Phosphoglycerate kinase

Overview
NamePhosphoglycerate kinase
Smed IDSMED30013285
Length (bp)2061
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoglycerate kinase (SMED30013285) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoglycerate kinase (SMED30013285) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013285

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30013285SMESG000048946.1 Contig585_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30013285SMESG000048946.1 PL06011B2F03_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoglycerate kinase vs. Ensembl Human
Match: PGK1 (phosphoglycerate kinase 1 [Source:HGNC Symbol;Acc:HGNC:8896])

HSP 1 Score: 512.301 bits (1318), Expect = 4.372e-177
Identity = 250/414 (60.39%), Postives = 317/414 (76.57%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MRVDFNVPMKN  ITN QRI  A+P+IK  L   AKS+VL+SHLGRP G    +KY+L PVAV L  +L   V FL DC+G  +E A      GSV LLENLRF++EEEGKG   SG K++A  A + +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP +  G LMKKEL YF +AL++P+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SL+D +GA +V+ +M +A    V + LP+DFVTA++F E+A+T  AT+ SGIP GWMGLD G +S   + + + R+K I+WNGP+GVFE++ FA+G+   M+EVVKAT  G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 416          
BLAST of Phosphoglycerate kinase vs. Ensembl Human
Match: PGK2 (phosphoglycerate kinase 2 [Source:HGNC Symbol;Acc:HGNC:8898])

HSP 1 Score: 497.278 bits (1279), Expect = 4.081e-171
Identity = 244/414 (58.94%), Postives = 314/414 (75.85%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            + +KL +D+++V+ KRV+MRVDFNVPMK   ITN QRI  +IP+IK  L   AK++VL+SHLGRP G    +KY+L PVAV L  +L   V FL DC+G  +E A      GSV LLENLRF++EEEGKG   SG+K++A    + +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP + +G LMKKEL YF +AL+NP RPFLAILGGAKV DKI LI N+LDK+NE+II GGMA+TFLK+L+NMEIG SL+D +GA +V+ IM +A    V +  P+DFVT ++F E+A+   AT+ SGI  GWMGLD G +S     +V+A+++ I+WNGP+GVFE+D FAKG+   M+E+VKAT  G +T+IGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGKILPG+  L++
Sbjct:    3 LSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVLMSHLGRPDGVPMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLENLRFHVEEEGKGQDPSGKKIKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIVKATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSN 416          
BLAST of Phosphoglycerate kinase vs. Ensembl Human
Match: PGK1 (phosphoglycerate kinase 1 [Source:HGNC Symbol;Acc:HGNC:8896])

HSP 1 Score: 477.248 bits (1227), Expect = 8.364e-164
Identity = 234/388 (60.31%), Postives = 295/388 (76.03%), Query Frame = 1
Query:  184 MKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            MKN  ITN QRI  A+P+IK  L   AKS+VL+SHLGRP G    +KY+L PVAV L  +L   V FL DC+G  +E A      GSV LLENLRF++EEEGKG   SG K++A  A + +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP +  G LMKKEL YF +AL++P+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SL+D +GA +V+ +M +A    V + LP+DFVTA++F E+A+T  AT+ SGIP GWMGLD G +S   + + + R+K I+WNGP+GVFE++ FA+G+   M+EVVKAT  G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    1 MKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 388          
BLAST of Phosphoglycerate kinase vs. Ensembl Celegans
Match: pgk-1 (Probable phosphoglycerate kinase [Source:UniProtKB/Swiss-Prot;Acc:P91427])

HSP 1 Score: 514.998 bits (1325), Expect = 1.325e-178
Identity = 250/409 (61.12%), Postives = 310/409 (75.79%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            KL ID++N+  KRVL+RVDFNVP+K+G ITN QRI  A+PTI+ AL   AKS+VL+SHLGRP GR+ +KYTL+PVA  L  +L   V FL DC+G  +E A  +   GSV LLENLR++LEEEGKGV  SG K++A++A V  F + LTKLG IYVNDAFGTAHRAH+SMVGV    R +G L+K EL YF++AL NP RPFLAILGGAKV DKI LI NLLDK+NE+II GGMA+TFLK+   ++IG SLYD +GA +V  +++ A    V +HLP+DFV A++FAEDA +   T E G+P+G MGLD+G +S   F   I R+KTI+WNGP GVFEFDKFA G+   M+EVVKAT  GA+TIIGGGDTA+   K+N+   VSHVSTGGGASLELLEGK+LPG+  L+
Sbjct:    6 KLAIDQLNLAGKRVLIRVDFNVPLKDGKITNNQRIAAAVPTIQHALSNGAKSVVLMSHLGRPDGRRQDKYTLKPVAEELKALLKKDVLFLDDCVGSEVEAACADPAPGSVILLENLRYHLEEEGKGVDASGAKVKADSAAVKKFRESLTKLGDIYVNDAFGTAHRAHSSMVGVEHSQRASGFLLKNELSYFSKALDNPARPFLAILGGAKVADKIQLIKNLLDKVNEMIIGGGMAYTFLKVAQGVKIGNSLYDEEGAKIVNELLEAAKAKGVQIHLPVDFVIADKFAEDATSKTVTAEEGVPDGHMGLDVGPESSKIFAAAIQRAKTIVWNGPAGVFEFDKFATGTKSLMDEVVKATAAGAITIIGGGDTATAAKKYNTEDKVSHVSTGGGASLELLEGKVLPGVDALS 414          
BLAST of Phosphoglycerate kinase vs. Ensembl Fly
Match: Pgk (gene:FBgn0250906 transcript:FBtr0077739)

HSP 1 Score: 503.827 bits (1296), Expect = 4.383e-174
Identity = 252/410 (61.46%), Postives = 312/410 (76.10%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            KL I+ +++  KRVLMRVDFNVP+K G IT+ QRI  A+ +IKLAL  KAKS+VL+SHLGRP G K+ KYTL PVA  L  +L   V FL DC+G  +E A  +   GSV LLEN+RFY+EEEGKG+  SG K++A+ A V  F   L KLG +YVNDAFGTAHRAH+SM+G     R AGLL+ KELKYF++AL  P  PFLAILGGAKV DKI LI NLLDK+NE+II GGMAFTFLK+L+NM+IG SL+D +G+ +V++++++A   NV +HLP+DFV  ++FAE+A  S AT+E+GIP+G MGLD+G K+   F   IAR+K I+WNGP GVFEF  FA G+   M+ VV ATKNG V+IIGGGDTASCCAK+N+  LVSHVSTGGGASLELLEGK LPG+  L S
Sbjct:    5 KLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIVAALDSIKLALSKKAKSVVLMSHLGRPDGNKNIKYTLAPVAAELKTLLGQDVIFLSDCVGSEVEAACKDPAPGSVILLENVRFYVEEEGKGLDASGGKVKADPAKVKEFRASLAKLGDVYVNDAFGTAHRAHSSMMGDGFEQRAAGLLLNKELKYFSQALDKPPNPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMAFTFLKVLNNMKIGGSLFDEEGSKIVEKLVEKAKKNNVQLHLPVDFVCGDKFAENAAVSEATVEAGIPDGHMGLDVGPKTRELFAAPIARAKLIVWNGPPGVFEFPNFANGTKSIMDGVVAATKNGTVSIIGGGDTASCCAKWNTEALVSHVSTGGGASLELLEGKTLPGVAALTS 414          
BLAST of Phosphoglycerate kinase vs. Ensembl Fly
Match: Pgk (gene:FBgn0250906 transcript:FBtr0330718)

HSP 1 Score: 503.827 bits (1296), Expect = 4.383e-174
Identity = 252/410 (61.46%), Postives = 312/410 (76.10%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            KL I+ +++  KRVLMRVDFNVP+K G IT+ QRI  A+ +IKLAL  KAKS+VL+SHLGRP G K+ KYTL PVA  L  +L   V FL DC+G  +E A  +   GSV LLEN+RFY+EEEGKG+  SG K++A+ A V  F   L KLG +YVNDAFGTAHRAH+SM+G     R AGLL+ KELKYF++AL  P  PFLAILGGAKV DKI LI NLLDK+NE+II GGMAFTFLK+L+NM+IG SL+D +G+ +V++++++A   NV +HLP+DFV  ++FAE+A  S AT+E+GIP+G MGLD+G K+   F   IAR+K I+WNGP GVFEF  FA G+   M+ VV ATKNG V+IIGGGDTASCCAK+N+  LVSHVSTGGGASLELLEGK LPG+  L S
Sbjct:    5 KLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIVAALDSIKLALSKKAKSVVLMSHLGRPDGNKNIKYTLAPVAAELKTLLGQDVIFLSDCVGSEVEAACKDPAPGSVILLENVRFYVEEEGKGLDASGGKVKADPAKVKEFRASLAKLGDVYVNDAFGTAHRAHSSMMGDGFEQRAAGLLLNKELKYFSQALDKPPNPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMAFTFLKVLNNMKIGGSLFDEEGSKIVEKLVEKAKKNNVQLHLPVDFVCGDKFAENAAVSEATVEAGIPDGHMGLDVGPKTRELFAAPIARAKLIVWNGPPGVFEFPNFANGTKSIMDGVVAATKNGTVSIIGGGDTASCCAKWNTEALVSHVSTGGGASLELLEGKTLPGVAALTS 414          
BLAST of Phosphoglycerate kinase vs. Ensembl Fly
Match: Pgk (gene:FBgn0250906 transcript:FBtr0330716)

HSP 1 Score: 503.827 bits (1296), Expect = 4.383e-174
Identity = 252/410 (61.46%), Postives = 312/410 (76.10%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            KL I+ +++  KRVLMRVDFNVP+K G IT+ QRI  A+ +IKLAL  KAKS+VL+SHLGRP G K+ KYTL PVA  L  +L   V FL DC+G  +E A  +   GSV LLEN+RFY+EEEGKG+  SG K++A+ A V  F   L KLG +YVNDAFGTAHRAH+SM+G     R AGLL+ KELKYF++AL  P  PFLAILGGAKV DKI LI NLLDK+NE+II GGMAFTFLK+L+NM+IG SL+D +G+ +V++++++A   NV +HLP+DFV  ++FAE+A  S AT+E+GIP+G MGLD+G K+   F   IAR+K I+WNGP GVFEF  FA G+   M+ VV ATKNG V+IIGGGDTASCCAK+N+  LVSHVSTGGGASLELLEGK LPG+  L S
Sbjct:    5 KLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIVAALDSIKLALSKKAKSVVLMSHLGRPDGNKNIKYTLAPVAAELKTLLGQDVIFLSDCVGSEVEAACKDPAPGSVILLENVRFYVEEEGKGLDASGGKVKADPAKVKEFRASLAKLGDVYVNDAFGTAHRAHSSMMGDGFEQRAAGLLLNKELKYFSQALDKPPNPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMAFTFLKVLNNMKIGGSLFDEEGSKIVEKLVEKAKKNNVQLHLPVDFVCGDKFAENAAVSEATVEAGIPDGHMGLDVGPKTRELFAAPIARAKLIVWNGPPGVFEFPNFANGTKSIMDGVVAATKNGTVSIIGGGDTASCCAKWNTEALVSHVSTGGGASLELLEGKTLPGVAALTS 414          
BLAST of Phosphoglycerate kinase vs. Ensembl Fly
Match: Pgk (gene:FBgn0250906 transcript:FBtr0334162)

HSP 1 Score: 503.827 bits (1296), Expect = 4.383e-174
Identity = 252/410 (61.46%), Postives = 312/410 (76.10%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            KL I+ +++  KRVLMRVDFNVP+K G IT+ QRI  A+ +IKLAL  KAKS+VL+SHLGRP G K+ KYTL PVA  L  +L   V FL DC+G  +E A  +   GSV LLEN+RFY+EEEGKG+  SG K++A+ A V  F   L KLG +YVNDAFGTAHRAH+SM+G     R AGLL+ KELKYF++AL  P  PFLAILGGAKV DKI LI NLLDK+NE+II GGMAFTFLK+L+NM+IG SL+D +G+ +V++++++A   NV +HLP+DFV  ++FAE+A  S AT+E+GIP+G MGLD+G K+   F   IAR+K I+WNGP GVFEF  FA G+   M+ VV ATKNG V+IIGGGDTASCCAK+N+  LVSHVSTGGGASLELLEGK LPG+  L S
Sbjct:    5 KLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIVAALDSIKLALSKKAKSVVLMSHLGRPDGNKNIKYTLAPVAAELKTLLGQDVIFLSDCVGSEVEAACKDPAPGSVILLENVRFYVEEEGKGLDASGGKVKADPAKVKEFRASLAKLGDVYVNDAFGTAHRAHSSMMGDGFEQRAAGLLLNKELKYFSQALDKPPNPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMAFTFLKVLNNMKIGGSLFDEEGSKIVEKLVEKAKKNNVQLHLPVDFVCGDKFAENAAVSEATVEAGIPDGHMGLDVGPKTRELFAAPIARAKLIVWNGPPGVFEFPNFANGTKSIMDGVVAATKNGTVSIIGGGDTASCCAKWNTEALVSHVSTGGGASLELLEGKTLPGVAALTS 414          
BLAST of Phosphoglycerate kinase vs. Ensembl Fly
Match: Pgk (gene:FBgn0250906 transcript:FBtr0330717)

HSP 1 Score: 503.827 bits (1296), Expect = 4.383e-174
Identity = 252/410 (61.46%), Postives = 312/410 (76.10%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            KL I+ +++  KRVLMRVDFNVP+K G IT+ QRI  A+ +IKLAL  KAKS+VL+SHLGRP G K+ KYTL PVA  L  +L   V FL DC+G  +E A  +   GSV LLEN+RFY+EEEGKG+  SG K++A+ A V  F   L KLG +YVNDAFGTAHRAH+SM+G     R AGLL+ KELKYF++AL  P  PFLAILGGAKV DKI LI NLLDK+NE+II GGMAFTFLK+L+NM+IG SL+D +G+ +V++++++A   NV +HLP+DFV  ++FAE+A  S AT+E+GIP+G MGLD+G K+   F   IAR+K I+WNGP GVFEF  FA G+   M+ VV ATKNG V+IIGGGDTASCCAK+N+  LVSHVSTGGGASLELLEGK LPG+  L S
Sbjct:    5 KLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIVAALDSIKLALSKKAKSVVLMSHLGRPDGNKNIKYTLAPVAAELKTLLGQDVIFLSDCVGSEVEAACKDPAPGSVILLENVRFYVEEEGKGLDASGGKVKADPAKVKEFRASLAKLGDVYVNDAFGTAHRAHSSMMGDGFEQRAAGLLLNKELKYFSQALDKPPNPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMAFTFLKVLNNMKIGGSLFDEEGSKIVEKLVEKAKKNNVQLHLPVDFVCGDKFAENAAVSEATVEAGIPDGHMGLDVGPKTRELFAAPIARAKLIVWNGPPGVFEFPNFANGTKSIMDGVVAATKNGTVSIIGGGDTASCCAKWNTEALVSHVSTGGGASLELLEGKTLPGVAALTS 414          
BLAST of Phosphoglycerate kinase vs. Ensembl Zebrafish
Match: pgk1 (phosphoglycerate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2711])

HSP 1 Score: 508.834 bits (1309), Expect = 7.096e-176
Identity = 248/414 (59.90%), Postives = 316/414 (76.33%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MRVDFNVPMKN VITN QRI  A+P+I+  L   AK++VL+SHLGRP G    +KY+L PVA  L  +L   V FL DC+G  +E A  + P GSV LLENLRF++ EEGKG   SG K +A+ A++ +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP + AG LMKKEL YF  AL+ PQRPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L NMEIG SL+D +G+ +V+ +M +A    V + LP+DF+TA++F E A T  AT+  GIP GWMGLD G +S   + + +AR+K I+WNGP+GVFE+D FA G+   M++VV+ATKNG +TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLHLDKVDVKGKRVIMRVDFNVPMKNNVITNNQRIKAAVPSIQHCLDNCAKAVVLMSHLGRPDGVPMPDKYSLEPVAAELKNLLGKDVQFLKDCVGPEVEKACADPPAGSVILLENLRFHVAEEGKGKDASGNKTKASQAEIDAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAAGFLMKKELDYFAMALEKPQRPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLKNMEIGTSLFDEEGSTIVKDLMAKAEKNGVKITLPVDFITADKFDEKATTGTATVAEGIPAGWMGLDCGPESSKLYAEAVARAKQIVWNGPVGVFEWDNFAHGTKNMMDKVVEATKNGCITIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 416          
BLAST of Phosphoglycerate kinase vs. Ensembl Xenopus
Match: mfsd6l (major facilitator superfamily domain containing 6-like [Source:Xenbase;Acc:XB-GENE-5841491])

HSP 1 Score: 499.975 bits (1286), Expect = 3.281e-172
Identity = 243/414 (58.70%), Postives = 317/414 (76.57%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MRVDFNVPMKN  ITN QRI  A+P+I+  L   AKS+VL+SHLGRP G    +KY+L PVA  L  ++   + FL DC+G  +E A  +   G+V LLENLRF++EEEGKG   +G K++A+AA V +F   L+KLG +Y+NDAFGTAHRAH+SMVGV LP R AG LMKKEL YF +AL+NP+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NM IG SLYD +GA +V+ +M +A    V + LP+DF TA +F E+A T +A++ +GIP+GWMGLD G +S+  F + + R+K I+WNGP+GVFE+D FAKG+   M++VV+ T  G +TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKVDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIQHCLDHGAKSVVLMSHLGRPDGVPMPDKYSLAPVAEELKALMKREIVFLKDCVGPEVEAACADPAPGTVLLLENLRFHVEEEGKGKDAAGNKVKADAAKVDAFRASLSKLGDVYINDAFGTAHRAHSSMVGVKLPQRAAGFLMKKELDYFAKALENPERPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMSIGNSLYDEEGAKIVKDLMAKAEKNGVKITLPVDFTTAEKFDENAGTGHASVSTGIPDGWMGLDCGPESMKLFVEAVGRAKQIVWNGPVGVFEWDNFAKGTKAVMDKVVEVTGKGCITIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 416          
BLAST of Phosphoglycerate kinase vs. Ensembl Xenopus
Match: mfsd6l (major facilitator superfamily domain containing 6-like [Source:Xenbase;Acc:XB-GENE-5841491])

HSP 1 Score: 479.559 bits (1233), Expect = 2.876e-164
Identity = 235/401 (58.60%), Postives = 307/401 (76.56%), Query Frame = 1
Query:  145 NKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            N++++M VDFNVPMKN  ITN QRI  A+P+I+  L   AKS+VL+SHLGRP G    +KY+L PVA  L  ++   + FL DC+G  +E A  +   G+V LLENLRF++EEEGKG   +G K++A+AA V +F   L+KLG +Y+NDAFGTAHRAH+SMVGV LP R AG LMKKEL YF +AL+NP+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NM IG SLYD +GA +V+ +M +A    V + LP+DF TA +F E+A T +A++ +GIP+GWMGLD G +S+  F + + R+K I+WNGP+GVFE+D FAKG+   M++VV+ T  G +TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:   18 NQKMVM-VDFNVPMKNNQITNNQRIKAAVPSIQHCLDHGAKSVVLMSHLGRPDGVPMPDKYSLAPVAEELKALMKREIVFLKDCVGPEVEAACADPAPGTVLLLENLRFHVEEEGKGKDAAGNKVKADAAKVDAFRASLSKLGDVYINDAFGTAHRAHSSMVGVKLPQRAAGFLMKKELDYFAKALENPERPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMSIGNSLYDEEGAKIVKDLMAKAEKNGVKITLPVDFTTAEKFDENAGTGHASVSTGIPDGWMGLDCGPESMKLFVEAVGRAKQIVWNGPVGVFEWDNFAKGTKAVMDKVVEVTGKGCITIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 417          
BLAST of Phosphoglycerate kinase vs. Ensembl Xenopus
Match: mfsd6l (major facilitator superfamily domain containing 6-like [Source:Xenbase;Acc:XB-GENE-5841491])

HSP 1 Score: 462.225 bits (1188), Expect = 1.294e-157
Identity = 229/414 (55.31%), Postives = 305/414 (73.67%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MR+             +  I  A+P+I+  L   AKS+VL+SHLGRP G    +KY+L PVA  L  ++   + FL DC+G  +E A  +   G+V LLENLRF++EEEGKG   +G K++A+AA V +F   L+KLG +Y+NDAFGTAHRAH+SMVGV LP R AG LMKKEL YF +AL+NP+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NM IG SLYD +GA +V+ +M +A    V + LP+DF TA +F E+A T +A++ +GIP+GWMGLD G +S+  F + + R+K I+WNGP+GVFE+D FAKG+   M++VV+ T  G +TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKVDVKGKRVVMRL-------------ILLIKAAVPSIQHCLDHGAKSVVLMSHLGRPDGVPMPDKYSLAPVAEELKALMKREIVFLKDCVGPEVEAACADPAPGTVLLLENLRFHVEEEGKGKDAAGNKVKADAAKVDAFRASLSKLGDVYINDAFGTAHRAHSSMVGVKLPQRAAGFLMKKELDYFAKALENPERPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMSIGNSLYDEEGAKIVKDLMAKAEKNGVKITLPVDFTTAEKFDENAGTGHASVSTGIPDGWMGLDCGPESMKLFVEAVGRAKQIVWNGPVGVFEWDNFAKGTKAVMDKVVEVTGKGCITIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 403          
BLAST of Phosphoglycerate kinase vs. Ensembl Xenopus
Match: mfsd6l (major facilitator superfamily domain containing 6-like [Source:Xenbase;Acc:XB-GENE-5841491])

HSP 1 Score: 461.455 bits (1186), Expect = 1.718e-157
Identity = 229/414 (55.31%), Postives = 303/414 (73.19%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MR                 I  A+P+I+  L   AKS+VL+SHLGRP G    +KY+L PVA  L  ++   + FL DC+G  +E A  +   G+V LLENLRF++EEEGKG   +G K++A+AA V +F   L+KLG +Y+NDAFGTAHRAH+SMVGV LP R AG LMKKEL YF +AL+NP+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NM IG SLYD +GA +V+ +M +A    V + LP+DF TA +F E+A T +A++ +GIP+GWMGLD G +S+  F + + R+K I+WNGP+GVFE+D FAKG+   M++VV+ T  G +TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKVDVKGKRVVMR-----------------IKAAVPSIQHCLDHGAKSVVLMSHLGRPDGVPMPDKYSLAPVAEELKALMKREIVFLKDCVGPEVEAACADPAPGTVLLLENLRFHVEEEGKGKDAAGNKVKADAAKVDAFRASLSKLGDVYINDAFGTAHRAHSSMVGVKLPQRAAGFLMKKELDYFAKALENPERPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMSIGNSLYDEEGAKIVKDLMAKAEKNGVKITLPVDFTTAEKFDENAGTGHASVSTGIPDGWMGLDCGPESMKLFVEAVGRAKQIVWNGPVGVFEWDNFAKGTKAVMDKVVEVTGKGCITIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 399          
BLAST of Phosphoglycerate kinase vs. Ensembl Xenopus
Match: mfsd6l (major facilitator superfamily domain containing 6-like [Source:Xenbase;Acc:XB-GENE-5841491])

HSP 1 Score: 441.425 bits (1134), Expect = 1.565e-149
Identity = 229/416 (55.05%), Postives = 298/416 (71.63%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHA--SMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MRVDFNVPMKN  ITN QRI  A+P+I+  L   AKS+VL+SHLGRP G    +KY+L PVA  L  ++   + FL DC+G  +E A  +   G+V LLENLRF++EEEGKG   +G K       V+ F     KL  +        AHR  +  SMVGV LP R AG LMKKEL YF +AL+NP+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NM IG SLYD +GA +V+ +M +A    V + LP+DF TA +F E+A T +A++ +GIP+GWMGLD G +S+  F + + R+K I+WNGP+GVFE+D FAKG+   M++VV+ T  G +TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKVDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIQHCLDHGAKSVVLMSHLGRPDGVPMPDKYSLAPVAEELKALMKREIVFLKDCVGPEVEAACADPAPGTVLLLENLRFHVEEEGKGKDAAGNK-------VSLFTD--VKLHLLRA-----VAHRETSCLSMVGVKLPQRAAGFLMKKELDYFAKALENPERPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMSIGNSLYDEEGAKIVKDLMAKAEKNGVKITLPVDFTTAEKFDENAGTGHASVSTGIPDGWMGLDCGPESMKLFVEAVGRAKQIVWNGPVGVFEWDNFAKGTKAVMDKVVEVTGKGCITIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 404          
BLAST of Phosphoglycerate kinase vs. Ensembl Mouse
Match: Pgk1 (phosphoglycerate kinase 1 [Source:MGI Symbol;Acc:MGI:97555])

HSP 1 Score: 513.072 bits (1320), Expect = 1.781e-177
Identity = 249/414 (60.14%), Postives = 318/414 (76.81%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MRVDFNVPMKN  ITN QRI  A+P+IK  L   AKS+VL+SHLGRP G    +KY+L PVA  L  +L   V FL DC+G  +E+A      G+V LLENLRF++EEEGKG   SG K++A  A + +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP +  G LMKKEL YF +AL++P+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SLYD +GA +V+ +M +A    V + LP+DFVTA++F E+A+T  AT+ SGIP GWMGLD G++S   + + + R+K I+WNGP+GVFE++ FA+G+   M+EVVKAT  G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGPEVENACANPAAGTVILLENLRFHVEEEGKGKDASGNKVKAEPAKIDAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLYDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGTESSKKYAEAVGRAKQIVWNGPVGVFEWEAFARGTKSLMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 416          
BLAST of Phosphoglycerate kinase vs. Ensembl Mouse
Match: Pgk2 (phosphoglycerate kinase 2 [Source:MGI Symbol;Acc:MGI:97563])

HSP 1 Score: 506.908 bits (1304), Expect = 4.806e-175
Identity = 249/414 (60.14%), Postives = 318/414 (76.81%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D++++K KRV+MRVDFNVPMKN  ITN QRI  AIP+IK  L   AKS+VL+SHLGRP G    +KY+L PVA  L  +L+  V FL DC+G  +E A     +GS+ LLENLRF++EEEGKG   SG+K+ A+ A V +F   L+KLG +YVNDAFGTAHRAH+S VGVNLP + +G LMKKEL YF++AL+ P+RPFLAILGGAKV DKI LI N+LDK+N +II GGMA+TFLK L NM+IG SL+D +GA +V+ IM++A    V +  P+DFVT ++F E+A+   ATIESGIP+GWMGLD G +S+    +++A++K I+WNGP+GVFE+D FAKG+   M+EVVKAT NG VTIIGGGDTA+CCAK+ +   VSHVSTGGGASLELLEGKILPG+  L++
Sbjct:    3 LSAKLTLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKSVVLMSHLGRPDGIPMPDKYSLEPVADELKSLLNKDVIFLKDCVGPEVEQACANPDNGSIILLENLRFHVEEEGKGKDSSGKKISADPAKVEAFQASLSKLGDVYVNDAFGTAHRAHSSTVGVNLPQKASGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLIKNMLDKVNFMIIGGGMAYTFLKELKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDENAKVGQATIESGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFAKGTKALMDEVVKATSNGCVTIIGGGDTATCCAKWGTEDKVSHVSTGGGASLELLEGKILPGVEALSN 416          
BLAST of Phosphoglycerate kinase vs. Ensembl Mouse
Match: Pgk1 (phosphoglycerate kinase 1 [Source:MGI Symbol;Acc:MGI:97555])

HSP 1 Score: 310.842 bits (795), Expect = 4.436e-101
Identity = 154/250 (61.60%), Postives = 190/250 (76.00%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNME 852
            +  KL +D+++VK KRV+MRVDFNVPMKN  ITN QRI  A+P+IK  L   AKS+VL+SHLGRP G    +KY+L PVA  L  +L   V FL DC+G  +E+A      G+V LLENLRF++EEEGKG   SG K++A  A + +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP +  G LMKKEL YF +AL++P+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NME
Sbjct:    3 LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGPEVENACANPAAGTVILLENLRFHVEEEGKGKDASGNKVKAEPAKIDAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNME 252          
BLAST of Phosphoglycerate kinase vs. UniProt/SwissProt
Match: sp|P41759|PGK_SCHMA (Phosphoglycerate kinase OS=Schistosoma mansoni OX=6183 GN=PGK PE=1 SV=1)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 264/409 (64.55%), Postives = 324/409 (79.22%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            KL I ++++K KRVL+RVDFNVPMK+G +TN QRI  AIPTIK AL   AKS+VL+SHLGRP G K +KY+L+PV   +SK+L   V FL DC+G  + +A      GSVFLLENLRF++EEEGKGVS +G+K +A A  + +F + LTKLG +YVNDAFGTAHRAHASMVG  LP +  G LM KEL YF +AL+NP+RPFLAILGGAKV+DKI LI N+LDK+NELII GGMA+TFLK +HNM IG SL+D  GA +V ++M+ A   NV +HLP+DFVTA++FA+DA T   TI+SGI +GWMGLDIG K++  F+KVI+R+KTI+WNGPMGVFE DKFA G+   M+EVVKATKNGA TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK LPG+  L 
Sbjct:    5 KLSISDVDLKGKRVLIRVDFNVPMKDGKVTNTQRIAAAIPTIKYALDKGAKSVVLMSHLGRPDGHKVDKYSLKPVCPEVSKLLGKEVTFLNDCVGPDVVNACANPAPGSVFLLENLRFHVEEEGKGVSPTGEKTKATADQIKAFSESLTKLGDVYVNDAFGTAHRAHASMVGCQLPQKACGFLMNKELTYFAKALENPERPFLAILGGAKVSDKIQLINNMLDKVNELIIGGGMAYTFLKQIHNMHIGNSLFDAPGAEIVHKVMETAKAKNVAIHLPVDFVTADKFADDANTEIRTIQSGIADGWMGLDIGPKTIEEFSKVISRAKTIVWNGPMGVFEMDKFATGTKAAMDEVVKATKNGATTIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKQLPGVVALT 413          
BLAST of Phosphoglycerate kinase vs. UniProt/SwissProt
Match: sp|P00559|PGK1_HORSE (Phosphoglycerate kinase 1 OS=Equus caballus OX=9796 GN=PGK1 PE=1 SV=2)

HSP 1 Score: 519.62 bits (1337), Expect = 3.151e-179
Identity = 252/414 (60.87%), Postives = 321/414 (77.54%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQ-GRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D++NVK KRV+MRVDFNVPMKN  ITN QRI  A+P+IK  L   AKS+VL+SHLGRP  G   +KY+L+PVAV L  +L   V FL DC+G  +E A  +   GSV LLENLRF++EEEGKG   SG K++A  A + +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP +  G LMKKEL YF +AL++P+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SL+D +GA +V+ +M +A    V + LP+DFVTA++F E+A+T  AT+ SGIP GWMGLD G++S   + + +AR+K I+WNGP+GVFE++ FA+G+   M+EVVKAT  G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKLNVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDVGPMPDKYSLQPVAVELKSLLGKDVLFLKDCVGPEVEKACADPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIETFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKNLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGTESSKKYAEAVARAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 416          
BLAST of Phosphoglycerate kinase vs. UniProt/SwissProt
Match: sp|P16617|PGK1_RAT (Phosphoglycerate kinase 1 OS=Rattus norvegicus OX=10116 GN=Pgk1 PE=1 SV=2)

HSP 1 Score: 516.153 bits (1328), Expect = 7.706e-178
Identity = 250/414 (60.39%), Postives = 319/414 (77.05%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MRVDFNVPMKN  ITN QRI  A+P+IK  L   AKS+VL+SHLGRP G    +KY+L PVA  L  +L   V FL DC+G  +E+A      G+V LLENLRF++EEEGKG   SG K++A  A + +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP +  G LMKKEL YF +AL++P+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SLYD +GA +V+ +M +A    V + LP+DFVTA++F E+A+T  AT+ SGIP GWMGLD G++S   + + +AR+K I+WNGP+GVFE++ FA+G+   M+EVVKAT  G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGSEVENACANPAAGTVILLENLRFHVEEEGKGKDASGNKVKAEPAKIDAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLYDEEGAKIVKDLMAKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGTESSKKYAEAVARAKQIVWNGPVGVFEWEAFARGTKSLMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 416          
BLAST of Phosphoglycerate kinase vs. UniProt/SwissProt
Match: sp|P91427|PGK_CAEEL (Probable phosphoglycerate kinase OS=Caenorhabditis elegans OX=6239 GN=pgk-1 PE=3 SV=1)

HSP 1 Score: 514.998 bits (1325), Expect = 1.686e-177
Identity = 250/409 (61.12%), Postives = 310/409 (75.79%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            KL ID++N+  KRVL+RVDFNVP+K+G ITN QRI  A+PTI+ AL   AKS+VL+SHLGRP GR+ +KYTL+PVA  L  +L   V FL DC+G  +E A  +   GSV LLENLR++LEEEGKGV  SG K++A++A V  F + LTKLG IYVNDAFGTAHRAH+SMVGV    R +G L+K EL YF++AL NP RPFLAILGGAKV DKI LI NLLDK+NE+II GGMA+TFLK+   ++IG SLYD +GA +V  +++ A    V +HLP+DFV A++FAEDA +   T E G+P+G MGLD+G +S   F   I R+KTI+WNGP GVFEFDKFA G+   M+EVVKAT  GA+TIIGGGDTA+   K+N+   VSHVSTGGGASLELLEGK+LPG+  L+
Sbjct:    6 KLAIDQLNLAGKRVLIRVDFNVPLKDGKITNNQRIAAAVPTIQHALSNGAKSVVLMSHLGRPDGRRQDKYTLKPVAEELKALLKKDVLFLDDCVGSEVEAACADPAPGSVILLENLRYHLEEEGKGVDASGAKVKADSAAVKKFRESLTKLGDIYVNDAFGTAHRAHSSMVGVEHSQRASGFLLKNELSYFSKALDNPARPFLAILGGAKVADKIQLIKNLLDKVNEMIIGGGMAYTFLKVAQGVKIGNSLYDEEGAKIVNELLEAAKAKGVQIHLPVDFVIADKFAEDATSKTVTAEEGVPDGHMGLDVGPESSKIFAAAIQRAKTIVWNGPAGVFEFDKFATGTKSLMDEVVKATAAGAITIIGGGDTATAAKKYNTEDKVSHVSTGGGASLELLEGKVLPGVDALS 414          
BLAST of Phosphoglycerate kinase vs. UniProt/SwissProt
Match: sp|P50310|PGK1_CRIGR (Phosphoglycerate kinase 1 OS=Cricetulus griseus OX=10029 GN=PGK1 PE=2 SV=2)

HSP 1 Score: 514.612 bits (1324), Expect = 2.493e-177
Identity = 250/414 (60.39%), Postives = 319/414 (77.05%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MRVDFNVPMKN  ITN QRI  A+P+IK  L   AKS+VL+SHLGRP G    +KY+L PVA  L  +L   V FL DC+G  +E+A      G+V LLENLRF++EEEGKG   SG K++A  A + +F   L+KLG +YVNDAFGTAHRAH+SMVGVNLP +  G LMKKEL YF +AL++P+RPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SLYD +GA +V+ +M +A    V + LP+DFVTA++F E+A+T  AT+ SGIP GWMGLD G++S   + + +AR+K I+WNGP+GVFE++ FA+G+   M+EVVKAT  G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK+LPG+  L++
Sbjct:    3 LSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGPEVENACANPAAGTVILLENLRFHVEEEGKGKDASGNKIKAEPAKIDAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLYDEEGAKIVKDLMAKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGTESSKKYAEAVARAKQIVWNGPVGVFEWEAFARGTKSLMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN 416          
BLAST of Phosphoglycerate kinase vs. TrEMBL
Match: Q86DX7 (Phosphoglycerate kinase (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 269/409 (65.77%), Postives = 324/409 (79.22%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            KL I ++++K+KRVL+RVDFNVPMK+G +TN QRI  AIPTIK AL   AKS+VL+SHLGRP G K EKY+L+PV   +SK+L   V FL DC+G  +  A      GSVFLLENLRF++EEEGKGVS SG K +A A  + +F + LTKLG +YVNDAFGTAHRAHASMVG  LP +  G LM KEL YF +AL+NP+RPFLAILGGAKV+DKI LI N+LDK+NELII GGMA+TFLK +HNM IG SL+D  GA +VQ++M+ A   +V +HLP+DFVTA++FAEDA T  ATIESGIP+GWMGLDIG K++  F KVI+R+KTI+WNGPMGVFE DKFA G+   M+ VV+ATKNGA TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK LPG+  L 
Sbjct:    6 KLSISDVDLKDKRVLIRVDFNVPMKDGKVTNTQRIAAAIPTIKYALDKGAKSVVLMSHLGRPDGYKVEKYSLKPVCSEVSKLLGKEVTFLSDCVGPDVISACSNPAPGSVFLLENLRFHIEEEGKGVSPSGDKTKATADQIKAFSESLTKLGDVYVNDAFGTAHRAHASMVGCQLPQKACGFLMNKELTYFAKALENPERPFLAILGGAKVSDKIQLINNMLDKVNELIIGGGMAYTFLKQIHNMHIGASLFDAPGAEIVQKVMETAKAKHVAIHLPVDFVTADKFAEDANTGTATIESGIPDGWMGLDIGPKTIEEFRKVISRAKTIVWNGPMGVFEMDKFAAGTKAAMDAVVEATKNGATTIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKQLPGVVALT 414          
BLAST of Phosphoglycerate kinase vs. TrEMBL
Match: C1LT16 (Phosphoglycerate kinase OS=Schistosoma japonicum OX=6182 GN=PGK1 PE=2 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 269/409 (65.77%), Postives = 324/409 (79.22%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            KL I ++++K+KRVL+RVDFNVPMK+G +TN QRI  AIPTIK AL   AKS+VL+SHLGRP G K EKY+L+PV   +SK+L   V FL DC+G  +  A      GSVFLLENLRF++EEEGKGVS SG K +A A  + +F + LTKLG +YVNDAFGTAHRAHASMVG  LP +  G LM KEL YF +AL+NP+RPFLAILGGAKV+DKI LI N+LDK+NELII GGMA+TFLK +HNM IG SL+D  GA +VQ++M+ A   +V +HLP+DFVTA++FAEDA T  ATIESGIP+GWMGLDIG K++  F KVI+R+KTI+WNGPMGVFE DKFA G+   M+ VV+ATKNGA TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK LPG+  L 
Sbjct:    5 KLSISDVDLKDKRVLIRVDFNVPMKDGKVTNTQRIAAAIPTIKYALDKGAKSVVLMSHLGRPDGYKVEKYSLKPVCSEVSKLLGKEVTFLSDCVGPDVISACSNPAPGSVFLLENLRFHIEEEGKGVSPSGDKTKATADQIKAFSESLTKLGDVYVNDAFGTAHRAHASMVGCQLPQKACGFLMNKELTYFAKALENPERPFLAILGGAKVSDKIQLINNMLDKVNELIIGGGMAYTFLKQIHNMHIGASLFDAPGAEIVQKVMETAKAKHVAIHLPVDFVTADKFAEDANTGTATIESGIPDGWMGLDIGPKTIEEFRKVISRAKTIVWNGPMGVFEMDKFAAGTKAAMDAVVEATKNGATTIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKQLPGVVALT 413          
BLAST of Phosphoglycerate kinase vs. TrEMBL
Match: C1LAJ2 (Phosphoglycerate kinase OS=Schistosoma japonicum OX=6182 GN=PGK1 PE=2 SV=1)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 270/409 (66.01%), Postives = 324/409 (79.22%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            KL I ++++K KRVL+RVDFNVPMK+G +TN QRI  AIPTIK AL   AKS+VL+SHLGRP G K EKY+L+PV   +SK+L   V FL DC+G  + +A      GSVFLLENLRF++EEEGKGVS SG K +A A  V +F + LTKLG +YVNDAFGTAHRAHASMVG  LP +  G LM KEL YF +AL+NP+RPFLAILGGAKV+DKI LI N+LDK+NELII GGMA+TFLK +HNM IG SL+D  GA +VQ++M+ A   +V +HLP+DFVTA++FAEDA T  ATIESGIP+GWMGLDIG K++  F KVI+R+KTI+WNGPMGVFE DKFA G+   M+ VV+ATKNGA TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK LPG+  L 
Sbjct:    5 KLSISDVDLKGKRVLIRVDFNVPMKDGKVTNTQRIAAAIPTIKYALDKGAKSVVLMSHLGRPDGNKVEKYSLKPVCSEVSKLLGKEVTFLSDCVGPDVINACSNPAPGSVFLLENLRFHVEEEGKGVSLSGDKTKATADQVKAFSESLTKLGDVYVNDAFGTAHRAHASMVGCQLPQKACGFLMNKELTYFAKALENPERPFLAILGGAKVSDKIQLINNMLDKVNELIIGGGMAYTFLKQIHNMNIGASLFDAPGAEIVQKVMETAKAKHVAIHLPVDFVTADKFAEDANTGTATIESGIPDGWMGLDIGPKTIEEFRKVISRAKTIVWNGPMGVFEMDKFAAGTKAAMDAVVEATKNGATTIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKQLPGVVALT 413          
BLAST of Phosphoglycerate kinase vs. TrEMBL
Match: B3W661 (Phosphoglycerate kinase OS=Schistosoma japonicum OX=6182 GN=PGK1 PE=2 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 269/409 (65.77%), Postives = 324/409 (79.22%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            KL I ++++K KRVL+RVDFNVPMK+G +TN QRI  AIPTIK AL   AKS+VL+SHLGRP G K EKY+L+PV   +SK+L   V FL DC+G  + +A      GSVFLLENLRF++EEEGKGVS SG K +A A  + +F + LTKLG +YVNDAFGTAHRAHASMVG  LP +  G LM KEL YF +AL+NP+RPFLAILGGAKV+DKI LI N+LDK+NELII GGMA+TFLK +HNM IG SL+D  GA +VQ++M+ A   +V +HLP+DFVTA++FAEDA T  ATIESGIP+GWMGLDIG K++  F KVI+R+KTI+WNGPMGVFE DKFA G+   M+ VV+ATKNGA TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK LPG+  L 
Sbjct:    5 KLSISDVDLKGKRVLIRVDFNVPMKDGKVTNTQRIAAAIPTIKYALDKGAKSVVLMSHLGRPDGNKVEKYSLKPVCSEVSKLLGKEVTFLSDCVGPDVINACSNPAPGSVFLLENLRFHVEEEGKGVSLSGDKTKATADQIKAFSESLTKLGDVYVNDAFGTAHRAHASMVGCQLPQKACGFLMNKELTYFAKALENPERPFLAILGGAKVSDKIQLINNMLDKVNELIIGGGMAYTFLKQIHNMNIGASLFDAPGAEIVQKVMETAKAKHVAIHLPVDFVTADKFAEDANTGTATIESGIPDGWMGLDIGPKTIEEFRKVISRAKTIVWNGPMGVFEMDKFAAGTKAAMDAVVEATKNGATTIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKQLPGVVALT 413          
BLAST of Phosphoglycerate kinase vs. TrEMBL
Match: C1LT13 (Phosphoglycerate kinase OS=Schistosoma japonicum OX=6182 GN=PGK1 PE=2 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 268/409 (65.53%), Postives = 324/409 (79.22%), Query Frame = 1
Query:  115 KLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            KL I ++++K KRVL+RVDFNVPMK+G +TN QRI  AIPTIK AL   AKS+VL+SHLGRP G K EKY+L+PV   +SK+L   V FL DC+G  + +A      GSVFLLENLRF++EEEGKGVS SG K +A A  + +F + LTKLG +YVNDAFGTAHRAHASMVG  LP +  G LM KEL YF +AL+NP+RPFLAILGGAKV+DKI LI N+LDK+NELII GGMA+TFLK +HNM IG SL+D  GA +VQ++M+ A   +V +HLP+DFVTA++FAEDA T  +TIESGIP+GWMGLDIG K++  F KVI+R+KTI+WNGPMGVFE DKFA G+   M+ VV+ATKNGA TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK LPG+  L 
Sbjct:    5 KLSISDVDLKGKRVLIRVDFNVPMKDGKVTNTQRIAAAIPTIKYALDKGAKSVVLMSHLGRPDGNKVEKYSLKPVCSEVSKLLGKEVTFLSDCVGPDVINACSNPAPGSVFLLENLRFHVEEEGKGVSLSGDKTKATADQIKAFSESLTKLGDVYVNDAFGTAHRAHASMVGCQLPQKACGFLMNKELTYFAKALENPERPFLAILGGAKVSDKIQLINNMLDKVNELIIGGGMAYTFLKQIHNMNIGASLFDAPGAEIVQKVMETAKAKHVAIHLPVDFVTADKFAEDANTGTSTIESGIPDGWMGLDIGPKTIEEFRKVISRAKTIVWNGPMGVFEMDKFAAGTKAAMDAVVEATKNGATTIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKQLPGVVALT 413          
BLAST of Phosphoglycerate kinase vs. Ensembl Cavefish
Match: pgk1 (phosphoglycerate kinase 1 [Source:NCBI gene;Acc:103037587])

HSP 1 Score: 501.516 bits (1290), Expect = 3.824e-173
Identity = 243/414 (58.70%), Postives = 316/414 (76.33%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MRVDFNVPMK+  ITN QRI  A+P+I+  L   AK++VL+SHLGRP G    +KY+L PV   L  +L   V FL DC+G  +E A  +   GSV LLENLRF++ EEGKG   +G K +A+  ++ SF   L+KLG IYVNDAFGTAHRAH+SMVGV+LP + AG LMKKEL YF  AL+ PQRPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L NMEIG SL+D +G+ +V+ +M +A    V + LP+DFV A++F E+A+T+ AT+E+GIP  WMGLD G +S   +++ ++R+K I+WNGP+GVFE+D FAKG+   M++VV+ TKNG +TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK+LPG+  L+S
Sbjct:    3 LSNKLTLDKVDVKGKRVIMRVDFNVPMKDKAITNNQRIKAAVPSIQHCLDNGAKAVVLMSHLGRPDGVPMPDKYSLEPVVAELKTLLGKDVTFLKDCVGPEVEKACADPAAGSVILLENLRFHVAEEGKGKDAAGNKTKASQEEINSFRASLSKLGDIYVNDAFGTAHRAHSSMVGVDLPQKAAGFLMKKELDYFAMALEKPQRPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLKNMEIGTSLFDEEGSKIVKDLMAKAEKNGVKITLPVDFVIADKFDENAKTNTATVEAGIPADWMGLDCGPESSKVYSEAVSRAKQIVWNGPVGVFEWDNFAKGTKNLMDKVVEVTKNGCITIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKVLPGVDALSS 416          
BLAST of Phosphoglycerate kinase vs. Ensembl Cavefish
Match: pgk1 (phosphoglycerate kinase 1 [Source:NCBI gene;Acc:103037587])

HSP 1 Score: 463.766 bits (1192), Expect = 1.435e-158
Identity = 230/414 (55.56%), Postives = 302/414 (72.95%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQG-RKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++VK KRV+MR                 I  A+P+I+  L   AK++VL+SHLGRP G    +KY+L PV   L  +L   V FL DC+G  +E A  +   GSV LLENLRF++ EEGKG   +G K +A+  ++ SF   L+KLG IYVNDAFGTAHRAH+SMVGV+LP + AG LMKKEL YF  AL+ PQRPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L NMEIG SL+D +G+ +V+ +M +A    V + LP+DFV A++F E+A+T+ AT+E+GIP  WMGLD G +S   +++ ++R+K I+WNGP+GVFE+D FAKG+   M++VV+ TKNG +TIIGGGDTA+CCAK+++   VSHVSTGGGASLELLEGK+LPG+  L+S
Sbjct:    3 LSNKLTLDKVDVKGKRVIMR-----------------IKAAVPSIQHCLDNGAKAVVLMSHLGRPDGVPMPDKYSLEPVVAELKTLLGKDVTFLKDCVGPEVEKACADPAAGSVILLENLRFHVAEEGKGKDAAGNKTKASQEEINSFRASLSKLGDIYVNDAFGTAHRAHSSMVGVDLPQKAAGFLMKKELDYFAMALEKPQRPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLKNMEIGTSLFDEEGSKIVKDLMAKAEKNGVKITLPVDFVIADKFDENAKTNTATVEAGIPADWMGLDCGPESSKVYSEAVSRAKQIVWNGPVGVFEWDNFAKGTKNLMDKVVEVTKNGCITIIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKVLPGVDALSS 399          
BLAST of Phosphoglycerate kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002727.1 (pep scaffold:Pmarinus_7.0:GL491524:864:2355:-1 gene:ENSPMAG00000002492.1 transcript:ENSPMAT00000002727.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.614 bits (405), Expect = 6.486e-47
Identity = 74/100 (74.00%), Postives = 89/100 (89.00%), Query Frame = 1
Query:  556 LTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEI 855
            L+KLG IYVNDAFGTAHRAH+SMVG +LP++ AG LMKKEL YF +AL+ P+RPFLAILGGAKV DKI LI NLLDK++E+I+ GGMA+TFLK+LHNME+
Sbjct:   17 LSKLGDIYVNDAFGTAHRAHSSMVGCDLPIKAAGFLMKKELDYFAKALEKPERPFLAILGGAKVKDKIQLINNLLDKVDEMIVGGGMAYTFLKVLHNMEV 116          
BLAST of Phosphoglycerate kinase vs. Ensembl Yeast
Match: PGK1 (3-phosphoglycerate kinase; catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis [Source:SGD;Acc:S000000605])

HSP 1 Score: 453.751 bits (1166), Expect = 2.485e-155
Identity = 225/412 (54.61%), Postives = 292/412 (70.87%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            +  KL + ++++K+KRV +RVDFNVP+    IT+ QRI  A+PTIK  L    + +VL SHLGRP G ++EKY+L PVA  L  +L   V FL DC+G  +E AV  S  GSV LLENLR+++EEEG    + GQK++A+  DV  F   L+ L  +Y+NDAFGTAHRAH+SMVG +LP R AG L++KELKYF +AL+NP RPFLAILGGAKV DKI LI NLLDK++ +II GGMAFTF K+L N EIG S++D  GA +V ++M++A    V V LP+DF+ A+ F+ DA T   T + GIP GW GLD G +S   F   +A++KTI+WNGP GVFEF+KFA G+   ++EVVK++  G   IIGGGDTA+   K+     +SHVSTGGGASLELLEGK LPG+  L+
Sbjct:    3 LSSKLSVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRYVVLASHLGRPNGERNEKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHIEEEGSRKVD-GQKVKASKEDVQKFRHELSSLADVYINDAFGTAHRAHSSMVGFDLPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMAFTFKKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVDFIIADAFSADANTKTVTDKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKSSAAGNTVIIGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLS 413          
BLAST of Phosphoglycerate kinase vs. Ensembl Yeast
Match: YCR013C_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; transcription of both YCR013C and the overlapping essential gene PGK1 is reduced in a gcr1 null mutant [Source:SGD;Acc:S000000606])

HSP 1 Score: 98.2117 bits (243), Expect = 8.476e-24
Identity = 80/188 (42.55%), Postives = 99/188 (52.66%), Query Frame = -2
Query:  762 PGKILPSKSSRLAPPPVLT*LTKCAELNLAQQLAVSPPPIIVTAPFFVAFTTSSMQYIDPLANLSNSNTPIGPFQMIVXXXXXXXXXXXXXXDPISRPIQPFGIPLSIVAYEVRASSANLFAVTKSSGK*TVTLQTEALFMILCTIRAPSKS*RLTPISILCNILRKVNAIPPVMXXXXXXXSKLNIR 1325
            PG  LPS +S+ APPPV T             +AVSPPP++   P     TTSS + + P AN SNS TP GPFQ +VL  A    N   D  P+S P QP GIP   V   V AS+    A+ KS+GK T T    A  +   TI AP+ S   +PIS+      KV AIPP M+    LS+KL+I 
Sbjct:   28 PGNSLPSNNSKEAPPPVETWEILSVTPYFLATVAVSPPPMMTVLPAAELLTTSSNKALVPAANFSNSKTPGGPFQTMVLAFATVAANNFLDSGPLSNPCQPAGIPSLSVTVLVLASAEKASAMMKSTGKTTSTPLALAFSINFGTISAPALSKMESPISVFSKTFLKVKAIPPPMMIESTLSNKLSIN 215          
BLAST of Phosphoglycerate kinase vs. Ensembl Nematostella
Match: EDO25387 (Phosphoglycerate kinase [Source:UniProtKB/TrEMBL;Acc:A8DWM3])

HSP 1 Score: 152.14 bits (383), Expect = 2.996e-43
Identity = 67/137 (48.91%), Postives = 97/137 (70.80%), Query Frame = 1
Query:  928 VTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVL 1338
            V +HLP+D + A+ F+ DA+T    + + IP GW GLD G +S+A F+ ++  SKTI+WNGP+GVFE + FAKG++   E + KATKNGA +++GGGD+ +   +F     +S+VSTGGGA LE+LEG +LPGI  +
Sbjct:    3 VQIHLPVDVIGADAFSNDAKTQVFDVNA-IPEGWQGLDAGPRSLAIFDTLLLNSKTILWNGPLGVFEMESFAKGTIALGESIAKATKNGAFSLVGGGDSVAAVKQFGLEEKMSYVSTGGGAMLEMLEGSVLPGIEAI 138          
BLAST of Phosphoglycerate kinase vs. Ensembl Medaka
Match: pgk1 (phosphoglycerate kinase 1 [Source:NCBI gene;Acc:100049274])

HSP 1 Score: 485.337 bits (1248), Expect = 1.055e-166
Identity = 244/414 (58.94%), Postives = 309/414 (74.64%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRK-DEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++V  KRV+MRVDFNVPMK   ITN QRI  A+P+I+  L   AKS+VL+SHLGRP G    EKY+L PVA  L  +L   V FL DC+G  +E A      GSV LLENLRF++EEEGKG   +G K +A    +  F   L+KLG +Y+NDAFGTAHRAH+SMVGVNLP + AG LMKKEL YF  AL+ PQRPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SL+D +GA +V+ +M +A    V + LP+DF+TA++F E A T  AT+ +GIP GWMGLD G +S  A+ + + R+K I+WNGP+GVFE++ FAKG+   M++VV+ T+ G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK+LPG+  L+S
Sbjct:    3 LSNKLTLDKVDVNGKRVVMRVDFNVPMKGRQITNNQRIKAAVPSIQHCLDHGAKSVVLMSHLGRPDGNAMPEKYSLEPVAAELKSLLGRDVAFLKDCVGPDVEAACANPAAGSVILLENLRFHVEEEGKGKDAAGNKTKATQEQIDVFRASLSKLGDVYINDAFGTAHRAHSSMVGVNLPQKAAGFLMKKELDYFAMALEKPQRPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAAIVKDLMAKAEKNGVKITLPVDFITADKFDEKAATGTATVAAGIPAGWMGLDCGPESSKAYAEAVGRAKQIVWNGPVGVFEWENFAKGTKNLMDKVVEVTQAGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVEALSS 416          
BLAST of Phosphoglycerate kinase vs. Ensembl Medaka
Match: pgk1 (phosphoglycerate kinase 1 [Source:NCBI gene;Acc:100049274])

HSP 1 Score: 471.47 bits (1212), Expect = 3.053e-161
Identity = 238/404 (58.91%), Postives = 301/404 (74.50%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRK-DEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGK 1314
            +  KL +D+++V  KRV+MRVDFNVPMK   ITN QRI  A+P+I+  L   AKS+VL+SHLGRP G    EKY+L PVA  L  +L   V FL DC+G  +E A      GSV LLENLRF++EEEGKG   +G K +A    +  F   L+KLG +Y+NDAFGTAHRAH+SMVGVNLP + AG LMKKEL YF  AL+ PQRPFLAILGGAKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SL+D +GA +V+ +M +A    V + LP+DF+TA++F E A T  AT+ +GIP GWMGLD G +S  A+ + + R+K I+WNGP+GVFE++ FAKG+   M++VV+ T+ G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEG+
Sbjct:    3 LSNKLTLDKVDVNGKRVVMRVDFNVPMKGRQITNNQRIKAAVPSIQHCLDHGAKSVVLMSHLGRPDGNAMPEKYSLEPVAAELKSLLGRDVAFLKDCVGPDVEAACANPAAGSVILLENLRFHVEEEGKGKDAAGNKTKATQEQIDVFRASLSKLGDVYINDAFGTAHRAHSSMVGVNLPQKAAGFLMKKELDYFAMALEKPQRPFLAILGGAKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAAIVKDLMAKAEKNGVKITLPVDFITADKFDEKAATGTATVAAGIPAGWMGLDCGPESSKAYAEAVGRAKQIVWNGPVGVFEWENFAKGTKNLMDKVVEVTQAGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGE 406          
BLAST of Phosphoglycerate kinase vs. Ensembl Medaka
Match: pgk1 (phosphoglycerate kinase 1 [Source:NCBI gene;Acc:100049274])

HSP 1 Score: 402.519 bits (1033), Expect = 5.719e-135
Identity = 213/414 (51.45%), Postives = 275/414 (66.43%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRK-DEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNS 1344
            +  KL +D+++V  KRV+MRVDFNVPMK   ITN QRI  A+P+I+  L   AKS+VL+SHLGRP G    EKY+L PVA  L  +L   V FL DC+G  +E A      GSV LLENLRF++EEEGKG   +G K +A    +  F   L+KLG +Y+NDAFGTAHRAH                                         AKV DKI LI N+LDK+NE+II GGMAFTFLK+L+NMEIG SL+D +GA +V+ +M +A    V + LP+DF+TA++F E A T  AT+ +GIP GWMGLD G +S  A+ + + R+K I+WNGP+GVFE++ FAKG+   M++VV+ T+ G +TIIGGGDTA+CCAK+N+   VSHVSTGGGASLELLEGK+LPG+  L+S
Sbjct:    3 LSNKLTLDKVDVNGKRVVMRVDFNVPMKGRQITNNQRIKAAVPSIQHCLDHGAKSVVLMSHLGRPDGNAMPEKYSLEPVAAELKSLLGRDVAFLKDCVGPDVEAACANPAAGSVILLENLRFHVEEEGKGKDAAGNKTKATQEQIDVFRASLSKLGDVYINDAFGTAHRAHR----------------------------------------AKVKDKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAAIVKDLMAKAEKNGVKITLPVDFITADKFDEKAATGTATVAAGIPAGWMGLDCGPESSKAYAEAVGRAKQIVWNGPVGVFEWENFAKGTKNLMDKVVEVTQAGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVEALSS 376          
BLAST of Phosphoglycerate kinase vs. Planmine SMEST
Match: SMESG000048946.1 (SMESG000048946.1)

HSP 1 Score: 1268.06 bits (3280), Expect = 0.000e+0
Identity = 627/627 (100.00%), Postives = 627/627 (100.00%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNSYDPRLDEGWKMAEVVDDLEKISETGVAVKAKLGDDEEKEEYICPYREHKCACSEVPERFPCETCVYPFDCQCPGMQHPLDTTAKGCGATEXXXXXXXXXXXXVDITCKKKVMKKCHPCIPKSDLEYRYNLFPERSIVCTTNIKPSDHPHNDDIFNCIDCETFFNRNIPFVNNTWCQGNPCYCYKIEYPDNYLNCFSCANESGLCDTEPPFTMMN 1986
            MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNSYDPRLDEGWKMAEVVDDLEKISETGVAVKAKLGDDEEKEEYICPYREHKCACSEVPERFPCETCVYPFDCQCPGMQHPLDTTAKGCGATEKLCKTLKCPLCCVDITCKKKVMKKCHPCIPKSDLEYRYNLFPERSIVCTTNIKPSDHPHNDDIFNCIDCETFFNRNIPFVNNTWCQGNPCYCYKIEYPDNYLNCFSCANESGLCDTEPPFTMMN
Sbjct:    1 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLNSYDPRLDEGWKMAEVVDDLEKISETGVAVKAKLGDDEEKEEYICPYREHKCACSEVPERFPCETCVYPFDCQCPGMQHPLDTTAKGCGATEKLCKTLKCPLCCVDITCKKKVMKKCHPCIPKSDLEYRYNLFPERSIVCTTNIKPSDHPHNDDIFNCIDCETFFNRNIPFVNNTWCQGNPCYCYKIEYPDNYLNCFSCANESGLCDTEPPFTMMN 627          
BLAST of Phosphoglycerate kinase vs. Planmine SMEST
Match: SMESG000039090.1 (SMESG000039090.1)

HSP 1 Score: 513.457 bits (1321), Expect = 5.511e-178
Identity = 247/412 (59.95%), Postives = 319/412 (77.43%), Query Frame = 1
Query:  106 MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALRGKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEYIEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKCLTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKNPQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEIGVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATIESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSMYCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELLEGKILPGIRVLN 1341
            + +KL +D++++ NKRVL+RVDFNVPMK+G ITN QR+  A+PTIK AL   AKS+VL+SHLGRP G  ++KY+L PVA  +SK+L   V FL DC+G+ +  A      GS+FLLENLRF++EEEGKGV  SG K++A+A +V  F +CLT LG +YVNDAFGTAHRAHASMVG +LP + +G L+K EL YF +AL+NP RPFLAI+GGAKV+DKI+LI N+L+ ++ELIITGGMAFTFLK+L+NMEIG SL+D  G+ +VQ I+ +A   NV +HLP+DFVT ++F E A+  +AT+ +G+P G MGLD G +++  F   I R+KTI+WNGPMGVFEF+ F  G+   M+ VV  TK GA TIIGGGDTA+CCAK+ +   VSHVSTGGGASLELLEGKILPG+  L+
Sbjct:    3 LSKKLSVDKLDLANKRVLIRVDFNVPMKDGKITNNQRLVAAMPTIKYALEKNAKSVVLMSHLGRPDGTPNKKYSLEPVAAEVSKLLGKDVKFLHDCVGDAVISACKNPAHGSIFLLENLRFHVEEEGKGVDASGNKIKASAEEVKKFSECLTSLGDVYVNDAFGTAHRAHASMVGCSLPQKASGFLLKTELTYFAKALENPARPFLAIIGGAKVSDKILLIKNMLNIVDELIITGGMAFTFLKVLNNMEIGNSLFDEAGSKIVQEIINKAKEKNVKIHLPVDFVTGDKFDEHAKVGHATLATGVPVGSMGLDCGKETMKEFCSAIHRAKTIVWNGPMGVFEFENFCHGTKAAMDAVVDVTKAGATTIIGGGDTATCCAKWGTEDKVSHVSTGGGASLELLEGKILPGVAALS 414          
The following BLAST results are available for this feature:
BLAST of Phosphoglycerate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PGK14.372e-17760.39phosphoglycerate kinase 1 [Source:HGNC Symbol;Acc:... [more]
PGK24.081e-17158.94phosphoglycerate kinase 2 [Source:HGNC Symbol;Acc:... [more]
PGK18.364e-16460.31phosphoglycerate kinase 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgk-11.325e-17861.12Probable phosphoglycerate kinase [Source:UniProtK... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgk4.383e-17461.46gene:FBgn0250906 transcript:FBtr0077739[more]
Pgk4.383e-17461.46gene:FBgn0250906 transcript:FBtr0330718[more]
Pgk4.383e-17461.46gene:FBgn0250906 transcript:FBtr0330716[more]
Pgk4.383e-17461.46gene:FBgn0250906 transcript:FBtr0334162[more]
Pgk4.383e-17461.46gene:FBgn0250906 transcript:FBtr0330717[more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgk17.096e-17659.90phosphoglycerate kinase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd6l3.281e-17258.70major facilitator superfamily domain containing 6-... [more]
mfsd6l2.876e-16458.60major facilitator superfamily domain containing 6-... [more]
mfsd6l1.294e-15755.31major facilitator superfamily domain containing 6-... [more]
mfsd6l1.718e-15755.31major facilitator superfamily domain containing 6-... [more]
mfsd6l1.565e-14955.05major facilitator superfamily domain containing 6-... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pgk11.781e-17760.14phosphoglycerate kinase 1 [Source:MGI Symbol;Acc:M... [more]
Pgk24.806e-17560.14phosphoglycerate kinase 2 [Source:MGI Symbol;Acc:M... [more]
Pgk14.436e-10161.60phosphoglycerate kinase 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Phosphoglycerate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41759|PGK_SCHMA0.000e+064.55Phosphoglycerate kinase OS=Schistosoma mansoni OX=... [more]
sp|P00559|PGK1_HORSE3.151e-17960.87Phosphoglycerate kinase 1 OS=Equus caballus OX=979... [more]
sp|P16617|PGK1_RAT7.706e-17860.39Phosphoglycerate kinase 1 OS=Rattus norvegicus OX=... [more]
sp|P91427|PGK_CAEEL1.686e-17761.12Probable phosphoglycerate kinase OS=Caenorhabditis... [more]
sp|P50310|PGK1_CRIGR2.493e-17760.39Phosphoglycerate kinase 1 OS=Cricetulus griseus OX... [more]
back to top
BLAST of Phosphoglycerate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q86DX70.000e+065.77Phosphoglycerate kinase (Fragment) OS=Schistosoma ... [more]
C1LT160.000e+065.77Phosphoglycerate kinase OS=Schistosoma japonicum O... [more]
C1LAJ20.000e+066.01Phosphoglycerate kinase OS=Schistosoma japonicum O... [more]
B3W6610.000e+065.77Phosphoglycerate kinase OS=Schistosoma japonicum O... [more]
C1LT130.000e+065.53Phosphoglycerate kinase OS=Schistosoma japonicum O... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pgk13.824e-17358.70phosphoglycerate kinase 1 [Source:NCBI gene;Acc:10... [more]
pgk11.435e-15855.56phosphoglycerate kinase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002727.16.486e-4774.00pep scaffold:Pmarinus_7.0:GL491524:864:2355:-1 gen... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PGK12.485e-15554.613-phosphoglycerate kinase; catalyzes transfer of h... [more]
YCR013C_mRNA8.476e-2442.55Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO253872.996e-4348.91Phosphoglycerate kinase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgk11.055e-16658.94phosphoglycerate kinase 1 [Source:NCBI gene;Acc:10... [more]
pgk13.053e-16158.91phosphoglycerate kinase 1 [Source:NCBI gene;Acc:10... [more]
pgk15.719e-13551.45phosphoglycerate kinase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phosphoglycerate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000048946.10.000e+0100.00SMESG000048946.1[more]
SMESG000039090.15.511e-17859.95SMESG000039090.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013285 ID=SMED30013285|Name=Phosphoglycerate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2061bp
TCCGATCTCCGATGCAATATTTGATAAATTTACGTATTATCGTGAGTTCG
TAAATTAAGTGTCGCATCTGTACCTACGGCCAGGAAGGTGTTAATTTTTC
GGGAAATGGACAGAAAGCTTTGTATAGACGAAATAAATGTTAAAAATAAA
AGAGTTTTAATGAGAGTCGATTTCAATGTGCCCATGAAGAACGGGGTCAT
TACCAACATGCAGAGAATCACTGAGGCCATTCCTACAATAAAATTAGCAC
TGAGGGGCAAAGCTAAATCAATTGTATTAATAAGTCATCTGGGTCGACCC
CAAGGAAGGAAGGATGAAAAGTACACGTTAAGACCAGTTGCTGTGGTGCT
TAGCAAAATATTGGACATCACTGTCCATTTTCTGCCTGATTGCATAGGAG
AATACATTGAAGATGCAGTTATGGAATCACCAGATGGTTCTGTGTTTCTG
CTGGAGAATTTGAGGTTTTATCTGGAAGAAGAGGGGAAAGGTGTGAGTGA
ATCTGGTCAAAAACTGAGAGCAAATGCAGCTGACGTCGCATCATTTGGGA
AATGTTTAACAAAATTAGGCTACATCTACGTCAATGATGCATTTGGGACT
GCCCATAGAGCTCATGCCTCAATGGTGGGAGTAAATTTGCCATTACGGGT
GGCAGGGTTGTTAATGAAGAAGGAATTAAAATACTTCAATAGAGCTTTAA
AGAATCCACAAAGACCTTTCTTAGCAATTTTAGGCGGTGCAAAGGTGAAC
GATAAAATAGTCCTGATATTTAATTTACTTGATAAAATTAATGAACTGAT
CATTACTGGCGGAATGGCGTTCACTTTCCTCAAGATATTGCACAATATGG
AGATTGGCGTGAGCCTTTACGATTTGGATGGGGCTCTGATGGTGCAGAGG
ATCATGAAGAGGGCTTCTGTTTGCAATGTTACAGTTCATTTGCCGCTCGA
TTTTGTTACCGCGAACAGATTCGCTGAAGATGCTCGAACCTCGTATGCCA
CAATCGAAAGTGGAATACCGAATGGCTGGATGGGCCTGGATATTGGATCT
AAGTCGGTAGCGGCATTTAACAAGGTAATTGCAAGAAGTAAAACGATCAT
TTGGAACGGACCGATGGGCGTATTTGAATTTGATAAATTTGCCAAAGGAT
CAATGTACTGCATGGAGGAAGTTGTGAAGGCAACAAAAAATGGCGCAGTG
ACAATAATAGGCGGGGGTGATACGGCCAGTTGTTGTGCCAAATTCAATTC
CGCGCATTTAGTCAGTCATGTCAGCACCGGAGGAGGCGCTAGTCTTGAAC
TTTTGGAAGGCAAAATCTTACCGGGAATCCGAGTGCTCAATAGTTATGAC
CCCCGGCTAGATGAAGGGTGGAAAATGGCTGAAGTTGTTGACGATTTAGA
GAAGATTTCCGAAACCGGTGTTGCTGTCAAAGCAAAATTAGGTGATGATG
AGGAAAAGGAGGAATATATTTGTCCTTATCGAGAACATAAATGTGCTTGT
TCTGAAGTTCCTGAAAGGTTCCCTTGCGAAACCTGTGTTTATCCATTCGA
CTGTCAGTGTCCAGGAATGCAGCACCCGCTGGACACGACGGCAAAAGGTT
GCGGGGCGACGGAAAAGCTTTGTAAAACATTGAAGTGTCCCTTATGCTGT
GTTGACATAACATGCAAGAAAAAGGTTATGAAAAAATGTCATCCTTGCAT
ACCGAAATCGGATCTGGAATATCGATATAATCTTTTCCCTGAACGGTCAA
TCGTATGCACCACAAACATAAAGCCCAGTGATCACCCCCACAACGATGAT
ATTTTCAATTGCATTGATTGCGAGACATTCTTCAACCGGAATATTCCTTT
TGTAAATAACACCTGGTGCCAGGGTAACCCTTGCTACTGCTATAAAATCG
AATATCCTGACAATTACCTTAACTGCTTTTCCTGTGCCAACGAAAGTGGC
CTATGTGATACCGAGCCCCCCTTTACAATGATGAACTGATTGGAGGATTC
AATTATTACGCACTTGTTTGAACCGGATAACAAATAAATTTACTTTATCA
CAATAAAAAAA
back to top

protein sequence of SMED30013285-orf-1

>SMED30013285-orf-1 ID=SMED30013285-orf-1|Name=SMED30013285-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=628bp
MDRKLCIDEINVKNKRVLMRVDFNVPMKNGVITNMQRITEAIPTIKLALR
GKAKSIVLISHLGRPQGRKDEKYTLRPVAVVLSKILDITVHFLPDCIGEY
IEDAVMESPDGSVFLLENLRFYLEEEGKGVSESGQKLRANAADVASFGKC
LTKLGYIYVNDAFGTAHRAHASMVGVNLPLRVAGLLMKKELKYFNRALKN
PQRPFLAILGGAKVNDKIVLIFNLLDKINELIITGGMAFTFLKILHNMEI
GVSLYDLDGALMVQRIMKRASVCNVTVHLPLDFVTANRFAEDARTSYATI
ESGIPNGWMGLDIGSKSVAAFNKVIARSKTIIWNGPMGVFEFDKFAKGSM
YCMEEVVKATKNGAVTIIGGGDTASCCAKFNSAHLVSHVSTGGGASLELL
EGKILPGIRVLNSYDPRLDEGWKMAEVVDDLEKISETGVAVKAKLGDDEE
KEEYICPYREHKCACSEVPERFPCETCVYPFDCQCPGMQHPLDTTAKGCG
ATEKLCKTLKCPLCCVDITCKKKVMKKCHPCIPKSDLEYRYNLFPERSIV
CTTNIKPSDHPHNDDIFNCIDCETFFNRNIPFVNNTWCQGNPCYCYKIEY
PDNYLNCFSCANESGLCDTEPPFTMMN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR015911Phosphoglycerate_kinase_CS
IPR001576Phosphoglycerate_kinase
IPR015901Phosphoglycerate_kinase_C
IPR015824Phosphoglycerate_kinase_N
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004618phosphoglycerate kinase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity