SMED30013275

Overview
NameSMED30013275
Smed IDSMED30013275
Length (bp)1215
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30013275 (SMED30013275) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30013275 (SMED30013275) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013275 (SMED30013275) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013275 (SMED30013275) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013275

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013275SMESG000063084.1 SmedASXL_071077SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013275SMESG000063084.1 dd_Smed_v4_6478_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013275SMESG000063084.1 dd_Smed_v4_6478_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30013275SMESG000063084.1 dd_Smed_v6_6478_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30013275 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000247:26190..29604 -5909
Homology
BLAST of SMED30013275 vs. Ensembl Human
Match: SYNGR2 (synaptogyrin 2 [Source:HGNC Symbol;Acc:HGNC:11499])

HSP 1 Score: 140.584 bits (353), Expect = 6.011e-39
Identity = 77/236 (32.63%), Postives = 119/236 (50.42%), Query Frame = -2
Query:  390 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG----LQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1067
            FD    L +PQ++ R V L+F++IVF CI   G +N        C++N++  AC + + IGV+AFL +  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T+       K      +++R+AI FS FSI  W  +   A +R++ G    +Q   +P  +                      Y++YPG         NY + PF       + Y PP
Sbjct:   15 FDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNP------KDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTA------------------YASYPGASV-----DNYQQPPFTQNAETTEGYQPP 221          
BLAST of SMED30013275 vs. Ensembl Human
Match: SYNGR2 (synaptogyrin 2 [Source:HGNC Symbol;Acc:HGNC:11499])

HSP 1 Score: 140.584 bits (353), Expect = 6.011e-39
Identity = 77/236 (32.63%), Postives = 119/236 (50.42%), Query Frame = -2
Query:  390 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG----LQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1067
            FD    L +PQ++ R V L+F++IVF CI   G +N        C++N++  AC + + IGV+AFL +  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T+       K      +++R+AI FS FSI  W  +   A +R++ G    +Q   +P  +                      Y++YPG         NY + PF       + Y PP
Sbjct:   15 FDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNP------KDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTA------------------YASYPGASV-----DNYQQPPFTQNAETTEGYQPP 221          
BLAST of SMED30013275 vs. Ensembl Human
Match: SYNGR1 (synaptogyrin 1 [Source:HGNC Symbol;Acc:HGNC:11498])

HSP 1 Score: 132.494 bits (332), Expect = 1.109e-35
Identity = 81/239 (33.89%), Postives = 117/239 (48.95%), Query Frame = -2
Query:  399 FDFASLLVKPQLICRIVSLLFSIIVFGCI------SSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINN----LRSAIVFSLFSIALWAGITFFAVKRFRLGL------QGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQY 1067
            FD  +L+ +P  I R+VS LFSI+VFG I      +S     + C+YN++ +ACS+   +GV+AFL  + ++  DV F  +S++K RK  +L D+G S  W F WFV FCYL N+W  +        K K   +N      R+AI FS FSI  WAG    A +R+++G       Q   +P+ +                    APY    G D  G +G  Y + P N+     Q Y
Sbjct:   15 FDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVS--------KPKDNPLNEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQD---------------SSMPYAPYVEPTGPDPAG-MGGTYQQ-PANTFDTEPQGY 228          
BLAST of SMED30013275 vs. Ensembl Human
Match: SYNGR1 (synaptogyrin 1 [Source:HGNC Symbol;Acc:HGNC:11498])

HSP 1 Score: 125.561 bits (314), Expect = 1.170e-33
Identity = 69/175 (39.43%), Postives = 99/175 (56.57%), Query Frame = -2
Query:  576 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINN----LRSAIVFSLFSIALWAGITFFAVKRFR-LGLQGSF 1067
            FD  +L+ +P  I R+VS LFSI+VFG I + G  N      + C+YN++ +ACS+   +GV+AFL  + ++  DV F  +S++K RK  +L D+G S  W F WFV FCYL N+W  +        K K   +N      R+AI FS FSI  W+     AV+RF+ L  Q  +
Sbjct:   15 FDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVS--------KPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEY 181          
BLAST of SMED30013275 vs. Ensembl Human
Match: SYNGR2 (synaptogyrin 2 [Source:HGNC Symbol;Acc:HGNC:11499])

HSP 1 Score: 123.635 bits (309), Expect = 6.134e-32
Identity = 63/153 (41.18%), Postives = 94/153 (61.44%), Query Frame = -2
Query:  627 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAG 1067
            FD    L +PQ++ R V L+F++IVF CI   G +N        C++N++  AC + + IGV+AFL +  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T+    D L       +++R+AI FS FSI  W G
Sbjct:   15 FDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPK--DVLV----GADSVRAAITFSFFSIFSWVG 161          
BLAST of SMED30013275 vs. Ensembl Celegans
Match: sng-1 (Synaptogyrin homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:O76735])

HSP 1 Score: 100.523 bits (249), Expect = 3.316e-24
Identity = 59/187 (31.55%), Postives = 91/187 (48.66%), Query Frame = -2
Query:  570 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGG------RANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEP 1112
            M+      A  AG  FD  +   KP ++ R  +LLF +I++  +S GG        + VCLY + +S CSFAT +G  A  GAI  I+ D   D +S++  R+  +L D+  S ++T  + + F      WS      +D       + NN +  I+ +L S   W G  FFA +R+  G Q + EP
Sbjct:    1 MENVRAYGAGLAGANFDKNTFFKKPTVLFRCAALLFGLILWYSVSKGGWHKPSDAIHPVCLYGRSSSTCSFATAVGFFAVCGAIVLIVLDAKMDQISSVPTRRRAVLADLVVSAIFTAIFLIGFFTF---WSKLSAFEVDEDDENPIKTNNAKFGILSALLSFLAWGGAAFFAWRRYEEGNQATHEP 184          
BLAST of SMED30013275 vs. Ensembl Fly
Match: Syngr (gene:FBgn0033876 transcript:FBtr0087645)

HSP 1 Score: 131.339 bits (329), Expect = 1.872e-35
Identity = 87/245 (35.51%), Postives = 123/245 (50.20%), Query Frame = -2
Query:  384 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK----VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSF------EPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPF---NSGGMAGQQ----YYPPTY 1067
            FD  +  +KPQ++ R +  LFS++VFGCISS G   K     CLYN D  AC +   +GV  FL ++ F+  + +F+ +S++K RK  ++ D+GFS LWTF +FV+F YL ++WS++    L           ++++AI F LFSI  WA     A KRF +G    F      +PA  + QQ               A  YS    +D   D    Y  +PF     GGM  QQ    Y  PTY
Sbjct:   25 FDPLTFAMKPQVVIRALCWLFSVVVFGCISSEGWTEKDGKEYCLYNGDGMACKYGNMVGVFGFLASMGFMGGEFLFERMSSVKSRKRYVMADMGFSALWTFMYFVAFLYLWSQWSSSAPPPLGI------GAGSMKTAIWFCLFSIVSWALCALMAYKRFLIGAGDEFTSAFETDPANVVHQQ---------------AYGYS----MDNDND---QYSASPFGQPQQGGMEQQQSGMEYQQPTY 241          
BLAST of SMED30013275 vs. Ensembl Zebrafish
Match: syngr3a (synaptogyrin 3a [Source:ZFIN;Acc:ZDB-GENE-050522-541])

HSP 1 Score: 150.214 bits (378), Expect = 9.743e-43
Identity = 92/250 (36.80%), Postives = 128/250 (51.20%), Query Frame = -2
Query:  384 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK-----VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYP-GVDTTGDLGSNYHETPFNSG-GMAGQQYYPPTY 1112
            MD      A +AG  FD  + + +PQ I RI+S +FS++VFG I + G  N       C++NK+N+AC++ T IG+IAFL  I FII D+ F  +S+IK RK  ++ D+GFSG W F WFV FC+L N+W    +T  D L +     +  R+AI FS FSI  WAG+T  AV+++ LG   +     +I+                   P   YP G DT  +    Y   PF          Y  P Y
Sbjct:    1 MDGVGSFGAGRAGAAFDPFAFIQQPQTILRILSWIFSMVVFGSIINEGYVNHGSQRLYCVFNKNNNACNYGTTIGLIAFLACIFFIILDIKFQQISSIKDRKKAVMLDIGFSGFWAFLWFVGFCFLANQW---QRTTTDELPLNQ-GADAARAAITFSFFSIFTWAGLTVRAVQKYMLGTDMTLFTTEHIDGN----------------PPIQPYPTGPDTIPN--DTYKSAPFTENLDTTAPTYQVPIY 228          
BLAST of SMED30013275 vs. Ensembl Zebrafish
Match: syngr2b (synaptogyrin 2b [Source:ZFIN;Acc:ZDB-GENE-070424-19])

HSP 1 Score: 142.895 bits (359), Expect = 7.185e-40
Identity = 82/243 (33.74%), Postives = 122/243 (50.21%), Query Frame = -2
Query:  384 AAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKV------CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPF--NSGGMAGQQYYPPTY 1088
            A+ AG  FD    + +PQ + R +S +F+I+VF  I++ G  N        C++N+++ AC +  GIGVIAFL  + F+++D I   +SN + RK+I++ D+ FSG WTF WFV FC   ++WS T     D   +     + + + I FS FSIA W  +T+FAV RFR G++        + Q        +S        P   YP    TG     Y + PF  N        + PP Y
Sbjct:   10 ASLAGAGFDLVKFIKQPQTVVRFLSWVFAIVVFSSITAEGYVNSTDEAEVRCVFNRNDGACHYGVGIGVIAFLACVGFLLADAILPLISNAQERKYIVMADLAFSGCWTFLWFVCFCLTADQWSKTS----DRSGIP---TDAVHAVIAFSFFSIASWGALTYFAVVRFRQGVE-------EVTQSYTDPPPDLSSPYPSTYTP-PTYPSFQNTG--ADIYQQPPFTPNPDPSGQTSFQPPVY 235          
BLAST of SMED30013275 vs. Ensembl Zebrafish
Match: syngr1a (synaptogyrin 1a [Source:ZFIN;Acc:ZDB-GENE-041010-169])

HSP 1 Score: 140.198 bits (352), Expect = 6.156e-39
Identity = 85/246 (34.55%), Postives = 121/246 (49.19%), Query Frame = -2
Query:  399 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRW--SNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQY 1112
            MD A    A KAG  FD  +   +PQ I RIVS +FSI++FGCI++ G  N+       C++N++ +AC++A G+G + FL    F+  D+ F  +S++K RK  +L D+G S  W+F WFV FC+L N+W  +N     L          +  R+AI F+ FSI  WAG  FF  +R++LG   S                     Q   AAP           D+ +NY      SGG   Q Y
Sbjct:    1 MDQA--YGAGKAGGTFDPITFFQQPQTILRIVSWIFSIVIFGCIANEGYVNRPDEVEEFCIFNRNQNACNYAVGMGALDFLCCAAFLALDIYFPQISSVKDRKKAVLADIGVSAFWSFVWFVGFCFLANQWQVANPEDNPLKE------GADAARAAITFAFFSIFTWAGQAFFGFQRYKLGSSSSL-----------FSQDYTDPSQDPAAAPSEGTEYTGYNADMEANYD----GSGGYQNQDY 223          
BLAST of SMED30013275 vs. Ensembl Zebrafish
Match: syngr3b (synaptogyrin 3b [Source:ZFIN;Acc:ZDB-GENE-070822-6])

HSP 1 Score: 137.117 bits (344), Expect = 1.131e-37
Identity = 82/235 (34.89%), Postives = 123/235 (52.34%), Query Frame = -2
Query:  432 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKV-----CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAY---PGVDTTGDLGSNYHETP 1112
            MD A    A +AG  FD  + + +PQ I R ++ +FS++VF  I + G  N       C++NK+  AC++A  IG++AFL ++ F+  DV F  +S++K RK  +L ++ FSG WTF WFV FC+L N+WS T       L ++    +  R+AI FS FSI  WAG+T  AV+RF LG   +   +  +  Q        +        P +AY   P ++T       Y   P
Sbjct:    1 MDGAGSFGAGRAGSAFDLVAFVKQPQTILRALAWIFSMVVFASIINEGYVNMGSERLHCVFNKNADACNYAITIGIMAFLASVLFLALDVYFPQISSVKDRKRAVLLEIAFSGFWTFLWFVGFCFLANQWSRTSD---KELPLEQ-ASDAARAAIAFSFFSILTWAGLTVCAVQRFLLGTDMTLFTSEQVVNQPPKQTYPSNDVIGQTTIPVNAYQSPPLIETVETRPPGYKVPP 231          
BLAST of SMED30013275 vs. Ensembl Zebrafish
Match: syngr2b (synaptogyrin 2b [Source:ZFIN;Acc:ZDB-GENE-070424-19])

HSP 1 Score: 120.553 bits (301), Expect = 4.446e-32
Identity = 61/160 (38.12%), Postives = 93/160 (58.13%), Query Frame = -2
Query:  627 AAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKV------CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAG 1088
            A+ AG  FD    + +PQ + R +S +F+I+VF  I++ G  N        C++N+++ AC +  GIGVIAFL  + F+++D I   +SN + RK+I++ D+ FSG WTF WFV FC   ++WS T     D   +     + + + I FS FSIA W G
Sbjct:   10 ASLAGAGFDLVKFIKQPQTVVRFLSWVFAIVVFSSITAEGYVNSTDEAEVRCVFNRNDGACHYGVGIGVIAFLACVGFLLADAILPLISNAQERKYIVMADLAFSGCWTFLWFVCFCLTADQWSKTS----DRSGIP---TDAVHAVIAFSFFSIASWMG 162          
BLAST of SMED30013275 vs. Ensembl Xenopus
Match: syngr2 (synaptogyrin 2 [Source:NCBI gene;Acc:448480])

HSP 1 Score: 145.591 bits (366), Expect = 8.027e-41
Identity = 86/241 (35.68%), Postives = 118/241 (48.96%), Query Frame = -2
Query:  384 AAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY 1088
            A KAG  F   + L +P+ I RI+S +F++IVF CI S G  N        C++NK+N AC +  GIG +AFL  I F+  D+    +SN   RK+I+L D+GFS LW+F WFV FC+L N+W+ +     D +       +N R+AI FS FSI  W  +   A KR++ G    F P      Q                    +YP   T      NY   PF +   AG+   PP Y
Sbjct:    8 APKAGGSFSLENFLKRPETILRIISCIFALIVFACIVSDGYTNIPNESKLTCIFNKNNDACHYGVGIGFLAFLACILFLFLDIYLQTLSNANYRKYIVLADLGFSTLWSFLWFVGFCFLANQWAVSTT---DGILTGE---DNARAAIAFSFFSIISWIPLAVLAYKRYKQG--ADFNPDYVDPTQ-------------------DSYPSYPTGA--SDNYQSPPFTNSREAGEYQPPPDY 219          
BLAST of SMED30013275 vs. Ensembl Xenopus
Match: SYNGR3 (synaptogyrin 3 [Source:NCBI gene;Acc:100489723])

HSP 1 Score: 133.265 bits (334), Expect = 3.844e-36
Identity = 78/233 (33.48%), Postives = 117/233 (50.21%), Query Frame = -2
Query:  384 SLLVKPQLICRIVSLLFSIIVFGCISSGGRANK-----VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGS---NYHETPFNSG-GMAGQQYYPPTY 1055
              L +PQ I RI+S +FSI+VFG + + G  N       C+YN+++ AC++A  IGV+AF  +ICF + D+ F  +S++K RK  ++ D+GFS +W+F WFVSFC+L ++W  T               +  R+ IVFS FS+  W      A++R+RLG   S                        G+AP + YPG  T   + S    Y   PF      + + Y  P+Y
Sbjct:   19 EFLKQPQTILRIISWVFSIVVFGSLVNEGSINVDSPELYCVYNQNDDACNYAITIGVVAFFASICFFVVDIYFPQISSVKDRKKAVMIDIGFSAIWSFLWFVSFCFLADQWRKTSYDVPQGA-------DAARAGIVFSFFSVFSWCASAVKAMQRYRLGTDMSLFAGDQF-----------------GSAPNAGYPGYPTGSGIESTTDTYQSPPFTENMDSSTKGYQVPSY 227          
BLAST of SMED30013275 vs. Ensembl Xenopus
Match: aif1l (allograft inflammatory factor 1-like [Source:Xenbase;Acc:XB-GENE-953714])

HSP 1 Score: 127.487 bits (319), Expect = 5.927e-34
Identity = 66/167 (39.52%), Postives = 101/167 (60.48%), Query Frame = -2
Query:  591 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGG------RANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRW--SNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG 1067
            FD  + + +P  + R+VS +FSI+VFGCI + G       A + C++N+++SAC++   +GV+AFL  + ++  DV F  +S++K RK  ++ D+  SGLW FFWFV FC+L N+W  SN +   ++            R+AI FS FSI  WAG    A +R+RLG
Sbjct:   15 FDPQTFVRQPHTVLRMVSWVFSIVVFGCIINEGYINASTEAEEHCIFNRNSSACAYGVTVGVLAFLTCLLYLAVDVYFPQISSVKDRKKTVISDIAVSGLWAFFWFVGFCFLANQWQVSNPNDNPMNEGADA------ARAAIAFSFFSIFTWAGQAVLAYQRYRLG 175          
BLAST of SMED30013275 vs. Ensembl Xenopus
Match: aif1l (allograft inflammatory factor 1-like [Source:Xenbase;Acc:XB-GENE-953714])

HSP 1 Score: 113.235 bits (282), Expect = 4.691e-29
Identity = 66/177 (37.29%), Postives = 103/177 (58.19%), Query Frame = -2
Query:  561 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGG------RANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRW--SNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAAN 1067
            FD  + + +P  + R+VS +FSI+VFGCI + G       A + C++N+++SAC++   +GV+AFL  + ++  DV F  +S++K RK  ++ D+  SGLW FFWFV FC+L N+W  SN +   ++         +  R+AI FS FSI  WA   F AV R +   +  F+   N
Sbjct:   15 FDPQTFVRQPHTVLRMVSWVFSIVVFGCIINEGYINASTEAEEHCIFNRNSSACAYGVTVGVLAFLTCLLYLAVDVYFPQISSVKDRKKTVISDIAVSGLWAFFWFVGFCFLANQWQVSNPNDNPMNE------GADAARAAIAFSFFSIFTWA---FIAVLRHQHLKEIVFQEEYN 182          
BLAST of SMED30013275 vs. Ensembl Xenopus
Match: aif1l (allograft inflammatory factor 1-like [Source:Xenbase;Acc:XB-GENE-953714])

HSP 1 Score: 114.005 bits (284), Expect = 9.628e-27
Identity = 48/117 (41.03%), Postives = 77/117 (65.81%), Query Frame = -2
Query:  735 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGG------RANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWS 1067
            FD  + + +P  + R+VS +FSI+VFGCI + G       A + C++N+++SAC++   +GV+AFL  + ++  DV F  +S++K RK  ++ D+  SGLW FFWFV FC+L N+W 
Sbjct:   15 FDPQTFVRQPHTVLRMVSWVFSIVVFGCIINEGYINASTEAEEHCIFNRNSSACAYGVTVGVLAFLTCLLYLAVDVYFPQISSVKDRKKTVISDIAVSGLWAFFWFVGFCFLANQWQ 131          
BLAST of SMED30013275 vs. Ensembl Mouse
Match: Syngr2 (synaptogyrin 2 [Source:MGI Symbol;Acc:MGI:1328324])

HSP 1 Score: 136.346 bits (342), Expect = 2.055e-37
Identity = 75/236 (31.78%), Postives = 118/236 (50.00%), Query Frame = -2
Query:  390 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG----LQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1067
            FD    L +PQ++ R+VS++ ++IVF CI   G  N        C++N++  AC + + IGV+AFL +  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T       ++V     ++ R+AI FS FSI  W  +   A +R++ G    +Q   +P  +                      Y++YP          NY + PF       + Y PP
Sbjct:   15 FDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCVFNQNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKP---QDVRVGA---DSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQNYVDPTPDPN------------------TAYASYPSASV-----ENYQQPPFTQNVETTEGYQPP 221          
BLAST of SMED30013275 vs. Ensembl Mouse
Match: Syngr1 (synaptogyrin 1 [Source:MGI Symbol;Acc:MGI:1328323])

HSP 1 Score: 130.183 bits (326), Expect = 5.532e-35
Identity = 67/169 (39.64%), Postives = 99/169 (58.58%), Query Frame = -2
Query:  591 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINN----LRSAIVFSLFSIALWAGITFFAVKRFRLG 1067
            FD  +L+ +P  I R+VS +FSI+VFG I + G  N      + C+YN++ +ACS+   +GV+AFL  + ++  DV F  +S++K RK  +L D+G S  W FFWFV FC+L N+W  +        K K   +N      R+AI FS FSI  WAG    A +R+++G
Sbjct:   15 FDPYTLVRQPHTILRVVSWVFSIVVFGSIVNEGYLNNPEEEEEFCIYNRNPNACSYGVTVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFFWFVGFCFLANQWQVS--------KPKDNPLNEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIG 175          
BLAST of SMED30013275 vs. Ensembl Mouse
Match: Syngr1 (synaptogyrin 1 [Source:MGI Symbol;Acc:MGI:1328323])

HSP 1 Score: 124.02 bits (310), Expect = 3.141e-33
Identity = 66/167 (39.52%), Postives = 97/167 (58.08%), Query Frame = -2
Query:  597 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINN----LRSAIVFSLFSIALWAGITFFAVKRFR 1067
            FD  +L+ +P  I R+VS +FSI+VFG I + G  N      + C+YN++ +ACS+   +GV+AFL  + ++  DV F  +S++K RK  +L D+G S  W FFWFV FC+L N+W  +        K K   +N      R+AI FS FSI  W+     AV+RF+
Sbjct:   15 FDPYTLVRQPHTILRVVSWVFSIVVFGSIVNEGYLNNPEEEEEFCIYNRNPNACSYGVTVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFFWFVGFCFLANQWQVS--------KPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFK 173          
BLAST of SMED30013275 vs. Ensembl Mouse
Match: Syngr2 (synaptogyrin 2 [Source:MGI Symbol;Acc:MGI:1328324])

HSP 1 Score: 120.553 bits (301), Expect = 4.764e-32
Identity = 60/151 (39.74%), Postives = 92/151 (60.93%), Query Frame = -2
Query:  633 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALW 1067
            FD    L +PQ++ R+VS++ ++IVF CI   G  N        C++N++  AC + + IGV+AFL +  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T       ++V     ++ R+AI FS FSI  W
Sbjct:   15 FDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCVFNQNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKP---QDVRVGA---DSARAAITFSFFSIFSW 159          
BLAST of SMED30013275 vs. Ensembl Mouse
Match: Syngr3 (synaptogyrin 3 [Source:MGI Symbol;Acc:MGI:1341881])

HSP 1 Score: 121.324 bits (303), Expect = 8.636e-32
Identity = 68/172 (39.53%), Postives = 99/172 (57.56%), Query Frame = -2
Query:  591 AAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG 1088
            A +AG  FD  S   +PQ + R+VS +FSI VFG I + G  N        C++N +  AC F   +G+ AF+  + F++ DV F  +S+++ R+  +L D+GFSG+W+F WFV FC+LTN+W  T               +  R+AI FS FSI  W  +T  A++RFRLG
Sbjct:    8 AGRAGAAFDPVSFARRPQTLLRVVSWVFSIAVFGPIVNEGYVNSDSGPELRCVFNGNAGACRFGVVLGLGAFIACVAFLLLDVRFQQISSVRDRRRAVLLDLGFSGVWSFLWFVGFCFLTNQWQRTTPG-----PGTAQAGDAARAAIAFSFFSILSWVALTVKALQRFRLG 174          
BLAST of SMED30013275 vs. UniProt/SwissProt
Match: sp|A7E3W5|SNG2_BOVIN (Synaptogyrin-2 OS=Bos taurus OX=9913 GN=SYNGR2 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 6.432e-43
Identity = 81/243 (33.33%), Postives = 128/243 (52.67%), Query Frame = -2
Query:  390 AAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG----LQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1088
            A +AG  FD    L +PQ++ R V L+F++IVF CI   G +N      + C++N++  AC + + IGV+AFL +  F + D+ F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T +  +      H + ++ R+AI FS FSI  W  + F A +R++ G    +Q   +P  +                   +  Y++YPGV         Y + PF     + + Y PP
Sbjct:    8 APRAGGSFDLRRFLKQPQVVVRAVCLVFALIVFSCIFGEGYSNTHDSQQQYCVFNRNEDACRYGSAIGVLAFLASAFFFVVDIYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKKNDV------HVEADSARAAITFSFFSIFSWCVLAFLAYQRYKAGVDEFIQNYVDPTPD------------------PSTAYASYPGVP-----ADTYQQPPFTQNAESTEGYQPP 221          
BLAST of SMED30013275 vs. UniProt/SwissProt
Match: sp|O43760|SNG2_HUMAN (Synaptogyrin-2 OS=Homo sapiens OX=9606 GN=SYNGR2 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.887e-38
Identity = 77/236 (32.63%), Postives = 119/236 (50.42%), Query Frame = -2
Query:  390 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG----LQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1067
            FD    L +PQ++ R V L+F++IVF CI   G +N        C++N++  AC + + IGV+AFL +  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T+       K      +++R+AI FS FSI  W  +   A +R++ G    +Q   +P  +                      Y++YPG         NY + PF       + Y PP
Sbjct:   15 FDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNP------KDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTA------------------YASYPGASV-----DNYQQPPFTQNAETTEGYQPP 221          
BLAST of SMED30013275 vs. UniProt/SwissProt
Match: sp|A8MWL6|SNG2L_HUMAN (Putative synaptogyrin-2 like protein OS=Homo sapiens OX=9606 PE=5 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.662e-37
Identity = 79/242 (32.64%), Postives = 122/242 (50.41%), Query Frame = -2
Query:  390 AKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG----LQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1085
            A+AG  FD    L +PQ++ R + L+F++IVF CI   G +N        C++N +  AC + + IGV+AFL A  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T     + + V     ++ R+AI FS FSI  W  +     +R++ G    +Q   +P+ +                      Y++YPG         NY + PF       + Y PP
Sbjct:    9 AEAGGSFDLRPFLTQPQVVARALCLVFALIVFSCIYGEGYSNTHKSKQMYCVFNHNEDACRYGSAIGVLAFL-ASAFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTDP---EDVLVG---ADSARAAITFSFFSIFSWGVLASLTYQRYKAGVDDFIQNYVDPSPDPNTA------------------YASYPGASV-----DNYQQPPFTQNAETTEGYQPP 220          
BLAST of SMED30013275 vs. UniProt/SwissProt
Match: sp|O55101|SNG2_MOUSE (Synaptogyrin-2 OS=Mus musculus OX=10090 GN=Syngr2 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.438e-36
Identity = 75/236 (31.78%), Postives = 118/236 (50.00%), Query Frame = -2
Query:  390 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG----LQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1067
            FD    L +PQ++ R+VS++ ++IVF CI   G  N        C++N++  AC + + IGV+AFL +  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T       ++V     ++ R+AI FS FSI  W  +   A +R++ G    +Q   +P  +                      Y++YP          NY + PF       + Y PP
Sbjct:   15 FDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCVFNQNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKP---QDVRVGA---DSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQNYVDPTPDPN------------------TAYASYPSASV-----ENYQQPPFTQNVETTEGYQPP 221          
BLAST of SMED30013275 vs. UniProt/SwissProt
Match: sp|O54980|SNG2_RAT (Synaptogyrin-2 OS=Rattus norvegicus OX=10116 GN=Syngr2 PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 6.546e-36
Identity = 75/236 (31.78%), Postives = 118/236 (50.00%), Query Frame = -2
Query:  390 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKV------CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG----LQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1067
            FD    + +PQ++ R+VS++ ++IVF CI   G  N        C++N++  AC + + IGV+AFL +  F++ D  F  +SN   RK++++GD+ FS LWTF WFV FC+LTN+W+ T     D + V     ++ R+AI FS FSI  W  +   A +R++ G    +Q   +P  +                      Y++YP          NY + PF       + Y PP
Sbjct:   15 FDLRRYVSQPQVVTRLVSMVLALIVFSCIFGEGYINLHSSDQLHCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKP---DDVLVGA---DSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQNYVDPTPD------------------PTTAYASYPSASV-----ENYQQPPFTQNVETTEGYQPP 221          
BLAST of SMED30013275 vs. TrEMBL
Match: A0A095C9C9 (Synaptogyrin OS=Schistosoma haematobium OX=6185 GN=MS3_07284 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 3.713e-67
Identity = 121/257 (47.08%), Postives = 160/257 (62.26%), Query Frame = -2
Query:  384 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK-VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGL------QGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNS-------GGMAGQQYYPPTY 1112
            M+PANL+SAAK+G        L KP  I R+VS+L S+IVFG ISSG   ++ +C++   +SAC+    IGV AFLG I F+I+D +FD++SNIKRRKHII+GD+GFSGLWTF WFVSFC L N+W+NT   +L   KV+ WQ +N RSAIVFS  SIA+W GITFFA++RFR+G       +G  EP + ++                   P   YPG+ +  D  S   + P+         GG++G QYY PTY
Sbjct:    1 MNPANLLSAAKSGTTSSILDFLRKPVSILRLVSILVSVIVFGSISSGCYTHQGICIFGTTSSACNLPVAIGVFAFLGEILFLITDFMFDSISNIKRRKHIIIGDLGFSGLWTFLWFVSFCLLANKWTNTSDEWLGQHKVEGWQESNARSAIVFSFLSIAIWGGITFFALQRFRIGQAGLTPEEGLGEPGSTMDPNT--------------GIPGQPYPGMMS--DPMSQQQQQPYGGNIQQPPVGGVSG-QYYGPTY 240          
BLAST of SMED30013275 vs. TrEMBL
Match: A0A4Z2DE80 (Synaptogyrin OS=Schistosoma japonicum OX=6182 GN=EWB00_001936 PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 1.165e-66
Identity = 116/258 (44.96%), Postives = 159/258 (61.63%), Query Frame = -2
Query:  384 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRA-NKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGL------QGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDT--------TGDLGSNYHETPFNSGGMAGQQYYPPTY 1112
            M+PANL+SAAK+G        + KP +I R+ S+L S+I FGCI+SG    N +C++   +SAC+F   IGV AFLG I F++SD +F+++SN+KRR+HII+GD+ FSGLWTF WFVSFC L N+W+NT   +L   KV+ WQ +N RSAIVFS  SIA+W+GITFFA++RFRLG       +G  EP + ++  +              +AP  +YPG+ +              N  + P   GG    QYY PTY
Sbjct:    1 MNPANLLSAAKSGTTTSILEFIRKPVIILRLASILVSVIAFGCITSGCHTHNGICIFGATSSACNFPVAIGVFAFLGGILFLVSDFMFNSISNLKRRRHIIIGDLAFSGLWTFLWFVSFCLLANKWTNTSDEWLGQHKVEGWQESNARSAIVFSFLSIAIWSGITFFALQRFRLGQAGLNADEGLGEPGSTMDPNI--------------SAPGQSYPGMMSDPMSQQQQQQLYSGNIQQPPVGGGG----QYYGPTY 240          
BLAST of SMED30013275 vs. TrEMBL
Match: A0A183QFZ7 (Synaptogyrin OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.818e-66
Identity = 118/252 (46.83%), Postives = 154/252 (61.11%), Query Frame = -2
Query:  384 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK-VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDT--------TGDLGSNYHETPFNSGGMAGQQYYPPTY 1112
            M+PANL+SAAK+G   +    L KP  I R+VSLL S+IVFG ISSG   ++ +C++   +SAC+    IGV AFLG I F++ D +FD++SNIKRRK+I++GD+GFSGLWTF WFVSFC L N+W+NT   +L   KV+ WQ +N RSAIVFS  SIA+W GITFFA++RFR+G Q    P   + +         S        P   YPG+ +            G N  + P    G  G QYY PTY
Sbjct:    1 MNPANLLSAAKSGTTSNILDFLRKPVSILRLVSLLVSVIVFGSISSGCHTHQGICIFGTTSSACNLPVAIGVFAFLGEILFLVGDFMFDSISNIKRRKNIVIGDLGFSGLWTFLWFVSFCLLANKWTNTSDEWLGQHKVEGWQESNARSAIVFSFLSIAIWGGITFFALQRFRMG-QAGLTPEEGLGE-------AGSTMDPNTGVPGQPYPGMMSDPMSQQQQQQPYGGNIQQPPV---GGVGSQYYGPTY 241          
BLAST of SMED30013275 vs. TrEMBL
Match: A0A183KUI2 (Synaptogyrin OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS18723 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.010e-64
Identity = 116/248 (46.77%), Postives = 152/248 (61.29%), Query Frame = -2
Query:  390 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK-VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGL------QGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPP 1112
            M+PANL+SAAK+G        L KP  I R+VS+L S+IVFG ISSG   ++ +C++   +SAC+    IGV AFLG I F+ISD +FD++SNIKRRKHII+GD+GFSGLWTF WFVSFC L N+W+NT   +L   KV+ WQ +N RSAIVFS  SIA+W GITFFA++RFR+G       +G  EP + ++                   P   YPG+ +  D  S   + P+      G    PP
Sbjct:    1 MNPANLLSAAKSGTTSSILDFLRKPVSILRLVSILVSVIVFGSISSGCHTHQGICIFGTTSSACNLPVAIGVFAFLGEILFLISDFMFDSISNIKRRKHIIIGDLGFSGLWTFLWFVSFCLLANKWTNTSDEWLGQHKVEGWQESNARSAIVFSFLSIAIWGGITFFALQRFRMGQAGLTSEEGLGEPGSTMDPNT--------------GVPGQPYPGMMS--DPMSQQQQQPY-----GGNIQQPP 227          
BLAST of SMED30013275 vs. TrEMBL
Match: A0A183LSU2 (Synaptogyrin OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS6867 PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 8.332e-64
Identity = 110/214 (51.40%), Postives = 141/214 (65.89%), Query Frame = -2
Query:  474 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK-VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGV 1112
            M+PANL+SAAK+G        L KP  I R+VS+L S+IVFG ISSG   ++ +C++   +SAC+    IGV AFLG I F+ISD +FD++SNIKRRKHII+GD+GFSGLWTF WFVSFC L N+W+NT   +L   KV+ WQ +N RSAIVFS  SIA+W GITFFA++RFR+G Q    P   + +         S        P   YPG+
Sbjct:    1 MNPANLLSAAKSGTTSSILDFLRKPVSILRLVSILVSVIVFGSISSGCHTHQGICIFGTTSSACNLPVAIGVFAFLGEILFLISDFMFDSISNIKRRKHIIIGDLGFSGLWTFLWFVSFCLLANKWTNTTDEWLGQHKVEGWQESNARSAIVFSFLSIAIWGGITFFALQRFRIG-QAGLTPEEGLGEP-------GSTMDPNTGVPGQPYPGM 206          
BLAST of SMED30013275 vs. Ensembl Cavefish
Match: ENSAMXT00000035583.1 (synaptogyrin-2-like [Source:NCBI gene;Acc:103034981])

HSP 1 Score: 161.384 bits (407), Expect = 3.653e-47
Identity = 87/247 (35.22%), Postives = 130/247 (52.63%), Query Frame = -2
Query:  384 NLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQ--GSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY 1100
            ++  AA +G  FDF S + KPQ I R++S LFSI+VF  I++ G  N+       C++N+++SACS+   +G++AFL  + FII D  F  +SN  +RKHI++ D+ FSG WTF WFV FC+L N+WS+T       ++++    +  R+ I FS FS+  WA +T FA +R+  G+   G  +P+ +                     PY  YP          NY + PF         Y PP Y
Sbjct:    3 SVYGAALSGGSFDFQSFIKKPQTIVRLLSWLFSIVVFATITAEGFVNQHQKEDTKCIFNQNDSACSYGNAVGILAFLACVAFIILDAYFPQISNANQRKHIVISDLVFSGAWTFLWFVCFCFLANQWSHT-------VEIEGIPQDAARAVIAFSFFSVISWALLTLFAFRRYHQGMDEVGYTDPSHD------------------QTTPYPNYPSAP------DNYQQAPFTHSSTGEGSYQPPAY 218          
BLAST of SMED30013275 vs. Ensembl Cavefish
Match: syngr2b (synaptogyrin-2 [Source:NCBI gene;Acc:103034452])

HSP 1 Score: 146.747 bits (369), Expect = 2.173e-41
Identity = 84/247 (34.01%), Postives = 122/247 (49.39%), Query Frame = -2
Query:  384 NLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPF--NSGGMAGQQYYPPTY 1100
            ++  A+ AG  FDF   + +PQ I R++S +FSI+VF  I++ G  N       VC++NK++ AC +  GIG+I FL  + F++ D+    +SN + RK ++  D+ FS  WTF WFV FC L N+W+NT       + V     + + + I FS FSIA W  +T+ A+ RFR   QG  E + N  +                    S YP      D  S Y + PF      M    Y PP Y
Sbjct:    7 SVYGASLAGGSFDFVKFIKQPQTILRVLSWVFSIVVFATITAEGYVNPPNHSQVVCVFNKNDGACHYGVGIGIIGFLACVGFLMVDIYLPMMSNAQERKRVVTADLVFSAAWTFLWFVCFCVLANQWANT-------VDVNGIPTDAVHAIIAFSFFSIATWGALTYLALMRFR---QGVGEVSQNYGESAPDQTS-------------SQYPTSYVPPDHNSTYPQPPFVTKQEPMGDSDYQPPAY 230          
BLAST of SMED30013275 vs. Ensembl Cavefish
Match: syngr1b (synaptogyrin 1 [Source:NCBI gene;Acc:103039414])

HSP 1 Score: 145.206 bits (365), Expect = 9.486e-41
Identity = 84/233 (36.05%), Postives = 125/233 (53.65%), Query Frame = -2
Query:  396 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGG---RANKV---CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSF--EPAANIEQQVXXXXXXXXXXXXXGAAPYSAY-PGVDTTGDLGSNYHETPFNSGGMAGQQYY 1067
            FD  +   +P  + R+VS LFS+++FGCI++ G   R N+V   C+YN++ +AC++A G+G +AFL  + F+  DV F  +S++K RK  +L DVG S  W+F WFV FC+LTN+W       LD   +K    +  R+AI F+ FSI  WAG  F A +R++LG   +   +   +  Q                AAPYSA+  G D     G+  ++ P   G   G   Y
Sbjct:   15 FDPITFFQQPHTVLRMVSWLFSLVIFGCIANEGYVNRPNEVVEYCVYNRNQNACNYAVGMGTLAFLCCMAFLALDVYFPQISSVKDRKKAVLADVGVSAFWSFVWFVGFCFLTNQWQVAK---LDDNPLKE-GADAARAAITFAFFSIFTWAGQAFLAFQRYKLGADSALFSQDYTDPSQDA-------------AAAPYSAFTSGDDLESPGGTGSYQQPSGDGAFDGSAGY 230          
BLAST of SMED30013275 vs. Ensembl Cavefish
Match: syngr2b (synaptogyrin-2 [Source:NCBI gene;Acc:103034452])

HSP 1 Score: 142.895 bits (359), Expect = 9.654e-40
Identity = 85/255 (33.33%), Postives = 124/255 (48.63%), Query Frame = -2
Query:  384 NLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGL------QGSFEPAANIEQ-QVXXXXXXXXXXXXXGAAPYSAYPGVDT-TGDLGSNYHETPF--NSGGMAGQQYYPPTY 1100
            ++  A+ AG  FDF   + +PQ I R++S +FSI+VF  I++ G  N       VC++NK++ AC +  GIG+I FL  + F++ D+    +SN + RK ++  D+ FS  WTF WFV FC L N+W+NT       + V     + + + I FS FSIA W  +T+ A+ RFR G+       G   P     Q          +        P SAYP       D+   Y + PF      M    Y PP Y
Sbjct:    7 SVYGASLAGGSFDFVKFIKQPQTILRVLSWVFSIVVFATITAEGYVNPPNHSQVVCVFNKNDGACHYGVGIGIIGFLACVGFLMVDIYLPMMSNAQERKRVVTADLVFSAAWTFLWFVCFCVLANQWANT-------VDVNGIPTDAVHAIIAFSFFSIATWGALTYLALMRFRQGVGEVSQNYGESAPDQTSSQYPTSYVPPDHNSTYPATTYPASAYPSFPPGRPDI---YQQPPFVTKQEPMGDSDYQPPAY 251          
BLAST of SMED30013275 vs. Ensembl Cavefish
Match: syngr3a (synaptogyrin 3 [Source:NCBI gene;Acc:103035002])

HSP 1 Score: 134.806 bits (338), Expect = 7.036e-37
Identity = 81/235 (34.47%), Postives = 123/235 (52.34%), Query Frame = -2
Query:  423 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN-----KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNS 1112
            MD      A +AG  FD  + + +PQ I RI+S +FS++VFG I + G  N       C++NK+  AC++   IG++AF+  I F+I D+ F  +S++K RK  ++ ++GFSG WTF WFV FC+L N+W    +T  D L +     +  R+AI FS FSI  WAG+T  AV+++ LG   +     +++                   P+   PG +TT      Y   PF  
Sbjct:    1 MDGVGSFGAGRAGSAFDPLAFIQQPQTILRILSWIFSMVVFGSIINEGYVNFDSETLYCVFNKNYDACNYGITIGLVAFIACIFFMILDMKFQQISSVKDRKKAVMLEIGFSGFWTFMWFVCFCFLANQW---QRTTTDELPLNQ-GADAARAAIAFSFFSIFTWAGLTVRAVQKYLLGTDMTLFTTEHLD------------GTPQPTQPFPTAPGPETT----DTYQSPPFTE 215          
BLAST of SMED30013275 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003034.1 (pep scaffold:Pmarinus_7.0:GL485592:66:4677:1 gene:ENSPMAG00000002768.1 transcript:ENSPMAT00000003034.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 2.906e-38
Identity = 68/173 (39.31%), Postives = 103/173 (59.54%), Query Frame = -2
Query:  591 AAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKV------CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTH-QTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG 1088
            A  AG  FD  + + +P  I  I S +F+I+VFGCI   G  N        C+YN +  AC  AT   +++ + A+ F++ DV F ++S+++ RK  +LG++G SGLW F WFV FC+LTN+WS T   +++D +        + R+AI FS FSI  W G+T F  +++RLG
Sbjct:   10 AGPAGSNFDVVAFVKRPTTILSICSTVFAIVVFGCIVGEGHINHSQSSTLHCVYNDNEHACGLATATAILSAVSALAFLVLDVRFTDISSVQHRKAAVLGELGLSGLWAFLWFVCFCFLTNQWSKTAFASWMDIVG------GSARAAIAFSFFSIPTWVGLTIFIFQKYRLG 176          
BLAST of SMED30013275 vs. Ensembl Sea Lamprey
Match: syngr2b (synaptogyrin 2b [Source:ZFIN;Acc:ZDB-GENE-070424-19])

HSP 1 Score: 122.094 bits (305), Expect = 7.810e-33
Identity = 81/243 (33.33%), Postives = 123/243 (50.62%), Query Frame = -2
Query:  384 AAKAGLRFDFASLLVKPQLICRIVSL-LFSIIVFGCISSGGRAN-------KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY 1088
            A +AG  FD  + L KP  I R++S  LF+++V  CI++ G AN         C++N +  AC +   IGVIAFL A   ++ D+   ++     RK+I+  +V FS LWTF WFV FC+LTN+WS T +             +  R++I F+ FSI +W  +T+ A KR+++ L   F  +              +       APY+A  GVD+      +Y + PF   G A + Y  P+Y
Sbjct:   11 AGRAGGVFDIVAFLKKPLTILRLLSWWLFAVVVLACITNEGYANFGQKEPSIQCIFNLNGDACRYGVAIGVIAFLAATLLLVLDLYVPSIVGPLDRKNILRVEVVFSVLWTFMWFVGFCFLTNQWSKTSE---------QKNGDAARASISFAFFSIFIWGSLTYNAYKRYQV-LSDPFSQS-------------YADPSGTPYAPYTAGSGVDSR----DSYQQGPFTEAGTA-RGYQDPSY 225          
BLAST of SMED30013275 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006063.1 (pep scaffold:Pmarinus_7.0:GL476493:599143:603638:1 gene:ENSPMAG00000005478.1 transcript:ENSPMAT00000006063.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 3.285e-32
Identity = 60/151 (39.74%), Postives = 82/151 (54.30%), Query Frame = -2
Query:  573 LFSIIVFGCISSGGRANKV-----CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFE 1010
             FSI+VFGCI + G  N       C++N +  AC +   IGV+AF   + F+  D  F  +S++K RK  +L D+ FS  W F WFV FC LTN+W  T     D         ++ R+ I F  FSI  W+GI F A++RFRLG   +F 
Sbjct:    7 FFSIVVFGCIVNEGYTNNQGSKLHCIFNGNGDACRYGITIGVVAFFACVAFLALDAYFPQISSVKDRKRAVLADLAFSAFWAFMWFVGFCLLTNQWRETP----DSKVPNGIGADSARATIAFCFFSIISWSGIAFLALRRFRLGADAAFS 153          
BLAST of SMED30013275 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004662.1 (pep scaffold:Pmarinus_7.0:GL501065:8790:19293:1 gene:ENSPMAG00000004245.1 transcript:ENSPMAT00000004662.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 3.621e-31
Identity = 61/169 (36.09%), Postives = 100/169 (59.17%), Query Frame = -2
Query:  579 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGG------RANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGS 1067
            FD   L+ +PQ I R+V+ +FS+IVFGCIS+ G        +  C++N++ +AC F   IG IAFL +   ++ D+ F  +S++K R+ +++ D+ FS  W+F WFV FC+LTN+W  T            +  ++ R+AI FS FSI  W   +   ++R++LG+  +
Sbjct:   15 FDPVGLMKQPQTIMRVVNWVFSVIVFGCISNEGYVSTNSSPDLYCVFNRNGNACRFGIAIGAIAFLASSALLLLDLYFPQISSVKDRRKVVIFDMAFSAAWSFLWFVCFCFLTNQWQKTSADV-----APSYSHDSARAAITFSFFSIISWYCSSIKCIRRYKLGVDST 178          
BLAST of SMED30013275 vs. Ensembl Medaka
Match: ENSORLT00000009770.2 (synaptogyrin-2 [Source:NCBI gene;Acc:101171415])

HSP 1 Score: 140.584 bits (353), Expect = 3.839e-39
Identity = 87/245 (35.51%), Postives = 125/245 (51.02%), Query Frame = -2
Query:  384 AAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKV------CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGL----QGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY 1088
            A+ AG  FD  S + KPQ I R +S +FSI+VF  I++ G  N +      C++N ++ ACS+A GIGVI+FL  + F+I D  F  +SN   RK+I++ D+ FSG+WT  WF+ FCYL N+W  T               +  R+AI FS FS A W  + +FA  R+R G+    Q   +PA +                    +PY   P    +G  G  Y ++PF+ G     +Y PP Y
Sbjct:    8 ASLAGGTFDLESFVKKPQTILRFLSWIFSIVVFATITAEGYVNPMTEENTKCMFNGNDGACSYAVGIGVISFLACVLFLILDAYFPKLSNANERKYIVVADLVFSGVWTILWFICFCYLANQWGKT--------TAGTAAPDAARAAISFSFFSTATWGLLFYFAFGRYRQGVDDFTQDYRDPAVD------------------HTSPYP--PAQFGSGPTG--YQQSPFSQGQTQPGEYQPPAY 222          
BLAST of SMED30013275 vs. Ensembl Medaka
Match: syngr2b (synaptogyrin-2 [Source:NCBI gene;Acc:101157351])

HSP 1 Score: 139.043 bits (349), Expect = 2.339e-38
Identity = 74/179 (41.34%), Postives = 105/179 (58.66%), Query Frame = -2
Query:  585 ANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKV------CLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQ 1103
            A+    + AG  FDF   + +P  + R++S +F+I+VF CI S G  N        C++NK++SAC +A GIGVIAFL  + F++ DV     S+ + RK  +  D+GFSGLWTF WFV FC LT++WS T         ++    +  R+AI FS FSIA W   T+F + RFR G+ 
Sbjct:    7 ASAYGVSLAGKGFDFNKFVRQPLTVVRVLSWVFAIVVFSCIESEGYINAPTSPQVKCIFNKNDSACHYAVGIGVIAFLACVGFLLLDVYLLFSSSAQERKLAVAADLGFSGLWTFLWFVCFCLLTSQWSRTED-------MRGIPKDAGRAAIAFSFFSIATWGITTYFTLGRFRHGVD 178          
BLAST of SMED30013275 vs. Ensembl Medaka
Match: syngr1b (synaptogyrin 1 [Source:NCBI gene;Acc:101173609])

HSP 1 Score: 132.88 bits (333), Expect = 4.654e-36
Identity = 66/165 (40.00%), Postives = 102/165 (61.82%), Query Frame = -2
Query:  591 FDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK------VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG 1067
            FD  + L +PQ I RIVS LFSI++FGCI++ G  N+       C++N++ +AC++   +G +AFL  I F+  D+ F  +S++K RK  +L D+G S  W+F WFV FC+L N+W  + +   + L+      +  R+AI FS FSI  WA  +F A +R++LG
Sbjct:   17 FDPVTFLQQPQTILRIVSWLFSIVIFGCIANEGYINRQNEMEQYCIFNRNQNACNYGVFMGSMAFLCCIAFLALDIYFPQISSVKDRKKAVLADIGVSAFWSFMWFVGFCFLANQWQVSKEE-DNPLREGG---DAARAAITFSFFSIFTWAAQSFLAFQRYKLG 177          
BLAST of SMED30013275 vs. Ensembl Medaka
Match: SYNGR3 (synaptogyrin-3 [Source:NCBI gene;Acc:101164956])

HSP 1 Score: 124.405 bits (311), Expect = 7.580e-33
Identity = 70/180 (38.89%), Postives = 104/180 (57.78%), Query Frame = -2
Query:  591 MDPANLMSAAKAG-LRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRAN-----KVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLG 1112
            M+ A    A KAG + FD  +    P+ I R++S +FSI+VF CI + G  N      +C++N +  AC++   +GV  FLG++CF++ D  F ++SNIK RK  +L D+ FSGL +F WFV FC+L N+W  T     D L +     +  R+ I F  FSI  WA +T  A++R+  G
Sbjct:    1 MEAAGAYGARKAGSVSFDPVAFFTHPRTIFRLLSWVFSIVVFSCIVNEGYINIGSERLLCVFNNNADACNYGLTLGVGCFLGSLCFLVLDFYFPSMSNIKDRKRAVLLDLIFSGLASFLWFVGFCFLANQWQATSP---DQLPLDQGS-DAARATIAFCFFSILTWAVLTLSALRRYLTG 176          
BLAST of SMED30013275 vs. Ensembl Medaka
Match: ENSORLT00000016399.2 (synaptogyrin 3 [Source:NCBI gene;Acc:101166799])

HSP 1 Score: 118.242 bits (295), Expect = 1.117e-30
Identity = 81/251 (32.27%), Postives = 122/251 (48.61%), Query Frame = -2
Query:  384 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANK-----VCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTG---DLGSNYHETPFNSGGMAGQQYYPPTY 1112
            MD      A +AG   D  +   +PQ I R++S +FS++VF  I + G  N       C++NK+  AC++   +G++  L    F + D  F ++S+IK RK  ++ ++GFSG WTF +FVSFC+L N+WS T +   + L +     +  R+AI FS FSI  WAG+T  AV+++ LG   S     +++                G AP   YP     G   +    Y   PF     A   Y  P Y
Sbjct:    1 MDGVGSFGAGRAGSTIDPITFAKQPQTILRVLSWIFSLVVFASIVNEGYYNMGSERLHCVFNKNADACNYGVFVGLVGLLACSFFFMLDYKFSSISSIKDRKKAVMLEIGFSGFWTFLYFVSFCFLANQWSRTKK---EDLPLNQ-GADAARAAIAFSFFSIITWAGLTARAVQKYLLGTDMSLFTTEHMD----------------GGAPTQPYPSNSPGGGTTETTEAYQSPPFTENN-AAPTYQVPIY 230          
BLAST of SMED30013275 vs. Planmine SMEST
Match: SMESG000063084.1 (SMESG000063084.1)

HSP 1 Score: 467.233 bits (1201), Expect = 9.594e-167
Identity = 243/243 (100.00%), Postives = 243/243 (100.00%), Query Frame = -2
Query:  384 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY 1112
            MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVGTDDGGMSGDQMGGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY
Sbjct:    1 MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVGTDDGGMSGDQMGGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY 243          
BLAST of SMED30013275 vs. Planmine SMEST
Match: SMESG000063084.1 (SMESG000063084.1)

HSP 1 Score: 453.366 bits (1165), Expect = 1.979e-161
Identity = 237/237 (100.00%), Postives = 237/237 (100.00%), Query Frame = -2
Query:  384 MSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY 1094
            MSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVGTDDGGMSGDQMGGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY
Sbjct:    1 MSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVGTDDGGMSGDQMGGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY 237          
BLAST of SMED30013275 vs. Planmine SMEST
Match: SMESG000051237.1 (SMESG000051237.1)

HSP 1 Score: 155.992 bits (393), Expect = 3.421e-45
Identity = 88/225 (39.11%), Postives = 123/225 (54.67%), Query Frame = -2
Query:  405 AGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVXXXXXXXXXXXXXGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQ 1079
            +G  FDF   +  P +I RI+SL+FSIIVFGCI++G      C YN D +AC++ T IGVIA +  + F+I D +F  +SN+  RK+ ++ DV FSG+W F WFV FCYLTNR SNT        K +   ++N R+AI FS FSI  WA   +FAV++++ G+   F  + ++  Q                 PYS      +  D GSN     +N   M G 
Sbjct:   10 SGSSFDFQEYIKSPNVILRIISLVFSIIVFGCIANGVYYKDKCAYNNDMNACNYGTVIGVIACIACLAFLIGDAMFHQLSNVDHRKYYVVVDVLFSGIWCFLWFVGFCYLTNRLSNT--------KTEEGSVSNARAAIAFSFFSIISWALQCYFAVRKYQSGVGDLFASSDDVLDQ----------------QPYSG-----SLPDSGSNRGSNMYNDEQMIGD 205          
BLAST of SMED30013275 vs. Planmine SMEST
Match: SMESG000049096.1 (SMESG000049096.1)

HSP 1 Score: 100.138 bits (248), Expect = 4.396e-24
Identity = 56/176 (31.82%), Postives = 95/176 (53.98%), Query Frame = -2
Query:  552 AGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRANKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQ 1079
            AG   D  S   KP +I R +S+L SIIVF    SG   N +C+ N   S C++ T +G+I+ + ++ F+  D+I  +VS+++ RK I++ D+ FS ++   W VS   +   W  T  + +  + V+ WQ   +++A  F +F +A+W  IT    +RF  G +  F  A  + +
Sbjct:   15 AGGSIDKESFFKKPLVISRFISMLISIIVFSTTISGAWLNNMCIINGAVSNCNYITAVGIISLMISVTFLSIDLIMPHVSSLEMRKRIVIFDIFFSCVFIILWLVSTGVIIGEWWKTPTSTV--VGVQTWQFMCIQTAAAFCIFGLAIWVLITVLGARRFHSGKRELFLSANEVNR 188          
BLAST of SMED30013275 vs. Planmine SMEST
Match: SMESG000031799.1 (SMESG000031799.1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.638e-16
Identity = 41/150 (27.33%), Postives = 87/150 (58.00%), Query Frame = -2
Query:  582 RIVSLLFSIIVFGCI-SSGGRANKVC-LYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHIILGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAIVFSLFSIALWAGITFFAVKRFRLGLQG 1025
            R ++L++S+IV  CI  +G  ++ +C ++  D SAC+F   + V+  +    F++ D   +++ +  +   +   ++ F+ +W+F W V FC L NRW++      ++  +  W+I+++++AI FS FSI  W     +A++R+R+ ++ 
Sbjct:   15 RFLTLIYSLIVLVCILKAGYNSDGLCSIFLFDESACNFGIALPVVGIIALFLFLVFDFTCESIRDFTKLNILSTLEIIFTLIWSFLWLVGFCLLVNRWNSRG----NNNDIPGWRISSIQAAISFSFFSIFTWIYQFIWAIRRYRIRVRN 160          
The following BLAST results are available for this feature:
BLAST of SMED30013275 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNGR26.011e-3932.63synaptogyrin 2 [Source:HGNC Symbol;Acc:HGNC:11499][more]
SYNGR26.011e-3932.63synaptogyrin 2 [Source:HGNC Symbol;Acc:HGNC:11499][more]
SYNGR11.109e-3533.89synaptogyrin 1 [Source:HGNC Symbol;Acc:HGNC:11498][more]
SYNGR11.170e-3339.43synaptogyrin 1 [Source:HGNC Symbol;Acc:HGNC:11498][more]
SYNGR26.134e-3241.18synaptogyrin 2 [Source:HGNC Symbol;Acc:HGNC:11499][more]
back to top
BLAST of SMED30013275 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sng-13.316e-2431.55Synaptogyrin homolog 1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of SMED30013275 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Syngr1.872e-3535.51gene:FBgn0033876 transcript:FBtr0087645[more]
back to top
BLAST of SMED30013275 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syngr3a9.743e-4336.80synaptogyrin 3a [Source:ZFIN;Acc:ZDB-GENE-050522-5... [more]
syngr2b7.185e-4033.74synaptogyrin 2b [Source:ZFIN;Acc:ZDB-GENE-070424-1... [more]
syngr1a6.156e-3934.55synaptogyrin 1a [Source:ZFIN;Acc:ZDB-GENE-041010-1... [more]
syngr3b1.131e-3734.89synaptogyrin 3b [Source:ZFIN;Acc:ZDB-GENE-070822-6... [more]
syngr2b4.446e-3238.13synaptogyrin 2b [Source:ZFIN;Acc:ZDB-GENE-070424-1... [more]
back to top
BLAST of SMED30013275 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syngr28.027e-4135.68synaptogyrin 2 [Source:NCBI gene;Acc:448480][more]
SYNGR33.844e-3633.48synaptogyrin 3 [Source:NCBI gene;Acc:100489723][more]
aif1l5.927e-3439.52allograft inflammatory factor 1-like [Source:Xenba... [more]
aif1l4.691e-2937.29allograft inflammatory factor 1-like [Source:Xenba... [more]
aif1l9.628e-2741.03allograft inflammatory factor 1-like [Source:Xenba... [more]
back to top
BLAST of SMED30013275 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syngr22.055e-3731.78synaptogyrin 2 [Source:MGI Symbol;Acc:MGI:1328324][more]
Syngr15.532e-3539.64synaptogyrin 1 [Source:MGI Symbol;Acc:MGI:1328323][more]
Syngr13.141e-3339.52synaptogyrin 1 [Source:MGI Symbol;Acc:MGI:1328323][more]
Syngr24.764e-3239.74synaptogyrin 2 [Source:MGI Symbol;Acc:MGI:1328324][more]
Syngr38.636e-3239.53synaptogyrin 3 [Source:MGI Symbol;Acc:MGI:1341881][more]
back to top
BLAST of SMED30013275 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7E3W5|SNG2_BOVIN6.432e-4333.33Synaptogyrin-2 OS=Bos taurus OX=9913 GN=SYNGR2 PE=... [more]
sp|O43760|SNG2_HUMAN2.887e-3832.63Synaptogyrin-2 OS=Homo sapiens OX=9606 GN=SYNGR2 P... [more]
sp|A8MWL6|SNG2L_HUMAN4.662e-3732.64Putative synaptogyrin-2 like protein OS=Homo sapie... [more]
sp|O55101|SNG2_MOUSE1.438e-3631.78Synaptogyrin-2 OS=Mus musculus OX=10090 GN=Syngr2 ... [more]
sp|O54980|SNG2_RAT6.546e-3631.78Synaptogyrin-2 OS=Rattus norvegicus OX=10116 GN=Sy... [more]
back to top
BLAST of SMED30013275 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095C9C93.713e-6747.08Synaptogyrin OS=Schistosoma haematobium OX=6185 GN... [more]
A0A4Z2DE801.165e-6644.96Synaptogyrin OS=Schistosoma japonicum OX=6182 GN=E... [more]
A0A183QFZ72.818e-6646.83Synaptogyrin OS=Schistosoma rodhaini OX=6188 PE=3 ... [more]
A0A183KUI21.010e-6446.77Synaptogyrin OS=Schistosoma curassoni OX=6186 GN=S... [more]
A0A183LSU28.332e-6451.40Synaptogyrin OS=Schistosoma margrebowiei OX=48269 ... [more]
back to top
BLAST of SMED30013275 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035583.13.653e-4735.22synaptogyrin-2-like [Source:NCBI gene;Acc:10303498... [more]
syngr2b2.173e-4134.01synaptogyrin-2 [Source:NCBI gene;Acc:103034452][more]
syngr1b9.486e-4136.05synaptogyrin 1 [Source:NCBI gene;Acc:103039414][more]
syngr2b9.654e-4033.33synaptogyrin-2 [Source:NCBI gene;Acc:103034452][more]
syngr3a7.036e-3734.47synaptogyrin 3 [Source:NCBI gene;Acc:103035002][more]
back to top
BLAST of SMED30013275 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003034.12.906e-3839.31pep scaffold:Pmarinus_7.0:GL485592:66:4677:1 gene:... [more]
syngr2b7.810e-3333.33synaptogyrin 2b [Source:ZFIN;Acc:ZDB-GENE-070424-1... [more]
ENSPMAT00000006063.13.285e-3239.74pep scaffold:Pmarinus_7.0:GL476493:599143:603638:1... [more]
ENSPMAT00000004662.13.621e-3136.09pep scaffold:Pmarinus_7.0:GL501065:8790:19293:1 ge... [more]
back to top
BLAST of SMED30013275 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013275 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013275 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000009770.23.839e-3935.51synaptogyrin-2 [Source:NCBI gene;Acc:101171415][more]
syngr2b2.339e-3841.34synaptogyrin-2 [Source:NCBI gene;Acc:101157351][more]
syngr1b4.654e-3640.00synaptogyrin 1 [Source:NCBI gene;Acc:101173609][more]
SYNGR37.580e-3338.89synaptogyrin-3 [Source:NCBI gene;Acc:101164956][more]
ENSORLT00000016399.21.117e-3032.27synaptogyrin 3 [Source:NCBI gene;Acc:101166799][more]
back to top
BLAST of SMED30013275 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063084.19.594e-167100.00SMESG000063084.1[more]
SMESG000063084.11.979e-161100.00SMESG000063084.1[more]
SMESG000051237.13.421e-4539.11SMESG000051237.1[more]
SMESG000049096.14.396e-2431.82SMESG000049096.1[more]
SMESG000031799.11.638e-1627.33SMESG000031799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013275 ID=SMED30013275|Name=SMED30013275|organism=Schmidtea mediterranea sexual|type=transcript|length=1215bp
TTTTTTTTAAATAAAAATATTAATGTATTTAAAACACTGATACGTCTACA
TTATTCGACAAGACACATTGACTATTCTACAGATGAAATGCCGCCGCCAT
CTCAAGATAGCAACGTAAATTTCTATAAAAATTCCATGACAAATATAATA
TAAATGCTCACTAATTTCAATAAAAATATTATTACATATCGCTGAAAAAT
ATAAATACAAATTTTATAAAATTAAGCTAGAACTAAATAGAAAATGCGAT
TTCTAAATTTTTAAATTCAAATAAATATCTTAGAGATCATTACAGACAAC
AAATAGATCTAAAATCATATTATGCTAACAATTGAGATTCATTCAGTTAT
TCCTTCTTTTGTAATCAAAATTTCCAAAAATCAATAAGTTGGTGGATAAT
ATTGCTGGCCCGCCATGCCTCCACTATTAAATGGTGTTTCATGGTAATTG
GAACCCAGATCACCTGTGGTATCCACACCAGGGTAAGCAGAATAAGGGGC
CGCGCCTCCCATCTGATCACCAGACATGCCCCCATCATCTGTGCCGACCT
GTTGTTCAATATTTGCCGCAGGTTCAAATGATCCTTGCAAACCCAGCCTA
AATCTTTTAACGGCAAAAAAGGTAATTCCGGCCCATAAAGCAATTGAAAA
CAACGAAAACACAATGGCACTTCTAAGGTTGTTTATTTGCCAATGTTTAA
CTTTCAAATGGTCAAGAAATGTTTGATGGGTGTTAGACCATCTATTCGTA
AGATAACAAAATGAAACGAACCAGAAAAACGTCCATAAGCCTGAAAATCC
AACATCGCCTAAAATAATATGCTTACGACGTTTAATATTTGAGACGTTGT
CAAATATTACATCACTAATTATAAAACAAATTGCTCCGAGAAAAGCAATT
ACTCCAATACCTGTTGCAAAACTACACGCACTATTATCTTTGTTATATAG
GCATACTTTATTAGCACGACCTCCGGATGAAATGCAACCAAATACAATAA
TAGAGAAAAGAAGGCTAACAATTCTGCAAATTAATTGAGGTTTTACTAAA
AGTGAAGCAAAATCAAATCTAAGACCGGCTTTAGCAGCTGACATCAAATT
TGCAGGATCCATTTGCGCCAAGTATTTAATGAACAATATACATGAATAAT
TCAAACAAATAGATAACTATTTTATAAGTCTCTTAATTGAAATTTATTTT
ATATTTCATTTTTAA
back to top

protein sequence of SMED30013275-orf-1

>SMED30013275-orf-1 ID=SMED30013275-orf-1|Name=SMED30013275-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MDPANLMSAAKAGLRFDFASLLVKPQLICRIVSLLFSIIVFGCISSGGRA
NKVCLYNKDNSACSFATGIGVIAFLGAICFIISDVIFDNVSNIKRRKHII
LGDVGFSGLWTFFWFVSFCYLTNRWSNTHQTFLDHLKVKHWQINNLRSAI
VFSLFSIALWAGITFFAVKRFRLGLQGSFEPAANIEQQVGTDDGGMSGDQ
MGGAAPYSAYPGVDTTGDLGSNYHETPFNSGGMAGQQYYPPTY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016579Synaptogyrin
IPR008253Marvel
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008253Marvel domainPFAMPF01284MARVELcoord: 22..166
e-value: 2.6E-20
score: 72.9
IPR008253Marvel domainPROSITEPS51225MARVELcoord: 21..172
score: 16.481
IPR016579SynaptogyrinPANTHERPTHR10838SYNAPTOGYRINcoord: 8..236
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 99..121