPP G
Sbjct:   75 AIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLAQYY-------TSCNDVTAKN----VTLGMVVCNWVVILSVCITVLCVFDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQASSWTRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRKTKYLDLKNAQ-------------------EMQRYKEVCYYMLFALAAYGWPMYLIRNPTCGICRLAGACSSCCCLCSARPRFAPGVTIEEDNCCGCNA----------------IAIKRHF--------LDE-NMNMVDIVYTSCHDAVYETPFFVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLARGTKHYELIVVGHSLGAGTAAILSFLLRPQYPSLKCFAYSPPGG 504          

HSP 2 Score: 28.4906 bits (62), Expect = 2.403e-36
Identity = 14/55 (25.45%), Postives = 28/55 (50.91%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIR--LFIIVAYVYFNFHENMINNCNSKL 262
            MP +++   +W++ +DD V    + F++    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVCRCRWSVGSDDLVLPGIFLFVLHSTWFVILSVVLFGLTYNPHETCSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Xenopus
Match: polr3c (polymerase (RNA) III (DNA directed) polypeptide C (62kD) [Source:Xenbase;Acc:XB-GENE-993197])

HSP 1 Score: 140.584 bits (353), Expect = 1.193e-33
Identity = 101/353 (28.61%), Postives = 165/353 (46.74%), Query Frame = 1
Query:  565 TKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            T  T +W++R++ + C    ++E R A  S A + +S   +++LV SD  AG+ LL                                          + E++ V++S    EV       T N  D  S   ++    ++   A A+YGWP+++  +           GLC     SC             N   Q  I   +   +CH  +IL  T L+  + + +SF+N+ +  PFF+A+ H+ E I++++RGT SL+D+LTD+ A+   +  +G +G  AH G+  AA  I R++  + I++        Y+L++ GHSLGAG A +L+    + FP LKCYAFSPP G
Sbjct:  154 TASTRVWENRIRLLCCCIGKDNENRVAFSSIAKLLSSYFSDTDLVPSDIAAGLTLL------------------------------------------HQEQDKVDLSRDPEEVLCHSP--TQNPGD--SLEMELDKAAHYMQFAAAAYGWPLYVYSNP--------LTGLCKLCGESC------------QNRASQNGIVGGDNL-NCHFGSILQTTGLQDRDFIYISFHNRIYEIPFFVALDHKTESILVAVRGTLSLEDVLTDLSADCENLHIEGVTGSYAHKGITQAASYIYRRLINDGILNQAFTTAPEYKLVVVGHSLGAGAAAVLAIMLRNSFPTLKCYAFSPPGG 439          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Mouse
Match: Dagla (diacylglycerol lipase, alpha [Source:MGI Symbol;Acc:MGI:2677061])

HSP 1 Score: 156.377 bits (394), Expect = 6.056e-42
Identity = 125/487 (25.67%), Postives = 215/487 (44.15%), Query Frame = 1
Query:  271 IMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRY-----SLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRF--IYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCV-----SFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            I+ +S +G I+    R  + + +Y++L +   E I +IV      +Y      L        +++ N +++      L+  + + C+ +D  GR  + V L ATK+                     W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+                     DLK+    +R+  + Y+   A A+YGWP++L+       R   C GLC           C CC C         +   ++  C C+  AI    H   EN+  V     S ++  + +PF++A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P LKC+A+SPP G
Sbjct:   76 IIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVTLGMVVCNWVVI------LSVCITVLCV-FDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRNTKYL---------------------DLKNSHEMLRYKEVCYYMLFALAAYGWPMYLM-------RKPTC-GLCQ------LARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAI--RRHFLDENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHRGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAILSFLLRPQYPTLKCFAYSPPGG 502          

HSP 2 Score: 36.5798 bits (83), Expect = 6.056e-42
Identity = 17/55 (30.91%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  + + FL+    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Mouse
Match: Daglb (diacylglycerol lipase, beta [Source:MGI Symbol;Acc:MGI:2442032])

HSP 1 Score: 122.865 bits (307), Expect = 4.238e-28
Identity = 94/364 (25.82%), Postives = 161/364 (44.23%), Query Frame = 1
Query:  559 LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDG--FSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLGTVKYENY 1644
            L T   ++W+ R+++  C    +D  R A  S A++F++   +++LV SD  AG  LL +Q  N                               I+H     E   +      E  L  ++                  +++   A A+YGWP+++        R  F  GLC            I  DC ++   +   +   +   +CH  +IL  T L+  + + +SF++K +  PF + + H  E +++++RGT SL+D+LTD+ A   E  E G      +AH G+  AA+ I R++  + I+    +    Y+L++ GHSLGAG A +L+      +P ++ YAFSPP G +    Y
Sbjct:  185 LKTAAKSVWETRVQFCCCCVGQDDNTRVAFSSTADLFSTYFSDTDLVPSDIAAGFTLLHQQQDN-------------------------------ISHSREPPEVVTHTPGQPQETELDAEVEN---------------CHHYMPFAAAAYGWPLYIY-------RNPF-TGLCR-----------IGGDCCRARDIEYDAVEGDQH--NCHFASILKTTGLQYRDFIHISFHDKVYELPFIVVLDHRKESVVVAVRGTMSLQDVLTDLSAE-SETLELGIELQDCVAHKGIAQAARYIHRRLVNDGILSQAFSVAPEYQLVLVGHSLGAGAAALLAIMLRGAYPQVRAYAFSPPRGLLSKSLY 480          
BLAST of sn1-specific diacylglycerol lipase beta vs. UniProt/SwissProt
Match: sp|Q6WQJ1|DGLA_MOUSE (Sn1-specific diacylglycerol lipase alpha OS=Mus musculus OX=10090 GN=Dagla PE=1 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 3.716e-41
Identity = 125/487 (25.67%), Postives = 215/487 (44.15%), Query Frame = 1
Query:  271 IMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRY-----SLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRF--IYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCV-----SFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            I+ +S +G I+    R  + + +Y++L +   E I +IV      +Y      L        +++ N +++      L+  + + C+ +D  GR  + V L ATK+                     W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+                     DLK+    +R+  + Y+   A A+YGWP++L+       R   C GLC           C CC C         +   ++  C C+  AI    H   EN+  V     S ++  + +PF++A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P LKC+A+SPP G
Sbjct:   76 IIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVTLGMVVCNWVVI------LSVCITVLCV-FDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRNTKYL---------------------DLKNSHEMLRYKEVCYYMLFALAAYGWPMYLM-------RKPTC-GLCQ------LARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAI--RRHFLDENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHRGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAILSFLLRPQYPTLKCFAYSPPGG 502          

HSP 2 Score: 36.5798 bits (83), Expect = 3.716e-41
Identity = 17/55 (30.91%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  + + FL+    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. UniProt/SwissProt
Match: sp|Q9Y4D2|DGLA_HUMAN (Sn1-specific diacylglycerol lipase alpha OS=Homo sapiens OX=9606 GN=DAGLA PE=1 SV=3)

HSP 1 Score: 156.377 bits (394), Expect = 3.873e-41
Identity = 122/486 (25.10%), Postives = 214/486 (44.03%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRY-----SLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCV-----SFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
             I+ +S +G I+    R  + + +Y++L +   E I +IV      +Y      L        +++ N +++      L+  + + C+ +D  GR  + V L ATK+                     W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+++ N +  +   +                   + Y+   A A+YGWP++L+       R   C GLC           C CC C         +   ++  C C+  AI    H   EN+  V     S ++  + +PF++A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P LKC+A+SPP G
Sbjct:   75 AIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVTLGMVVCNWVVI------LSVCITVLCV-FDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKE-------------------VCYYMLFALAAYGWPMYLM-------RKPAC-GLCQ------LARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAI--RRHFLDENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAILSFLLRPQYPTLKCFAYSPPGG 502          

HSP 2 Score: 36.5798 bits (83), Expect = 3.873e-41
Identity = 17/55 (30.91%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  + + FL+    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. UniProt/SwissProt
Match: sp|Q5YLM1|DGLA_RAT (Sn1-specific diacylglycerol lipase alpha OS=Rattus norvegicus OX=10116 GN=Dagla PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 4.607e-41
Identity = 125/487 (25.67%), Postives = 215/487 (44.15%), Query Frame = 1
Query:  271 IMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRY-----SLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRF--IYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCV-----SFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSG-YLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            I+ +S +G I+    R  + + +Y++L +   E I +IV      +Y      L        +++ N +++      L+  + + C+ +D  GR  + V L ATK+                     W  RLK  LC  +  D + +A    A +FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+                     DLK+    +R+  + Y+   A A+YGWP++L+       R   C GLC           C CC C         +   ++  C C+  AI    H   EN+  V     S ++  + +PF++A+ H+ + +++SIRGT S KD LTD+  +   +  +G  G +L H GM+ +A+ IK+K+++E ++      ++    K+Y LI+ GHSLGAG A ILS     ++P LKC+A+SPP G
Sbjct:   76 IIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVTLGMVVCNWVVI------LSVCITVLCV-FDPTGR--TFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRNAVLDEANNDILAFLSGMPVTRNTKYL---------------------DLKNSHEMLRYKEVCYYMLFALAAYGWPMYLM-------RKPTC-GLCQ------LARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAI--RRHFLDENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHRGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAILSFLLRPQYPTLKCFAYSPPGG 502          

HSP 2 Score: 36.5798 bits (83), Expect = 4.607e-41
Identity = 17/55 (30.91%), Postives = 31/55 (56.36%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKL 262
            MP +++F R+W++ +DD V  + + FL+    F+I++ V F    N    C+  L
Sbjct:    1 MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNL 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. UniProt/SwissProt
Match: sp|Q8NCG7|DGLB_HUMAN (Sn1-specific diacylglycerol lipase beta OS=Homo sapiens OX=9606 GN=DAGLB PE=1 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 1.822e-36
Identity = 122/476 (25.63%), Postives = 220/476 (46.22%), Query Frame = 1
Query:  259 TISTIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFL--TAYLIIFCITYDQLG---------------RHGSDVIL--LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDAN--LIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            T+S IM +S +G I     R  +   +YI+L + F E + + +  A      +     C++ ++ N II   +  ++   A ++   I +D LG                H S  +L  L T  T++W+ R+K + C    +D  R A  S A +F++   +++LV SD  AG+ LL +Q  N  +                     NQ+   ++ H   + +                      ++DL ++  +    +++   A A+YGWP+++                  ++  +  C   I  DC +S + D  L+   +   +CH  +IL+ T L+  + + VSF++K +  PF +A+ H  E +++++RGT SL+D+LTD+ A   +++V E      LAH G+  AA+ + +++  + I+    +    YRL+I GHSLG G A +L+      +P ++CYAFSPP G
Sbjct:   72 TVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAW-----VADGVQCDRTVV-NGIIATVVVSWIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQLLNGLKTAATSVWETRIKLLCCCIGKDDHTRVAFSSTAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRN---------------------NQEPAQVVCHAPGSSQ----------------------EADLDAELENC---HHYMQFAAAAYGWPLYIY-----------------RNPLTGLCR--IGGDCCRSRTTDYDLVGGDQ--LNCHFGSILHTTGLQYRDFIHVSFHDKVYELPFLVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDV-ECEVQDRLAHKGISQAARYVYQRLINDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRG 473          
BLAST of sn1-specific diacylglycerol lipase beta vs. UniProt/SwissProt
Match: sp|Q91WC9|DGLB_MOUSE (Sn1-specific diacylglycerol lipase beta OS=Mus musculus OX=10090 GN=Daglb PE=1 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 2.964e-27
Identity = 94/364 (25.82%), Postives = 161/364 (44.23%), Query Frame = 1
Query:  559 LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDG--FSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLGTVKYENY 1644
            L T   ++W+ R+++  C    +D  R A  S A++F++   +++LV SD  AG  LL +Q  N                               I+H     E   +      E  L  ++                  +++   A A+YGWP+++        R  F  GLC            I  DC ++   +   +   +   +CH  +IL  T L+  + + +SF++K +  PF + + H  E +++++RGT SL+D+LTD+ A   E  E G      +AH G+  AA+ I R++  + I+    +    Y+L++ GHSLGAG A +L+      +P ++ YAFSPP G +    Y
Sbjct:  185 LKTAAKSVWETRVQFCCCCVGQDDNTRVAFSSTADLFSTYFSDTDLVPSDIAAGFTLLHQQQDN-------------------------------ISHSREPPEVVTHTPGQPQETELDAEVEN---------------CHHYMPFAAAAYGWPLYIY-------RNPF-TGLCR-----------IGGDCCRARDIEYDAVEGDQH--NCHFASILKTTGLQYRDFIHISFHDKVYELPFIVVLDHRKESVVVAVRGTMSLQDVLTDLSAE-SETLELGIELQDCVAHKGIAQAARYIHRRLVNDGILSQAFSVAPEYQLVLVGHSLGAGAAALLAIMLRGAYPQVRAYAFSPPRGLLSKSLY 480          
BLAST of sn1-specific diacylglycerol lipase beta vs. TrEMBL
Match: A0A3R7PXD3 (Lipase_3 domain-containing protein OS=Penaeus vannamei OX=6689 GN=C7M84_001160 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.792e-45
Identity = 115/361 (31.86%), Postives = 180/361 (49.86%), Query Frame = 1
Query:  559 LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFS-GYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLGTVKYE 1638
            L T    +W+ R +++ C+   ++    A  + A++FASL EES+LV SD  A + LL +      +  E +++ N     ++ SS+                    +I   ++E  L  + S       + +W  +   Y+F   A ASYGWP  +          +FC   CC       C    C +C    S D      K+  C C+  A+   T L++E++  ++F+NK +  PFF+AI  E E ++++IRGT SL+D +TD+     EV   G   G LAH GM++AAK ++RK++E   +   L     Y ++ITGHSLGAG A++L+     +FPNLKC+AFSPP G    E
Sbjct:  181 LGTHYIQLWEKRCRFLCCLTSRDENSSEAFKNVADVFASLFEESDLVASDVAAALVLL-RLKRKQEERQEEAIRKNNLHLPLSRSST-------------------ASIGALQSEGALPHQQSP------RPEWMKVGSAYHFMKFALASYGWPWFVYG--------RFCQA-CCSLWKHLHC----CANCRADPSLD-----AKDNCCLCNTAALKAITGLDQESISYITFHNKIYEVPFFVAIDDETEHVVVAIRGTLSLQDAITDLTCQCTEVEGAGLPEGCLAHKGMVHAAKFVQRKLEETRALREGLASRPGYGVVITGHSLGAGTAVVLAALMRPQFPNLKCFAFSPPGGLCSKE 497          
BLAST of sn1-specific diacylglycerol lipase beta vs. TrEMBL
Match: V9KEV6 (Sn1-specific diacylglycerol lipase beta OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 5.518e-45
Identity = 128/472 (27.12%), Postives = 203/472 (43.01%), Query Frame = 1
Query:  271 IMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAY-LIIFCITYDQLGRHG--------------SDVIL--LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCN---KCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFS-GYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            I+ +S QG I     R  IP  IYI+  +   E I  I+        SL     C   LI   I+   +   +  + L+   + +D LG+                SD +L    T    +W+HRLK + C    +DE R A  S   +F     +++LV SD  AG+ LL  Q+ +  + T     +  + +  T     + ++        +N  +Y+                                       A A+YGWPI++                   +  + FCN    C CC    + S+      V      CH  +++  T L+  + + +SF+NK +  PF++A+ H+ E +++++RGT SL+D+LTD+      +  DG S G  AH G+L+AA  I RK+  + I+         Y+L++TGHSLGAG A IL+   +  +P LKCYAFSPP G
Sbjct:   76 IVGVSMQGTITNPGPRRAIPTLIYIRAILYLPEVIWGILGIIWVSDESLD----CSSTLIVGVILAIVVSWIILFFTLVAVLVVFDPLGKPKKFEYYLNHNLESSESDQLLYKARTVAARVWEHRLKLLCCCIMQDDEVRTAFSSLGELFGGFFMDTDLVPSDIAAGLSLL-HQEQDKIEQTREPEVVCHNPAVATVPEELDMEL--------DNAAHYM-------------------------------------LFAVAAYGWPIYVF-----------------TNPLTGFCNLSRDCRCCISPAAESD-----IVGGDHLGCHLTSMIKITGLQYRDFIHISFHNKIYEIPFYVALDHKTEAVLVAVRGTLSLRDVLTDLSTECENLNIDGMSEGCFAHKGILHAASYIYRKLVTDGILSQAFVIAPEYKLVVTGHSLGAGAATILAIMLHKSYPGLKCYAFSPPGG 475          

HSP 2 Score: 40.4318 bits (93), Expect = 5.518e-45
Identity = 19/46 (41.30%), Postives = 30/46 (65.22%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHEN 235
            MP L++FGR+W +A+DD V+   +E LIR+  +I +   YF + E 
Sbjct:    1 MPGLVVFGRRWALASDDLVFPGAFELLIRVGWWIGILVFYFTYKEQ 46          
BLAST of sn1-specific diacylglycerol lipase beta vs. TrEMBL
Match: A0A4Y2H4V6 (Sn1-specific diacylglycerol lipase beta OS=Araneus ventricosus OX=182803 GN=DAGLB_0 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.801e-43
Identity = 128/485 (26.39%), Postives = 222/485 (45.77%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIP-NKFCE--QILIPNKIILYCIGPFLTAYLIIFCITYDQLGRH--------------GSDVILL------ATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLC--CKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFS-GYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLGTVKYEN 1641
            + I  +S++G + +   R  +   +Y++L +   EA+ +     I  +++  P +  CE  +++   ++I  C    L   ++   + +D +G +              G    L         K   IW+ +++   C    +++ RNA    + +     E+ ++V SD  AG+ LL ++       TE   +++ S+    +S +F+          + + ++  +    +  +  +  + T   +     W       +F   A+ SYGWP+ L              G+C   KH   C C    CC   K  S       V +  C CH  A+   T L  E+L+ VSF+N+ +  PFF+AI H+   +++SIRGT SL D LTDM A+  ++F DG S G   H GML AA  +K K++E + + +    +++Y L ITGHSLGAG A +L+      +PNL+CY+FSP  G +  E 
Sbjct:  119 ALIAWISSRGTVTQTRPRRHLCKILYLRLLVMIMEAVWN----GIGTKWAFTPTDHLCEPKEVVTLVQVIAVCSWIVLGIMILGIMLVFDPVGSYRNNGSGHRVADVERGEPQALYINLNRNPEKAKKIWEWQIRLFCCCCNQDEQSRNAYSDISKLLTYWFEDVDVVPSDIAAGLILLQQKQT-----TENGNRVSTSQ----HSENFS----------VQSPDSLTSTGAVQGSIISSPGVFTPPANQF---WMTPELACHFMKFAQGSYGWPLFLF--------TNMFTGMCQIWKHMRCCAC----CC---KPPS-----YIVDDNCCECHTAALKLVTGLSDEDLIFVSFHNRVYEIPFFVAIDHQTCSVVVSIRGTLSLSDTLTDMSADCDKLFTDGCSQGVFCHRGMLRAAFFVKNKLEESHALSDAFALHQSYSLAITGHSLGAGTAALLAVLLRPIYPNLRCYSFSPLGGLMSLEG 557          

HSP 2 Score: 40.0466 bits (92), Expect = 1.801e-43
Identity = 19/52 (36.54%), Postives = 32/52 (61.54%), Query Frame = 2
Query:   74 LKQRFFHYL*MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFN 223
            +KQ     L MP +++F R+W I +DDFV+ +  EF +RL  F++V  ++  
Sbjct:   36 VKQIKLGRLKMPGVVIFKRRWRIGSDDFVFPALIEFFLRLIWFVVVLVLFLK 87          
BLAST of sn1-specific diacylglycerol lipase beta vs. TrEMBL
Match: A0A369SEH2 (Sn1-specific diacylglycerol lipase alpha OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_002244 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 2.032e-43
Identity = 139/468 (29.70%), Postives = 223/468 (47.65%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFC--EQILIPNKIIL--YCIGPFLTAYLIIF--CITYDQLG---RHGS-DVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLGTVKYE 1638
            S   I+S++G I     R K+P  +Y++LF +  E  L+I    +   +S   ++ C  E I+I    ++  +C    L A+ IIF  C+ +D LG   R G+ D  +       +W+ R + + C  +VND  +      A IFA+    +N V +D  AG+ LL  Q    YD  +Y L    ++          QK +T            +++SN K+E N+   IS                  Y+   A A+YGWP+ +L H        F    C          K  CC C +   N   +I + +  C C+  A+  ++  + E+++  S+ N  +  PFF+A  H  + +IL+IRGT SL D +TD+ A   E+   G+     H GM  +AK +K K++ + ++    N++ +Y LII GHSLGAG+A ILS     ++P L+C+A+SPP G V +E
Sbjct:   74 SATWIISSRGTITNAKARQKMPLLLYLRLFFTIPEIALNI----LGTYWSFDDSRHCPDEDIIIVKVAVITNWC----LLAFGIIFTYCV-FDPLGSVKRDGNLDPSISYKLAQQVWETRCRHLCCCSRVNDSNQAIYTDLATIFATFFRNTNTVPTDVAAGLFLL--QQRQRYD-EKYILPWRGTQ--------VIQKQFT--------PARRMDLSN-KDEENILQDIS------------------YYIHYADAAYGWPLCVLQH--------FLTAPC------KLVPKYRCCSCARPLRNSGTII-INDNCCECNYAALKLQSGFDDEDIIVASYCNDLYELPFFVAYDHCKKKVILAIRGTMSLNDAITDLLAVPAELDIPGYHDTSGHKGMCESAKVLKEKLKSQKLLEPAFNEHPDYDLIIVGHSLGAGVAAILSILMKPDYPKLRCFAYSPPGGLVSFE 479          
BLAST of sn1-specific diacylglycerol lipase beta vs. TrEMBL
Match: A0A2D4H0D4 (Lipase_3 domain-containing protein OS=Micrurus corallinus OX=54390 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.178e-42
Identity = 136/482 (28.22%), Postives = 216/482 (44.81%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKF--CEQILI----PNKIILYCIGPFLTAYLIIFCITYDQLGRHG---------------SDVILLATKK--TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHD-ENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDAN-----LIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            S+I   S QG I     R  +P  +YI+L +   E + ++V          I +K   CE+ +I       I+ + I  F    + IF   +D LGR                 S+ +    KK  T +W+ R++ + C    ND+ R A  S A +F S   +++LV SD  AG+ LL +Q            K+  SK                                  +EV L    S    +DL+ +  +     ++   A A+YGWP ++L +      +L+   G CC+                  NS  Q  I +   + + H  +IL  T L+  + + +SF+NK F  PFF+A+ H+ E I++++RGT S +D+LTD+ A+     L +V E+G    L H G+  AA  I  ++  + I++  L+    Y+L++ GHSLG GIA IL+    + FPN++CYAFSPP G
Sbjct:   74 SSITYTSMQGTISNPGPRKSLPKLLYIRLALYVPELVWAVVGTV------WIADKQVNCERAMIDAIFGTVIVSWVIMVFTLVAVFIF---FDPLGRKTVYLTDYASRNLESSQSEQLFCNIKKRATRVWEKRIRLLCCCIMQNDDHRVAFTSIAELFRSYFSDTDLVPSDIAAGLTLLHQQQD----------KVENSKD--------------------------------PDEV-LIQPPSPPAGNDLEVELENAA---HYMKFAVAAYGWPYYVLMNPFTGLCKLR---GFCCR------------------NSAAQTEI-IGSDYLNMHFGSILQITGLQNRDFIHISFHNKIFEIPFFVALDHQKEAIVVAVRGTLSCEDVLTDLSADCESLTLEDVLENG----LVHKGITQAANYIYGRLINDGILNQALSIAPEYKLVVAGHSLGGGIASILAIMLRNSFPNMRCYAFSPPGG 474          

HSP 2 Score: 40.4318 bits (93), Expect = 3.178e-42
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL-FIIVAYVYFNFHENMIN 244
            MP L++FGR+W I +DDFV+   +E  IR+ + I   V ++ H+   N
Sbjct:    1 MPGLVLFGRRWTIGSDDFVFPGAFELFIRVTWWIGILVLYSIHKGQFN 48          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Cavefish
Match: dagla (diacylglycerol lipase alpha [Source:NCBI gene;Acc:103028196])

HSP 1 Score: 155.992 bits (393), Expect = 5.628e-38
Identity = 129/488 (26.43%), Postives = 222/488 (45.49%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCI------TYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKE-RFCSCHEKAILNE---THLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM--DANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            S IM +S +G I+    R  + + +YI+L +   E + ++V  A   +Y     + C      N      +G  +  +L+IF +      T+D  GR  + V L AT++                   + W  RL++ +C  +  D + +A    A++FA    + ++V SD  AG+ LL ++               ++K         N  +  +    +     Y+++   KN   +A                  + + Y+   A A+YGWP++LL       R   C GLC +  +SC C          S S   + + V+E   C C+  AI  +     L++  +V  S ++  + +PFF+A+ H  + +++SIRGT S KD LTD+  D+  + V E+    +L H GM+ +A+ IK+K+++E I+      ++     +Y L+I GHSLGAG A ILS     ++P L CY++SPP G
Sbjct:  101 SAIMWLSMRGSILYTQPREAVQYVLYIRLAILLVELVYAVVGIAWLVQY----YQPCSDDTAKN----LALGIVVCNWLVIFSVCFTMMCTFDPTGR--TFVKLKATRRRQRNLTTYTLRHRLEEGQASSWSRRLRFFMCCTRAQDSQSDAYSEVASLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRSAILDQPNNDILAFLSGMPVTRSTRYLDL---KNSTEMAM----------------YKEVCYYMLFAMAAYGWPMYLL-------RKPAC-GLC-RLLSSCTCTS-------GSGSRLSQSVTVEEDNCCGCNVLAIRRQFLDRDLKQVQIVYTSCHDAVYETPFFVAVDHGKKKVVISIRGTLSPKDALTDLTGDSERLPV-EEQHGVWLGHKGMVYSAEYIKKKLEQEMILSQAFGRDLSKGTMHYGLVIVGHSLGAGTAAILSFLLRPQYPTLHCYSYSPPGG 528          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Cavefish
Match: dagla (diacylglycerol lipase alpha [Source:NCBI gene;Acc:103028196])

HSP 1 Score: 142.124 bits (357), Expect = 1.078e-33
Identity = 102/366 (27.87%), Postives = 174/366 (47.54%), Query Frame = 1
Query:  559 LATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKE-RFCSCHEKAILNE---THLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM--DANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            L   + + W  RL++ +C  +  D + +A    A++FA    + ++V SD  AG+ LL ++               ++K         N  +  +    +     Y+++   KN   +A                  + + Y+   A A+YGWP++LL       R   C GLC +  +SC C          S S   + + V+E   C C+  AI  +     L++  +V  S ++  + +PFF+A+ H  + +++SIRGT S KD LTD+  D+  + V E+    +L H GM+ +A+ IK+K+++E I+      ++     +Y L+I GHSLGAG A ILS     ++P L CY++SPP G
Sbjct:  210 LEEGQASSWSRRLRFFMCCTRAQDSQSDAYSEVASLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRSAILDQPNNDILAFLSGMPVTRSTRYLDL---KNSTEMAM----------------YKEVCYYMLFAMAAYGWPMYLL-------RKPAC-GLC-RLLSSCTCTS-------GSGSRLSQSVTVEEDNCCGCNVLAIRRQFLDRDLKQVQIVYTSCHDAVYETPFFVAVDHGKKKVVISIRGTLSPKDALTDLTGDSERLPV-EEQHGVWLGHKGMVYSAEYIKKKLEQEMILSQAFGRDLSKGTMHYGLVIVGHSLGAGTAAILSFLLRPQYPTLHCYSYSPPGG 525          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Cavefish
Match: daglb (diacylglycerol lipase beta [Source:NCBI gene;Acc:103025334])

HSP 1 Score: 136.732 bits (343), Expect = 1.393e-32
Identity = 96/352 (27.27%), Postives = 159/352 (45.17%), Query Frame = 1
Query:  574 TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKC-ICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSGY-LAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
              +W+ RL+ + C    +D  R A  S A + +    +++LV SD  AG+ LL                                          + E++ V      ++V +    S+  + DL+ +         F   A A+YGWP+++                     ++ F   C +  DC ++   +  L  V      C+  +IL+ T L+  + + +SF+N+ +  PFF+A+ H+ E +++++RGT SLKD LTD+ A    +  +G SG   AH G+  AA  I +K+  + I+    +    YRL+ITGHSLGAG A +L+      +P L+CYAFSPP G
Sbjct:  194 VRVWESRLRLLCCCLPQDDNHRAAFSSIAQLVSGFFSDTDLVPSDIAAGLALL------------------------------------------HQEQDKVEQCKDPDDV-IPHSPSSPIREDLEIELEKAAHCMQF---AVAAYGWPLYVY--------------------SNPFTGLCKLSGDCCRNPRAEYDL--VGGDNLGCNFNSILHVTGLQYRDFIHISFHNQIYEIPFFVALDHKREAVLVAVRGTLSLKDALTDLSAECENLPVEGVSGACYAHKGISQAANYIYKKLVNDGILSQAFSIAPEYRLVITGHSLGAGTASLLAVLLRSTYPTLQCYAFSPPGG 477          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Sea Lamprey
Match: daglb (diacylglycerol lipase, beta [Source:ZFIN;Acc:ZDB-GENE-070619-2])

HSP 1 Score: 133.65 bits (335), Expect = 1.197e-32
Identity = 70/215 (32.56%), Postives = 120/215 (55.81%), Query Frame = 1
Query:  982 YFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSGY-LAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            +++  A A+YGWP+++L   +N        GL      S F       +C    S +  L+   +     +   +L  T L + +L+ VSF+N  +  PFF+A+ H+++ +++S+RGT SL+D+LTD+ A+   +  DG      AH GM+ AA  I +++  + I++      ++Y L++TGHS+G G+A++LS      +P L+CYAFSPP G
Sbjct:  205 HYAKFAWAAYGWPMYVL---QNP-----LSGL------SVFFE-----NCRGQQSAEYSLVGGGDGGDGRNIATVLRVTGLCRSDLIHVSFHNAVYQIPFFVALDHDMQAVVVSVRGTLSLRDVLTDLSADCESMQVDGLQQDCYAHKGMIQAATFIHQRLVNDGILNEAFQHAQDYHLVVTGHSMGGGVAVLLSILLRCAYPRLRCYAFSPPGG 400          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003941.1 (pep scaffold:Pmarinus_7.0:GL487229:269:2582:1 gene:ENSPMAG00000003605.1 transcript:ENSPMAT00000003941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 6.004e-10
Identity = 23/42 (54.76%), Postives = 31/42 (73.81%), Query Frame = 1
Query: 1498 NKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
             + YR+++TGHSLGAG A IL+      +P+L+CYAFSPP G
Sbjct:    2 GQEYRVVVTGHSLGAGTAAILALLLKPSYPSLRCYAFSPPGG 43          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Nematostella
Match: EDO43710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR6])

HSP 1 Score: 169.088 bits (427), Expect = 1.991e-43
Identity = 128/480 (26.67%), Postives = 219/480 (45.62%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFC---EQILIPNKIILYCIGPFLTAYLIIFCITYDQLGR---------HGSDVI--------LLATKKTNIWKHRLKWILCI--KKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCK-QDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKE-RFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEV-FEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDN-----KNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPP 1617
            ++  MS +G +M+   R+ IP  +Y++L +S    I+ +V  AI  ++  +  + C   ++I I   ++++         +II C T+D  GR          G  V+         +A K  + WK   ++  C    +   +E   +       A   ++ ++V SDF AG+ LL + Q    +   E +L+  +            Q+M T+  +F      ++ I + + E  L  +I+                  YF   A A+YGWPI++                   H  S  C +C C  C  ++S   K++ V E   C CH  A+     L   +++ VS++N  + SPF++A+ H  + +++ IRGT SL+DILTD       +  E G   +  H GM+  A  I+RK++ + I+H   N +     ++YRL++ GHSLGAG A IL+      +P+L CYA+SPP
Sbjct:   84 SVAWMSGKGSLMDTEPRNFIPALLYVRLMLS----IIEVVWLAIGVKWIFLDTQVCPLTDEIYIARAVVVFNWMFLFIVTVIILC-TFDTAGRTWFAMQRARDGGHVLDAPCKYRTRIAKKYESRWKGCFRYAFCCIGAEGQGDENTRVSPLCRTLAEFFQDLDVVPSDFAAGLVLLRRHQKCEEHQELERALQERRV-----------QEMTTVRENF------FLLIFHTQEEFLLYKEIA------------------YFMNHALAAYGWPIYMK-----------------NHVLSFVCTRC-CYGCRNNDSRLHKIVQVDEDNCCRCHFSALKRIAGLHNTDVIYVSYHNSLYKSPFYVALDHHKKAVVVVIRGTLSLQDILTDFTVEPERIPAEGGDPSWFGHKGMVRCAVYIQRKLENDGILHTAFNADPDCGTRSYRLVLLGHSLGAGTAAILAFLLRPRYPDLFCYAYSPP 505          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Nematostella
Match: EDO44910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUI5])

HSP 1 Score: 132.88 bits (333), Expect = 2.065e-32
Identity = 83/279 (29.75%), Postives = 141/279 (50.54%), Query Frame = 1
Query:  853 FINNEENYVN-ISN----FKNEVNLADKISTGNKSDL-------------KSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLC--CKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENIIHNILNDN----KNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPP 1617
            F  N++ Y+N IS     F +E++  D + +     L             K +   I    YF   +  SYGWP+++  +         C G C  C+ +++C         C  +NS       +K+  C C+  AI  +T L  E+L   S++NK +  PF++A+  + + +++SIRGT S+KD LTD+  +  ++  +G  G +AH GM  +A  IK ++ +  I+    ++     K+YRL++ GHSLGAG A +LS      +P+L+C+A+S P
Sbjct:  203 FAGNDQQYMNAISQIAEMFASELHGVDAVPSDVAVGLILLQQQQEIESRGKEERSRIDAAAYFMRYSVGSYGWPMYVFMNP--------CCGPCSLCQKASAC---------CYPANSLAH---IIKDNCCMCNTAAIHLQTELRNEDLFYCSYHNKLYEIPFYVALDRDKKTVVVSIRGTLSMKDTLTDLTGHGEDIHIEGLDGGMAHKGMYLSATYIKGQLIDHGILQEAFDEAAKTVKSYRLVVVGHSLGAGTASVLSVLLKPMYPDLQCFAYSNP 461          

HSP 2 Score: 43.5134 bits (101), Expect = 1.805e-10
Identity = 51/210 (24.29%), Postives = 84/210 (40.00%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGR-HGSDVILLATKK-------------TNIWKHRLKWILCIKKVNDEE-RNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNS-SSFNQKMYTIIN 849
             I+  S QG IM    R +IP  +YI+L +   E  LSI+     +  S          +    ++ + I   + A   +F   +D LG  H  D  +  + K               +W+ R + + C    ND++  NA+   A +FAS     + V SD   G+ LL +Q        E   +I+ +   +  S  S+   MY  +N
Sbjct:   76 AIIWTSMQGTIMNTRPRQRIPILLYIQLALYVPEIALSILGIYWAFHSSTGCELGVVVPVQITVVLQWLILLSVFAAAAMF---FDPLGALHKQDRSIEQSSKFQCQTFSKLVAALVTLWERRCRLLCCCFAGNDQQYMNAISQIAEMFASELHGVDAVPSDVAVGLILLQQQQEIESRGKEERSRIDAAAYFMRYSVGSYGWPMYVFMN 282          

HSP 3 Score: 41.2022 bits (95), Expect = 1.805e-10
Identity = 19/59 (32.20%), Postives = 34/59 (57.63%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYFNFHENMINNCNSKLYQQS 274
            MP L+ F R+W I +DD V+      + R   FI+V  +Y  +H+++   C+S++  Q+
Sbjct:    1 MPALVAFNRRWQIGSDDLVFPFTAGLMARFAWFIVVCSIYGVYHKDL-KECHSQIALQT 58          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Nematostella
Match: EDO44911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUI6])

HSP 1 Score: 85.1149 bits (209), Expect = 3.530e-17
Identity = 50/164 (30.49%), Postives = 85/164 (51.83%), Query Frame = 1
Query:  931 GNKSDLKSDWRD-IRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSGYLAH 1419
            G+   ++S+ R  I    YF   +  SYGWP+++             M  CC   + C   +C  C C  +NS       +K+  C C+  AI  +T L  E+L+  S++NK +  PF++A+  + + +++SIRGT S+KD LTD+  +  ++  +G  G +AH
Sbjct:  247 GSAPGMESEERSRIDAAAYFMRYSVGSYGWPMYVF------------MNPCCGPCSLCQKARCSAC-CYPANSLAH---IIKDNCCMCNTAAIHLQTELRNEDLLYCSYHNKLYEIPFYVALDRDKKTVVVSIRGTLSMKDTLTDLTGHGEDIHIEGLDGGMAH 394          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Medaka
Match: dagla (diacylglycerol lipase alpha [Source:NCBI gene;Acc:101165873])

HSP 1 Score: 159.844 bits (403), Expect = 8.149e-43
Identity = 131/484 (27.07%), Postives = 224/484 (46.28%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKI--ILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKE-RFCSCHEKAILN---ETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM--DANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            S IM +S +G I+    R  + + IYI+L +   E   ++V  A   +Y     + C  +   N    I+ C    + +  I    T+D  GR  + V L AT++                   + W  RLK+ +C  +  D + +A    A++FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+++ N   E+N+               ++D   + Y+   A A+YGWP++L+       R   C GL C  ++SC C          S S   + + V+E   C C+  AI     +  L++ ++V  S ++  + +PFF+A+ H    +++SIRGT S KD LTD+  D+  + V E+    +L H GM+ +A+ IK+K+++E I+      ++     +Y L+I GHSLGAG A ILS     ++PNL CY++SPP G
Sbjct:   74 SAIMWLSMRGSILHTQPREAVQYVIYIRLTILLVELAYAVVGIAWLVQY----YQPCSDVTAKNLALGIVSCNWLVILSVCITLMCTFDPTGR--TFVKLKATRRRQRNLTTYTLRHRLEEGQASSWSRRLKFFMCCTRAQDTQSDAYSEVASLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRSAILDQANNDILAFLSGIPVTRNTKYLDLKN-STEMNM---------------YKD---VCYYMLFAMAAYGWPMYLM-------RNPAC-GL-CHLASSCPCTSV-------SGSRLSQSVTVEEDNCCGCNVLAIRRHFLDKDLKQVHIVYTSCHDAVYETPFFVAVDHVKRKVVISIRGTLSPKDALTDLTGDSERLPV-EEQHGTWLGHKGMVYSAEYIKKKLEQEMILSQAFGRDLSKGTMHYELVIVGHSLGAGTAAILSFLLRPQYPNLHCYSYSPPGG 501          

HSP 2 Score: 35.8094 bits (81), Expect = 8.149e-43
Identity = 14/41 (34.15%), Postives = 26/41 (63.41%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYF 220
            MP ++MF R+W++ +DD V  + + FLI     ++++ V F
Sbjct:    1 MPGMVMFRRRWSVGSDDLVLPALFLFLIHCIWLVVLSVVLF 41          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Medaka
Match: dagla (diacylglycerol lipase alpha [Source:NCBI gene;Acc:101165873])

HSP 1 Score: 159.844 bits (403), Expect = 8.991e-43
Identity = 129/483 (26.71%), Postives = 222/483 (45.96%), Query Frame = 1
Query:  265 STIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKI--ILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKK------------------TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILN---ETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDM--DANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEENII-----HNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
            S IM +S +G I+    R  + + IYI+L +   E   ++V  A   +Y     + C  +   N    I+ C    + +  I    T+D  GR  + V L AT++                   + W  RLK+ +C  +  D + +A    A++FA    + ++V SD  AG+ LL ++               ++K       + N  +  +    +     Y+++ N   E+N+               ++D   + Y+   A A+YGWP++L+       R   C GLC  H      + C C     S  + Q +   ++  C C+  AI     +  L++ ++V  S ++  + +PFF+A+ H    +++SIRGT S KD LTD+  D+  + V E+    +L H GM+ +A+ IK+K+++E I+      ++     +Y L+I GHSLGAG A ILS     ++PNL CY++SPP G
Sbjct:   74 SAIMWLSMRGSILHTQPREAVQYVIYIRLTILLVELAYAVVGIAWLVQY----YQPCSDVTAKNLALGIVSCNWLVILSVCITLMCTFDPTGR--TFVKLKATRRRQRNLTTYTLRHRLEEGQASSWSRRLKFFMCCTRAQDTQSDAYSEVASLFAEFFRDLDIVPSDIIAGLVLLRQR--------------QRAKRSAILDQANNDILAFLSGIPVTRNTKYLDLKN-STEMNM---------------YKD---VCYYMLFAMAAYGWPMYLM-------RNPAC-GLC--H----LASSCPCTSVSGSRLS-QSVTVEEDNCCGCNVLAIRRHFLDKDLKQVHIVYTSCHDAVYETPFFVAVDHVKRKVVISIRGTLSPKDALTDLTGDSERLPV-EEQHGTWLGHKGMVYSAEYIKKKLEQEMILSQAFGRDLSKGTMHYELVIVGHSLGAGTAAILSFLLRPQYPNLHCYSYSPPGG 501          

HSP 2 Score: 35.8094 bits (81), Expect = 8.991e-43
Identity = 14/41 (34.15%), Postives = 26/41 (63.41%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRL--FIIVAYVYF 220
            MP ++MF R+W++ +DD V  + + FLI     ++++ V F
Sbjct:    1 MPGMVMFRRRWSVGSDDLVLPALFLFLIHCIWLVVLSVVLF 41          
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Medaka
Match: daglb (diacylglycerol lipase beta [Source:NCBI gene;Acc:101154852])

HSP 1 Score: 152.14 bits (383), Expect = 1.511e-37
Identity = 123/474 (25.95%), Postives = 211/474 (44.51%), Query Frame = 1
Query:  268 TIMIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVIL-----------------LATKKT---NIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKC-ICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILSIRGTFSLKDILTDMDANLIEVFEDGFSGY-LAHSGMLNAAKNIKRKIQEENIIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG 1623
             I+ +SAQG I     R  +P  +Y++  +   E + + +            +      +I   +  + I  F T   ++F   +D +G  G    L                 L+T ++    +W+ RL+ + C    ++  R A  S + +F+    +++LV SD  AG+ LL                                          + E++ V +S   + V L+   S+  + DL+++   +    +  T A A+YGWP+++                     ++ F   C +  DC +S++ D  +  V      CH  +IL  T L+  + + VSF+N+ +  PFF+A+ H+ E +++++RGT SLKD+LTD+ A   ++  +G SG   AH GM  AA  I RK+  + I++   +    Y+L+ITGHSLGAG A +L+      FP L+CYAFSPP G
Sbjct:   75 AIVFVSAQGTITNPGPRRSMPALVYLRAALYLPELVWACMGAVWVSDSGGGCDPATVAAVISAVVASWVILLF-TGVGVVF--VFDPMGSSGRQPELTEPLGVRDMESSEGAQFLSTARSVAAKVWECRLRLLCCCLPQDEGHRAAFASISQLFSDFFSDTDLVPSDIAAGLALL------------------------------------------HQEQDKVELSRDPDGV-LSHSPSSPIEQDLEAE---LEKAAHCMTFAAAAYGWPLYVY--------------------SNPFSAPCKLSGDCCRSHAGDYDI--VGGDHLGCHFASILESTGLQYRDFIHVSFHNQIYEIPFFVALDHKREAVVVAVRGTLSLKDVLTDLSAECEQLPVEGVSGACYAHKGMCQAAGYIYRKLVNDGILNQAFSIAPEYKLVITGHSLGAGTASVLAILLRSSFPTLQCYAFSPPGG 477          
BLAST of sn1-specific diacylglycerol lipase beta vs. Planmine SMEST
Match: SMESG000046500.1 (SMESG000046500.1)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 324/327 (99.08%), Postives = 326/327 (99.69%), Query Frame = 1
Query:  286 AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKT 1266
            AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGS+VILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVN+SNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNK 
Sbjct:   61 AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSNVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNMSNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKV 387          

HSP 2 Score: 118.627 bits (296), Expect = 3.530e-28
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 268
            MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ
Sbjct:    1 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Planmine SMEST
Match: SMESG000046500.1 (SMESG000046500.1)

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 324/326 (99.39%), Postives = 326/326 (100.00%), Query Frame = 1
Query:  286 AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNK 1263
            AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGS+VILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVN+SNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNK
Sbjct:   61 AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSNVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNMSNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNK 386          

HSP 2 Score: 118.627 bits (296), Expect = 4.078e-28
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 268
            MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ
Sbjct:    1 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Planmine SMEST
Match: SMESG000046500.1 (SMESG000046500.1)

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 315/324 (97.22%), Postives = 318/324 (98.15%), Query Frame = 1
Query:  295 LIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKT 1266
            L   +S  SKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGS+VILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVN+SNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNK 
Sbjct:   48 LYQWKSYLSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSNVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNMSNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNKV 371          

HSP 2 Score: 106.686 bits (265), Expect = 3.506e-24
Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 2
Query:  119 MFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 268
            MFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ
Sbjct:    1 MFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 50          
BLAST of sn1-specific diacylglycerol lipase beta vs. Planmine SMEST
Match: SMESG000046500.1 (SMESG000046500.1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 299/301 (99.34%), Postives = 301/301 (100.00%), Query Frame = 1
Query:  361 FYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNK 1263
            FYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGS+VILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVN+SNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNK
Sbjct:   61 FYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSNVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNMSNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVKERFCSCHEKAILNETHLEKENLVCVSFYNK 361          

HSP 2 Score: 118.627 bits (296), Expect = 2.823e-28
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 268
            MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ
Sbjct:    1 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 55          
BLAST of sn1-specific diacylglycerol lipase beta vs. Planmine SMEST
Match: SMESG000046500.1 (SMESG000046500.1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 264/266 (99.25%), Postives = 266/266 (100.00%), Query Frame = 1
Query:  286 AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCC 1083
            AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGS+VILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVN+SNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCC
Sbjct:   61 AQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIPNKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSNVILLATKKTNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGIQLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEENYVNMSNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPIHLLFHDENKSRLKFCMGLCC 326          

HSP 2 Score: 118.242 bits (295), Expect = 2.213e-28
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 2
Query:  104 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 268
            MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ
Sbjct:    1 MPPLIMFGRKWNIATDDFVYLSFWEFLIRLFIIVAYVYFNFHENMINNCNSKLYQ 55          
The following BLAST results are available for this feature:
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DAGLA8.705e-4225.10diacylglycerol lipase alpha [Source:HGNC Symbol;Ac... [more]
DAGLB1.854e-3726.05diacylglycerol lipase beta [Source:HGNC Symbol;Acc... [more]
DAGLB3.794e-3725.63diacylglycerol lipase beta [Source:HGNC Symbol;Acc... [more]
DAGLB2.016e-2235.15diacylglycerol lipase beta [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dagl-26.928e-3025.58DiAcylGlycerol Lipase homolog [Source:UniProtKB/T... [more]
dagl-22.377e-2925.75DiAcylGlycerol Lipase homolog [Source:UniProtKB/T... [more]
dagl-21.958e-2825.48DiAcylGlycerol Lipase homolog [Source:UniProtKB/T... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inaE3.497e-3327.20gene:FBgn0261244 transcript:FBtr0073826[more]
inaE4.565e-3327.20gene:FBgn0261244 transcript:FBtr0340291[more]
inaE5.427e-3327.20gene:FBgn0261244 transcript:FBtr0073825[more]
inaE6.094e-3327.30gene:FBgn0261244 transcript:FBtr0290303[more]
inaE1.934e-3227.76gene:FBgn0261244 transcript:FBtr0340290[more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daglb9.852e-4525.26diacylglycerol lipase, beta [Source:ZFIN;Acc:ZDB-G... [more]
dagla4.723e-4426.84diacylglycerol lipase, alpha [Source:ZFIN;Acc:ZDB-... [more]
dagla4.723e-4426.84diacylglycerol lipase, alpha [Source:ZFIN;Acc:ZDB-... [more]
BX248389.11.210e-4225.87diacylglycerol lipase, alpha [Source:NCBI gene;Acc... [more]
dagla2.342e-4226.65diacylglycerol lipase, alpha [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cxxc46.020e-3924.55CXXC finger protein 4 [Source:Xenbase;Acc:XB-GENE-... [more]
cxxc41.544e-3824.35CXXC finger protein 4 [Source:Xenbase;Acc:XB-GENE-... [more]
cxxc41.513e-3624.55CXXC finger protein 4 [Source:Xenbase;Acc:XB-GENE-... [more]
cxxc42.403e-3624.55CXXC finger protein 4 [Source:Xenbase;Acc:XB-GENE-... [more]
polr3c1.193e-3328.61polymerase (RNA) III (DNA directed) polypeptide C ... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dagla6.056e-4225.67diacylglycerol lipase, alpha [Source:MGI Symbol;Ac... [more]
Daglb4.238e-2825.82diacylglycerol lipase, beta [Source:MGI Symbol;Acc... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6WQJ1|DGLA_MOUSE3.716e-4125.67Sn1-specific diacylglycerol lipase alpha OS=Mus mu... [more]
sp|Q9Y4D2|DGLA_HUMAN3.873e-4125.10Sn1-specific diacylglycerol lipase alpha OS=Homo s... [more]
sp|Q5YLM1|DGLA_RAT4.607e-4125.67Sn1-specific diacylglycerol lipase alpha OS=Rattus... [more]
sp|Q8NCG7|DGLB_HUMAN1.822e-3625.63Sn1-specific diacylglycerol lipase beta OS=Homo sa... [more]
sp|Q91WC9|DGLB_MOUSE2.964e-2725.82Sn1-specific diacylglycerol lipase beta OS=Mus mus... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7PXD31.792e-4531.86Lipase_3 domain-containing protein OS=Penaeus vann... [more]
V9KEV65.518e-4527.12Sn1-specific diacylglycerol lipase beta OS=Callorh... [more]
A0A4Y2H4V61.801e-4326.39Sn1-specific diacylglycerol lipase beta OS=Araneus... [more]
A0A369SEH22.032e-4329.70Sn1-specific diacylglycerol lipase alpha OS=Tricho... [more]
A0A2D4H0D43.178e-4228.22Lipase_3 domain-containing protein OS=Micrurus cor... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dagla5.628e-3826.43diacylglycerol lipase alpha [Source:NCBI gene;Acc:... [more]
dagla1.078e-3327.87diacylglycerol lipase alpha [Source:NCBI gene;Acc:... [more]
daglb1.393e-3227.27diacylglycerol lipase beta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
daglb1.197e-3232.56diacylglycerol lipase, beta [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000003941.16.004e-1054.76pep scaffold:Pmarinus_7.0:GL487229:269:2582:1 gene... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO437101.991e-4326.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449102.065e-3229.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449113.530e-1730.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dagla8.149e-4327.07diacylglycerol lipase alpha [Source:NCBI gene;Acc:... [more]
dagla8.991e-4326.71diacylglycerol lipase alpha [Source:NCBI gene;Acc:... [more]
daglb1.511e-3725.95diacylglycerol lipase beta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of sn1-specific diacylglycerol lipase beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046500.13.530e-2899.08SMESG000046500.1[more]
SMESG000046500.14.078e-2899.39SMESG000046500.1[more]
SMESG000046500.13.506e-2497.22SMESG000046500.1[more]
SMESG000046500.12.823e-2899.34SMESG000046500.1[more]
SMESG000046500.12.213e-2899.25SMESG000046500.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013286 ID=SMED30013286|Name=sn1-specific diacylglycerol lipase beta|organism=Schmidtea mediterranea sexual|type=transcript|length=3658bp
TCTATATAAATCTTATATGTTAGCTTTTAATAGTAAACGATTTTTGAGTA
TTTCAACACATGGATCAGCTTGTCTAAAACAAAGATTTTTTCATTATTTA
TAAATGCCTCCTCTCATTATGTTTGGTCGTAAGTGGAATATAGCTACAGA
TGATTTTGTCTACCTTTCATTTTGGGAATTTTTAATTCGGTTATTCATCA
TTGTTGCATATGTTTATTTTAATTTCCATGAAAATATGATAAATAACTGC
AATAGCAAACTATATCAACAATCATGATTATGAGCGCTCAAGGATTAATA
ATGGAAGAATCCAAAAGATCAAAAATTCCTTTTTGCATATACATTAAATT
ATTTATGAGTTTTTACGAAGCAATTTTGTCGATTGTTGCTTTTGCGATAA
ATTATCGATATTCTTTGATTCCTAATAAATTTTGTGAGCAAATTCTGATT
CCAAACAAAATTATATTATACTGCATTGGACCATTCTTGACTGCATATCT
CATAATTTTTTGTATTACTTATGATCAATTAGGAAGACATGGTAGTGATG
TTATTTTACTAGCAACAAAAAAAACAAATATATGGAAGCATCGTTTGAAA
TGGATTTTATGTATAAAAAAAGTAAATGATGAAGAAAGGAATGCTCTAGA
TTCTGCCGCAAATATTTTCGCTTCATTATGTGAGGAATCAAATCTGGTTT
TCAGTGACTTCGAAGCTGGTATTCAATTACTATGCAAACAAGATGCAAAT
GCATATGATTTTACCGAGTATTCTTTGAAAATAAATAAATCTAAATCTGG
TGTCACGAATTCGAGTAGTTTCAACCAAAAAATGTATACAATCATCAACC
ATTTTATAAACAATGAAGAAAATTATGTGAACATATCAAATTTTAAAAAT
GAAGTTAATTTAGCTGATAAAATTTCAACTGGAAATAAAAGTGATTTAAA
ATCGGACTGGAGAGATATTCGTTTTATTTATTATTTTTCAACAATGGCCA
AAGCTTCATATGGCTGGCCTATTCATCTGTTATTTCACGATGAAAATAAA
TCAAGATTAAAGTTTTGCATGGGTCTGTGTTGTAAGCATTCAACTTCATG
TTTCTGTAATAAATGCATATGTTGTGATTGTGAAAAATCGAATTCAAATG
ATCAAAAGTTAATTTATGTTAAAGAAAGGTTTTGTAGTTGCCATGAAAAA
GCCATTTTAAACGAAACACATTTAGAAAAGGAAAATCTTGTATGTGTTTC
ATTTTATAATAAGACATTTCATTCTCCTTTCTTTATTGCAATATCTCATG
AGATTGAAGTTATTATTTTATCTATTCGAGGAACGTTTTCATTGAAAGAT
ATTTTAACTGATATGGACGCGAATCTCATTGAAGTATTTGAAGACGGATT
TTCTGGATATCTGGCACATTCTGGTATGTTAAATGCAGCTAAAAATATTA
AAAGAAAAATTCAAGAAGAAAATATTATTCATAATATACTAAATGATAAT
AAAAATTACAGATTAATTATTACAGGTCATAGTTTAGGTGCCGGAATCGC
AATTATTTTATCGTGCTTTTATTATCACGAATTTCCTAATCTTAAATGTT
ATGCATTTAGCCCACCTCTGGGAACTGTTAAGTATGAAAATTATTTGTTA
TTTTTACAAATACTGATTATTTTTCTTATAACTCTTTAAAAAGACATAGT
TTATTCTACAGAAAAGATGTAACCTCATAATATTTAAGATACAAAGATTG
AAATTAAATTTTAAAGTTTTTTAGTATTCTTCATTGTTTGAAATCTTGTA
TGACACTACATAATTTATTATCGAATTTTCAAATAAAAATGATCCTAAAG
AAACTACAGTACAGAACCGAAAAGGTTAAGGTTGTATTGTATTTCACTGT
ATGGTGAAGGTTGGAAATATGATTATCCAAGATGATGATTTCAATTTAAA
TTTGCACCAAAGAAAATTTTAGTGCTTCTCCAAAAGCTTTGGAAAATATT
TTCAAATGCTGTTGGGCTTCGTTTATTGTTGTACAAATGAAATTTAAATA
TAAAAACGAATTCAATTTTCCAAATCGATAAAATGAATAAACAGAAAAAA
TAATTGACATCCATAAAATCAGAAATTGATTTATTGAGGAGGAAAAATAT
GTACGGATCCAAAATAATGAAACGAATACAAATAAAATAATATAAAATCA
ACGTGGGGTCCCCAGAAAAAGACATCTAAAAAACAAATTAATTAAAAATT
AATTAATTTTGTAGCTATGTAGGAAATCAGAGCGGGCAAAACTAATGAGA
TTTATCATTCCTCAAAATCAATAAACAGATGAATTTTTTAAACCATTTGA
CGATACTTATCCTTCTTCACTACAGTTGTAACATTTTTGACTAGATTGAT
AAACTTTTGAATAATATTTAAAATGTCGCCATTCTGACTATACCTGAAAC
ATTTAATTAATTTACCATTTCCTTTAGAAAAATCATTCTTCTGATAACAA
TCATTCACGGATTGTGTTACCTTCAGTTTACATTCAAAAGAATTGTAACG
GTTTTATGGTGTAATTTGTCTTAAATGAAATAGACATGTTGCGATAGCTT
TTTGTAGAAAGAAGTGATAAAGAATGTCGAGACATGCCGAAGAATTCAAA
ATTTTCACCTGCTGATTTAATACGTAATCAAATAAAAAATGTACAGCATA
TCACTTTACATTCCATATGTGATCGATGTCATTCTAATTATTTAAATTCC
TGAAATGTTTTTTTTGTGTCAAAATAATAATCGATTTTTTGTAAATTTTG
ATCATGAATAATTATTTTCTAATACAAAATTTTTAATTAAAGCAGTTGAA
CGGTTTTATGATGAAAAAGCTTAATAATTTGTATTAATTATTAACATGTT
GAAGTATTAAGACTGCAGATTACTGTAAAGATTTTGTCCTATCAATTGTC
AATGGTGTTGAATGGGTTCCTCGAATATCTTTACAATCAATTGTAGTGGC
CAAACGCCGACTTATCGAATGTTTAGAAAATTATCCTCATTCTAAATTTC
AATTATTAATTAAAAAATTTATCAAATGCAAATGTTGCTATTGTAGTAAA
ACATCCTGCAGATGGAACATACTTAATTCATTTGAAAGAGATGAAAAATA
TTGGGAAAATATTGAAATAAATACAAAATTACCTGGACAAATAATACACA
TCACTAATATAAAAAAATTAAATGATCCAAATAAATCTGATTTAATCAAC
AGCAACCGTAGCTTTTACACGCCCATAATTACTTCAAGCGATCAATTCAA
AACAGTTGTATTTCATCCAAAAATGTTTAAAGATCACTTTCCCCATCAAA
TGGTTAAAAGATTATTCAACATTTTGTATGAAAACCAACTATTTTATCCA
AATTGTCATCACTACTCAAAGCATTATTGGCCAAGTTGTAAAGATAAAGA
TATTATGAAATTACCATTTATCAGTGGTATATTAAATTCCGATACGACAT
CACTCTCTTATTTTGCAACTAATATTTGCAACCGAAAAAAGAGTAAAATA
CTAGAGGATTCTAATAATAGTTTATATCTGATATCCAAAATTACAGTTGT
GTGAAATTATTATATGCGCAATGGTAATAAATTGGTTTATCTTTTTCGTT
GTAGCATT
back to top

protein sequence of SMED30013286-orf-1

>SMED30013286-orf-1 ID=SMED30013286-orf-1|Name=SMED30013286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=472bp
MIMSAQGLIMEESKRSKIPFCIYIKLFMSFYEAILSIVAFAINYRYSLIP
NKFCEQILIPNKIILYCIGPFLTAYLIIFCITYDQLGRHGSDVILLATKK
TNIWKHRLKWILCIKKVNDEERNALDSAANIFASLCEESNLVFSDFEAGI
QLLCKQDANAYDFTEYSLKINKSKSGVTNSSSFNQKMYTIINHFINNEEN
YVNISNFKNEVNLADKISTGNKSDLKSDWRDIRFIYYFSTMAKASYGWPI
HLLFHDENKSRLKFCMGLCCKHSTSCFCNKCICCDCEKSNSNDQKLIYVK
ERFCSCHEKAILNETHLEKENLVCVSFYNKTFHSPFFIAISHEIEVIILS
IRGTFSLKDILTDMDANLIEVFEDGFSGYLAHSGMLNAAKNIKRKIQEEN
IIHNILNDNKNYRLIITGHSLGAGIAIILSCFYYHEFPNLKCYAFSPPLG
TVKYENYLLFLQILIIFLITL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002921Fungal_lipase-like
IPR029058AB_hydrolase
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR45792:SF3SN1-SPECIFIC DIACYLGLYCEROL LIPASE ALPHAcoord: 2..269
NoneNo IPR availablePANTHERPTHR45792FAMILY NOT NAMEDcoord: 2..269
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 20..42