DNA damage-inducible protein 1

Overview
NameDNA damage-inducible protein 1
Smed IDSMED30013263
Length (bp)1292
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA damage-inducible protein 1 (SMED30013263) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA damage-inducible protein 1 (SMED30013263) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA damage-inducible protein 1 (SMED30013263) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA damage-inducible protein 1 (SMED30013263) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013263

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013263SMESG000052590.1 SMESG000052541.1 Contig5171uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013263SMESG000052590.1 SMESG000052541.1 Contig5171newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013263SMESG000039746.1 Contig5171uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013263SMESG000039746.1 Contig5171newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30013263SMESG000052545.1 dd_Smed_v4_2764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013263SMESG000052545.1 dd_Smed_v4_2764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013263SMESG000052545.1 dd_Smed_v4_2764_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA damage-inducible protein 1 vs. Ensembl Human
Match: DDI2 (DNA damage inducible 1 homolog 2 [Source:HGNC Symbol;Acc:HGNC:24578])

HSP 1 Score: 232.646 bits (592), Expect = 9.865e-72
Identity = 133/309 (43.04%), Postives = 180/309 (58.25%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQQTATTSSN-----RIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSP----------------PDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            L + G++DGDV++  +K               RIDFS I  ++       Q++P  T  +     ++  SP                P  LS  K  NP L + L   D  KF ++  EQQ+      +E   L S +  D + Q+KIEE I+++NI+  M  AME  PESF Q  MLYINC++N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LE+Q MDML+GLDMLKR+QCSI+LK+NVL IG+   +T FLPE ELP+ A+L + 
Sbjct:   61 LASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFSSI--AVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYG 367          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Human
Match: DDI1 (DNA damage inducible 1 homolog 1 [Source:HGNC Symbol;Acc:HGNC:18961])

HSP 1 Score: 231.876 bits (590), Expect = 1.960e-71
Identity = 137/313 (43.77%), Postives = 184/313 (58.79%), Query Frame = 2
Query:  290 LGNLGIRDGD--VLLTSRKIQQTATTSSN---RIDFSGI-----------NPSLLSRGGSAQKRPLVTSIAEQ------------FRQQLLKSPPDILSQYKTFNPTLCDYLHDPV--KFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKL 1138
            LG+ G++DGD  VLL    +   A   +    R+DFSGI           +P    +   A +R    +  E+             R  LL +P D LS  K  NP L + L       F Q+  EQQR      +E   L + + LD + Q+KIEE I+++NI+  M  A+E  PESF Q TMLYINC++N    KAFVDSGAQMT +S   A +C++  L+D RW G+A+GVGTQ I+GRVH  Q+Q+ G FLQ S S+LEDQ MDML+GLDML+R+QCSI+LK+NVL IG+   +T FLPE ELP  +++
Sbjct:   61 LGSYGLKDGDIVVLLQKDNVGPRAPGRAPNQPRVDFSGIAVPGTSSSRPQHPGQQQQRTPAAQRSQGLASGEKVAGLQGLGSPALIRSMLLSNPHD-LSLLKERNPPLAEALLSGSLETFSQVLMEQQREKALREQERLRLYTADPLDREAQAKIEEEIRQQNIEENMNIAIEEAPESFGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLPEGELPLCSRM 372          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Celegans
Match: ddi-1 (pep chromosome:WBcel235:IV:6522874:6524568:1 gene:WBGene00015308.1 transcript:C01G5.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ddi-1)

HSP 1 Score: 132.494 bits (332), Expect = 1.815e-34
Identity = 67/153 (43.79%), Postives = 97/153 (63.40%), Query Frame = 2
Query:  680 KKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGV-GTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAK 1135
            K+ ID Q  H+M H+PE     TMLYIN  IN +  KAF+DSGAQ + +S+  A +C ++ LID R++ +ARGV GT+ I G++H   ++V          V+  +EMD+LIGL++L+++ C INLK + LE G N   TPFL  NE+  + K
Sbjct:  221 KELIDEQYLHSMTHHPEDMIAVTMLYINLTINGVPVKAFIDSGAQKSIMSMACAERCGLNGLIDRRFQSMARGVGGTEKIEGKIHLCDVKVEDAHFSCPFEVMARREMDLLIGLNVLRKHGCCINLKTSRLEFG-NGTTTPFLQSNEIDSHLK 372          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Fly
Match: rngo (gene:FBgn0030753 transcript:FBtr0343349)

HSP 1 Score: 212.231 bits (539), Expect = 1.473e-63
Identity = 134/320 (41.88%), Postives = 182/320 (56.88%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQQTATTSSN----RIDFSGINPSLLSRGGSAQKRPL------------VTSIA-------------EQFRQQLLKSPPDILSQYKTFNPTLCDYLH--DPVKFKQIHEEQ--QRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFNN 1150
            L   G+ DGD ++  R+         N     +DFS I     S GGS   R +            +T I              E  RQ  L SP + LS  + +NP+L + +   D  KF ++  E   +R   N +R + +LN+ +  D + Q  I E IK+KNI   M  A+E+NPE F   TMLYINC++N +  KAFVDSGAQ T +S + A +CHV+ LID+RW G+A+GVGTQ I+GR+H VQLQ+    L  S +VL  Q MDML+GLDMLKR+QC I+L+RN+L IG+    TPFLPE+ELP  A+L  N+
Sbjct:   57 LQQCGVGDGDFIMLERRRSANRPVGGNPAISTLDFSNIAVPGTSSGGSPPSRRVQQQGVQQPQFNNLTDIPTTDEFNVNFDDDPETVRQMFLSSP-ETLSLLRQYNPSLAEAIDSGDKEKFARLLREHITERKRRNEHR-MRMLNA-DPFDEETQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVDSGAQTTIMSKDCAERCHVNRLIDTRWNGVAKGVGTQPILGRIHMVQLQIENDHLTSSFTVLGQQPMDMLLGLDMLKRHQCLIDLQRNLLIIGTTGTTTPFLPESELPVSARLTGNS 373          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Fly
Match: rngo (gene:FBgn0030753 transcript:FBtr0074278)

HSP 1 Score: 212.231 bits (539), Expect = 1.473e-63
Identity = 134/320 (41.88%), Postives = 182/320 (56.88%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQQTATTSSN----RIDFSGINPSLLSRGGSAQKRPL------------VTSIA-------------EQFRQQLLKSPPDILSQYKTFNPTLCDYLH--DPVKFKQIHEEQ--QRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFNN 1150
            L   G+ DGD ++  R+         N     +DFS I     S GGS   R +            +T I              E  RQ  L SP + LS  + +NP+L + +   D  KF ++  E   +R   N +R + +LN+ +  D + Q  I E IK+KNI   M  A+E+NPE F   TMLYINC++N +  KAFVDSGAQ T +S + A +CHV+ LID+RW G+A+GVGTQ I+GR+H VQLQ+    L  S +VL  Q MDML+GLDMLKR+QC I+L+RN+L IG+    TPFLPE+ELP  A+L  N+
Sbjct:   57 LQQCGVGDGDFIMLERRRSANRPVGGNPAISTLDFSNIAVPGTSSGGSPPSRRVQQQGVQQPQFNNLTDIPTTDEFNVNFDDDPETVRQMFLSSP-ETLSLLRQYNPSLAEAIDSGDKEKFARLLREHITERKRRNEHR-MRMLNA-DPFDEETQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVDSGAQTTIMSKDCAERCHVNRLIDTRWNGVAKGVGTQPILGRIHMVQLQIENDHLTSSFTVLGQQPMDMLLGLDMLKRHQCLIDLQRNLLIIGTTGTTTPFLPESELPVSARLTGNS 373          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Zebrafish
Match: ddi2 (DNA-damage inducible protein 2 [Source:NCBI gene;Acc:386644])

HSP 1 Score: 239.58 bits (610), Expect = 1.506e-74
Identity = 142/322 (44.10%), Postives = 181/322 (56.21%), Query Frame = 2
Query:  278 PSSLLGNLGIRDGDVLLTS-----RKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRP---------------LVTSIAEQFRQQLLKSP----------PDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            P+  LGN G++DGDVL+       R   Q       RIDFS I     S  G  + RP                 TS       Q L +P          P  LS  K  NP L + L   D  +F ++  EQQ+     ++E   L + +  D   Q+KIEE I++ NI+  M  AME  PESF Q  MLYINC++N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LEDQ MDML+GLDMLKR+QCSI+LK+NVL IG+   ET FLPE ELP+ A+L + 
Sbjct:   57 PTRALGNYGLKDGDVLVLRQAERLRAPPQPTVPGLPRIDFSSIAVPGTS-SGQNRNRPQQAQRPSTTQPPPPQATTSPGSGVSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLERFTKVLMEQQQDRARRDQERIKLLTADPFDLDAQAKIEEEIRQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNVLLIGTTGTETRFLPEAELPECARLAYG 377          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Zebrafish
Match: ddi2 (DNA-damage inducible protein 2 [Source:NCBI gene;Acc:386644])

HSP 1 Score: 239.58 bits (610), Expect = 1.592e-74
Identity = 142/322 (44.10%), Postives = 181/322 (56.21%), Query Frame = 2
Query:  278 PSSLLGNLGIRDGDVLLTS-----RKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRP---------------LVTSIAEQFRQQLLKSP----------PDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            P+  LGN G++DGDVL+       R   Q       RIDFS I     S  G  + RP                 TS       Q L +P          P  LS  K  NP L + L   D  +F ++  EQQ+     ++E   L + +  D   Q+KIEE I++ NI+  M  AME  PESF Q  MLYINC++N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LEDQ MDML+GLDMLKR+QCSI+LK+NVL IG+   ET FLPE ELP+ A+L + 
Sbjct:   57 PTRALGNYGLKDGDVLVLRQAERLRAPPQPTVPGLPRIDFSSIAVPGTS-SGQNRNRPQQAQRPSTTQPPPPQATTSPGSGVSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLERFTKVLMEQQQDRARRDQERIKLLTADPFDLDAQAKIEEEIRQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNVLLIGTTGTETRFLPEAELPECARLAYG 377          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Zebrafish
Match: nrip2 (nuclear receptor interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9425])

HSP 1 Score: 49.2914 bits (116), Expect = 3.623e-6
Identity = 32/126 (25.40%), Postives = 56/126 (44.44%), Query Frame = 2
Query:  728 ESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFL 1105
            E  A  + L + C+         +++G Q   IS    R+  +    + + +   + V     V  V  +QLQ+    +Q +  V+ED   ++ +GL  L   +C ++LK  VL + S   E PFL
Sbjct:  155 ERAASLSALVVQCKCGDAEVMLSINTGCQHNHISKTCCRRLGLKSKQEDKGRD-KQPVSESSPVETVKSLQLQLGRERVQCTAQVIEDATFEVCLGLQTLLELKCCVDLKSRVLRLHSPEQELPFL 279          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Xenopus
Match: ddi2 (DNA damage inducible 1 homolog 2 [Source:NCBI gene;Acc:619368])

HSP 1 Score: 231.491 bits (589), Expect = 5.330e-72
Identity = 133/306 (43.46%), Postives = 184/306 (60.13%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLV-----------TSIAEQ-------FRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            L + G++DGDV++  ++    A  ++    F G++ S ++  GS+ +               TS   Q        R+ LL +P + LS  K  NP L + L   D  KF ++  EQQ+      +E   L S +  D + Q+KIEE I+++NI+  M  AME  PESF Q  MLYINC++N    KAFVDSGAQMT +S   A +CH+  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LE+Q MDML+GLDMLKR+QCSI+L++NVL IG+    T FLPE ELP+ A+L + 
Sbjct:   15 LASYGLKDGDVVILRQRETPEARPAA---PFPGLDFSTIAVPGSSSQPAPSQPQAPPPPPPDTSSFPQGLDNPALLREMLLANPHE-LSLLKERNPPLAEALLSGDLEKFTKVLLEQQQERARREQERIRLYSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGYPVKAFVDSGAQMTIMSQACAERCHIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLEKNVLVIGTTGTRTSFLPEGELPECARLAYG 316          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Mouse
Match: Ddi2 (DNA-damage inducible protein 2 [Source:MGI Symbol;Acc:MGI:1917244])

HSP 1 Score: 236.884 bits (603), Expect = 1.396e-73
Identity = 141/309 (45.63%), Postives = 186/309 (60.19%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQ---QTATTSSN--RIDFSGI------NPSL--LSRGGSAQKRPLVTSIAEQ-------FRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFNN 1150
            L + G++DGDV++  +K     + A   SN  RIDFS I      NP    L R  +    P   + + Q        R  LL +P + LS  K  NP L + L   D  KF ++  EQQ+      +E   L S +  D + Q+KIEE I+++NI+  M  AME  PESF Q  MLYINCR+N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LE+Q MDML+GLDMLKR+QCSI+LK+NVL IG+   +T FLPE ELP+ A+L +  
Sbjct:   61 LASYGLKDGDVVILRQKENADPRPAVQFSNLPRIDFSSIAVPGTSNPQQRQLPRTQAQHSSPGEMASSPQGLDNPALLRDMLLANPHE-LSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVAMLYINCRVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLACSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYGT 368          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Mouse
Match: Ddi1 (DNA-damage inducible 1 [Source:MGI Symbol;Acc:MGI:1919079])

HSP 1 Score: 224.942 bits (572), Expect = 7.517e-69
Identity = 118/228 (51.75%), Postives = 153/228 (67.11%), Query Frame = 2
Query:  461 FRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKL 1138
             R  LL +P D LS  K  NP L + L   +   F Q+  EQQR      +E+  L S N  D + Q++IEE I+++NI+  M  AME  PESF Q  MLYINC++N    KAFVDSGAQMT +S   A +C++  L+D RW G+A+GVGTQ I+GRVH  Q+Q+ G FLQ S S+LE+Q MD+L+GLDML+R+QCSI+LK+NVL IG+   +T FLPE ELP  AKL
Sbjct:  152 IRSMLLSNPHD-LSLLKERNPALAEALLSGNLETFSQVLMEQQRERTLREQEMFRLYSTNPFDQETQARIEEEIRQQNIEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWGGVAKGVGTQRIMGRVHLAQIQIEGDFLQCSFSILEEQPMDILLGLDMLRRHQCSIDLKKNVLVIGTTGSQTHFLPEGELPLCAKL 378          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Mouse
Match: Nrip3 (nuclear receptor interacting protein 3 [Source:MGI Symbol;Acc:MGI:1925843])

HSP 1 Score: 50.8322 bits (120), Expect = 1.069e-6
Identity = 32/122 (26.23%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  749 MLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHV-DHLIDSRWKGIARGVGTQ-HIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIG-SNNVETPFL 1105
            M+ ++C+    + KA VD+G Q   IS     +  + DH+   + +G    +     +VG++  + + V  + L    +V++D E  + +GL  L+  +C INL ++ L +G ++  E PF+
Sbjct:  106 MILVSCQCAGKDVKALVDTGCQYNLISSACVDRLGLKDHVKSHKHEGEKLSLPRHLKVVGQIEHLMITVGSLRLDCQAAVVDDNEKSLSLGLQTLRSLKCIINLDKHRLIVGKTDKEEIPFV 227          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Mouse
Match: Nrip3 (nuclear receptor interacting protein 3 [Source:MGI Symbol;Acc:MGI:1925843])

HSP 1 Score: 50.8322 bits (120), Expect = 1.140e-6
Identity = 32/122 (26.23%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  749 MLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHV-DHLIDSRWKGIARGVGTQ-HIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIG-SNNVETPFL 1105
            M+ ++C+    + KA VD+G Q   IS     +  + DH+   + +G    +     +VG++  + + V  + L    +V++D E  + +GL  L+  +C INL ++ L +G ++  E PF+
Sbjct:  117 MILVSCQCAGKDVKALVDTGCQYNLISSACVDRLGLKDHVKSHKHEGEKLSLPRHLKVVGQIEHLMITVGSLRLDCQAAVVDDNEKSLSLGLQTLRSLKCIINLDKHRLIVGKTDKEEIPFV 238          
BLAST of DNA damage-inducible protein 1 vs. UniProt/SwissProt
Match: sp|Q6TH22|DDI2_DANRE (Protein DDI1 homolog 2 OS=Danio rerio OX=7955 GN=ddi2 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.202e-73
Identity = 142/322 (44.10%), Postives = 181/322 (56.21%), Query Frame = 2
Query:  278 PSSLLGNLGIRDGDVLLTS-----RKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRP---------------LVTSIAEQFRQQLLKSP----------PDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            P+  LGN G++DGDVL+       R   Q       RIDFS I     S  G  + RP                 TS       Q L +P          P  LS  K  NP L + L   D  +F ++  EQQ+     ++E   L + +  D   Q+KIEE I++ NI+  M  AME  PESF Q  MLYINC++N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LEDQ MDML+GLDMLKR+QCSI+LK+NVL IG+   ET FLPE ELP+ A+L + 
Sbjct:   57 PTRALGNYGLKDGDVLVLRQAERLRAPPQPTVPGLPRIDFSSIAVPGTS-SGQNRNRPQQAQRPSTTQPPPPQATTSPGSGVSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLERFTKVLMEQQQDRARRDQERIKLLTADPFDLDAQAKIEEEIRQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNVLLIGTTGTETRFLPEAELPECARLAYG 377          
BLAST of DNA damage-inducible protein 1 vs. UniProt/SwissProt
Match: sp|A2ADY9|DDI2_MOUSE (Protein DDI1 homolog 2 OS=Mus musculus OX=10090 GN=Ddi2 PE=1 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 9.767e-73
Identity = 141/309 (45.63%), Postives = 186/309 (60.19%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQ---QTATTSSN--RIDFSGI------NPSL--LSRGGSAQKRPLVTSIAEQ-------FRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFNN 1150
            L + G++DGDV++  +K     + A   SN  RIDFS I      NP    L R  +    P   + + Q        R  LL +P + LS  K  NP L + L   D  KF ++  EQQ+      +E   L S +  D + Q+KIEE I+++NI+  M  AME  PESF Q  MLYINCR+N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LE+Q MDML+GLDMLKR+QCSI+LK+NVL IG+   +T FLPE ELP+ A+L +  
Sbjct:   61 LASYGLKDGDVVILRQKENADPRPAVQFSNLPRIDFSSIAVPGTSNPQQRQLPRTQAQHSSPGEMASSPQGLDNPALLRDMLLANPHE-LSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVAMLYINCRVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLACSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYGT 368          
BLAST of DNA damage-inducible protein 1 vs. UniProt/SwissProt
Match: sp|Q2T9Z1|DDI1_BOVIN (Protein DDI1 homolog 1 OS=Bos taurus OX=9913 GN=DDI1 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.962e-72
Identity = 133/307 (43.32%), Postives = 180/307 (58.63%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQ----------------------FRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKL 1138
            LG+ G++DGD+++  +K      +         + P+  +  G++  RP   + + Q                       R  LL SP D LS  K  NP+L + L   +   F Q+  EQQR      +E   L S +  D + Q+KIEE I+++NI+  M  AME  PESF Q  MLYINCR+N    KAFVDSGAQMT ++   A +C++  L+D RW G+A+GVGTQ I+GRVH  Q+Q+ G FLQ S S+LE+Q MDML+GLDML+R+QCSI+LKRNVL IG+   +T FLPE ELP  AKL
Sbjct:   61 LGSYGLKDGDMVILLQKEAMRPRSPERAAGLCSMEPAGPALPGTSGSRPHQRAQSAQHSSRRGSGEKAGPGQGLDSPALVRSMLLSSPHD-LSLLKERNPSLAEALLSGNLESFSQVLMEQQRERALREQERLRLFSADPFDLEAQAKIEEEIRQQNIEENMSIAMEEAPESFGQVAMLYINCRVNGHPLKAFVDSGAQMTIMNQVCAERCNIIRLVDRRWAGVAKGVGTQRILGRVHLAQIQIEGDFLQCSFSILEEQPMDMLLGLDMLRRHQCSIDLKRNVLVIGTTGTQTSFLPEGELPPCAKL 366          
BLAST of DNA damage-inducible protein 1 vs. UniProt/SwissProt
Match: sp|Q7ZYA7|DDI2_XENLA (Protein DDI1 homolog 2 OS=Xenopus laevis OX=8355 GN=ddi2 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.486e-72
Identity = 134/305 (43.93%), Postives = 182/305 (59.67%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLV----------TSIAEQ-------FRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            L + G++DGDV++     Q+ A  +     F G++ S ++  G++ +              TS   Q        RQ LL +P + LS  K  NP L + L   D  KF ++ +EQQ+      +E   L S +  D   Q+KIEE I++ NI+  M  AME  PESF Q  MLYINC++N    KAFVDSGAQMT +S   A +CH+  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LE+Q MDML+GLDMLKR+QCSI+L++NVL IG+    T FLPE ELP+ A+L + 
Sbjct:   61 LASYGLKDGDVVILR---QKEAPETRPAAPFPGLDFSTIAVPGASSQPDPSQPQAPPPPPDTSSFPQGLDNPALLRQMLLANPHE-LSLLKERNPPLAEALLSGDLEKFTKVLQEQQQERARREQERIRLYSADPFDLDAQAKIEEDIRQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGYPVKAFVDSGAQMTIMSQACAERCHIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLEKNVLVIGTTGTHTTFLPEGELPECARLAYG 361          
BLAST of DNA damage-inducible protein 1 vs. UniProt/SwissProt
Match: sp|Q5TDH0|DDI2_HUMAN (Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 4.738e-71
Identity = 133/309 (43.04%), Postives = 180/309 (58.25%), Query Frame = 2
Query:  290 LGNLGIRDGDVLLTSRKIQQTATTSSN-----RIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSP----------------PDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            L + G++DGDV++  +K               RIDFS I  ++       Q++P  T  +     ++  SP                P  LS  K  NP L + L   D  KF ++  EQQ+      +E   L S +  D + Q+KIEE I+++NI+  M  AME  PESF Q  MLYINC++N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LE+Q MDML+GLDMLKR+QCSI+LK+NVL IG+   +T FLPE ELP+ A+L + 
Sbjct:   61 LASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFSSI--AVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQTTFLPEGELPECARLAYG 367          
BLAST of DNA damage-inducible protein 1 vs. TrEMBL
Match: A0A5J4NI13 (DNA damage-inducible protein 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0004448 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.029e-77
Identity = 127/296 (42.91%), Postives = 192/296 (64.86%), Query Frame = 2
Query:  278 PSSLLGNLGIRDGDVLLT--------------SRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYLHDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELP 1123
            P  +L + G++DGD+++               +  I  T + + +RIDFS I      R   +    + +  AE  RQ +L+ PP +L+  +  NP L   ++DPV F +++E Q+ A  + ++EL+  ++ + LDP VQS+I E+I++KNID  ME+A+EH PE+FAQ +ML++NC++ +   KAFVDSGAQ T +S   A +C+++ LID RW G+A GVGTQ I+GRVH  +L++ G  L  S  VL+DQ +D++IGLDMLKR+QC I+LKRNVL +    +ETPFLPE+E+P
Sbjct:   53 PDKMLESAGLKDGDLVVMVPNSSEASFPQASQNEPIIGTPSATGSRIDFSSI------RIPRSVGPAVPSGEAETIRQMILRGPPHLLALLRQRNPELALLINDPVAFSRVYESQRNAQNDRHQELDFTSNADPLDPAVQSRIAEIIRQKNIDRHMENALEHYPETFAQVSMLFVNCKVGRHLIKAFVDSGAQSTIMSEKCAERCNLEPLIDKRWSGMAYGVGTQTIIGRVHNGELEIEGFILPTSFMVLKDQSLDLMIGLDMLKRHQCCIDLKRNVLVLDGGRIETPFLPESEIP 342          
BLAST of DNA damage-inducible protein 1 vs. TrEMBL
Match: A0A1E1X5B3 (Putative dna damage inducible protein OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 8.284e-77
Identity = 134/282 (47.52%), Postives = 181/282 (64.18%), Query Frame = 2
Query:  305 IRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNF 1144
            I++GDVLL    +  TA+TSS          + +SRGG+ ++ P         R  +LKSP D L+  K  NP L D L   D   F ++  EQQ+   + +R+   + + +  DP+ Q  I E I+++NIDS ME AME++PESF Q  MLYINCR+N    KAF+DSGAQ T +S   A +C +  L+D RW G+A+GVGTQ I+GR+H VQ+++ GVFL  S SVLE+Q MDML+GLDMLKR+QC I+LKRNVL +G+   ETPFL E ELP+ A+L  
Sbjct:   62 IKEGDVLLIQHLVPPTASTSSG---------TEVSRGGAEEEEPAF------IRDMILKSP-DQLALLKHNNPQLADALLSGDLELFTRVLREQQKEKSDRDRQRIRMMNADPFDPETQRLIAEEIRQQNIDSNMEAAMEYHPESFGQVVMLYINCRVNGHPVKAFIDSGAQTTIMSQACAERCAIMRLVDPRWAGVAKGVGTQRIIGRIHLVQIEIEGVFLTSSFSVLEEQPMDMLLGLDMLKRHQCLIDLKRNVLVMGTTGTETPFLGEGELPECARLQM 327          
BLAST of DNA damage-inducible protein 1 vs. TrEMBL
Match: A0A1E1XPG1 (Putative dna damage inducible protein OS=Amblyomma sculptum OX=1581419 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.087e-76
Identity = 134/282 (47.52%), Postives = 180/282 (63.83%), Query Frame = 2
Query:  305 IRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNF 1144
            I++GDVLL    +   A+TSS          + +SRGG+ ++ P         R  +LKSP D L+  K  NP L D L   D   F ++  EQQR   + +R+   + + +  DP+ Q  I E I+++NIDS ME AME++PESF Q  MLYINCR+N    KAF+DSGAQ T +S   A +C +  L+D RW G+A+GVGTQ I+GR+H VQ+++ GVFL  S SVLE+Q MDML+GLDMLKR+QC I+LKRNVL +G+   ETPFL E ELP+ A+L  
Sbjct:   62 IKEGDVLLIQHLVPPAASTSSG---------TEVSRGGAEEEEPAF------IRDMILKSP-DQLALLKHNNPQLADALLSGDLELFTRVLREQQREKSDRDRQRIRMMNADPFDPETQRLIAEEIRQQNIDSNMEAAMEYHPESFGQVVMLYINCRVNGHPVKAFIDSGAQTTIMSQACAERCAIMRLVDPRWAGVAKGVGTQRIIGRIHLVQIEIEGVFLTSSFSVLEEQPMDMLLGLDMLKRHQCLIDLKRNVLVMGTTGTETPFLGEGELPECARLQM 327          
BLAST of DNA damage-inducible protein 1 vs. TrEMBL
Match: A0A023G1U0 (Putative dna damage inducible protein (Fragment) OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.116e-75
Identity = 132/278 (47.48%), Postives = 177/278 (63.67%), Query Frame = 2
Query:  317 DVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNF 1144
            DVLL    +  TA+TSS          + +SRGG+ ++ P         R  +LKSP D L+  K  NP L D L   D   F ++  EQQ+   + +R+   + + +  DP+ Q  I E I+++NIDS ME AME++PESF Q  MLYINCR+N    KAF+DSGAQ T +S   A +C +  L+D RW G+A+GVGTQ I+GR+H VQ+++ GVFL  S SVLE+Q MDML+GLDMLKR+QC I+LKRNVL +G+   ETPFL E ELP+ A+L  
Sbjct:    1 DVLLIQHLVPPTASTSSG---------TEVSRGGAEEEEPAF------IRDMILKSP-DQLALLKHNNPQLADALLSGDLELFTRVLREQQKEKSDRDRQRIRMMNADPFDPETQRLIAEEIRQQNIDSNMEAAMEYHPESFGQVVMLYINCRVNGHPVKAFIDSGAQTTIMSQACAERCAIMRLVDPRWAGVAKGVGTQRIIGRIHLVQIEIEGVFLTSSFSVLEEQPMDMLLGLDMLKRHQCLIDLKRNVLVMGTTGTETPFLGEGELPECARLQM 262          
BLAST of DNA damage-inducible protein 1 vs. TrEMBL
Match: A0A131XDS1 (Putative dna damage inducible protein OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 4.119e-75
Identity = 138/304 (45.39%), Postives = 187/304 (61.51%), Query Frame = 2
Query:  305 IRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFNNXXXXXXXXXXXXXQRVGGGE 1210
            I++GDVLL    +  T  ++S     SG + SL  RG   ++   +       R  +LKSP D L+  K  NP L D L   D   F ++  EQQ+   + +R+   + + +  DP+ Q  I E I+++NIDS ME AME++PESF Q  MLYINCR+N    KAF+DSGAQ T +S   A +C +  L+D RW G+A+GVGTQ I+GR+H VQ+++ GVFL  S SVLE+Q MDML+GLDMLKR+QC I+LKRNVL +G+   ETPFL E ELP+ A+L    +S    +  S    R GG E
Sbjct:   62 IKEGDVLLIQHLMPPTNASTS-----SGTDMSLGPRGAEEEEPAFI-------RDMILKSP-DQLALLKHNNPQLADALLSGDLDLFTRVLREQQKEKSDRDRQRIRMMNADPFDPETQRLIAEEIRQQNIDSNMEAAMEYHPESFGQVVMLYINCRVNGHPVKAFIDSGAQTTIMSQACAERCAIMRLVDPRWAGVAKGVGTQRIIGRIHLVQIEIEGVFLTSSFSVLEEQPMDMLLGLDMLKRHQCLIDLKRNVLVMGTTGTETPFLGEGELPECARLQMLGASQSGSTLGSEASSRAGGSE 352          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Cavefish
Match: ddi2 (DNA damage inducible 1 homolog 2 [Source:NCBI gene;Acc:103030589])

HSP 1 Score: 238.424 bits (607), Expect = 1.149e-69
Identity = 141/314 (44.90%), Postives = 182/314 (57.96%), Query Frame = 2
Query:  290 LGNLGIRDGDVLL----------TSRKIQQTATTSSNRIDFSGI-------NPSLLSRGGSAQKRPLVTSIAEQ---------FRQQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            LGN G++DGDVL+           +    Q +     RIDFS I       N     +  SA + P  TS A            R  LL +P + LS  K  NP L + L   D  +F ++  EQQ+      +E   L + +  D + Q+KIEE I++ NI+  M  AME  PESF Q  MLYINC +N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LEDQ MDML+GLDMLKR+QCSI+LK++VL IG+   ET FLPE ELPD A+L + 
Sbjct:   61 LGNYGLKDGDVLVLRQADRRPPPAAAAAAQPSFPGLPRIDFSSIAVPGTSSNQRSTRQQPSAAQTPQATSPASSPQGLDNPTLLRDMLLANPHE-LSLLKERNPPLAEALLSGDLERFTKVLVEQQQDRAKREQERIRLLTADPFDLEAQAKIEEDIRQHNIEENMTIAMEEAPESFGQVVMLYINCIVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKSVLLIGTTGTETRFLPEAELPDCARLAYG 373          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Cavefish
Match: nrip2 (nuclear receptor-interacting protein 3 [Source:NCBI gene;Acc:103031228])

HSP 1 Score: 55.4546 bits (132), Expect = 3.206e-8
Identity = 32/120 (26.67%), Postives = 57/120 (47.50%), Query Frame = 2
Query:  746 TMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFL 1105
            + L + C+      K  +++G Q   IS    R+  +    +S+  G++R       V  V  +QLQ+    +Q S  V++D+  ++ +GL  L+  +C ++L   VL   S   E PFL
Sbjct:  176 SALLLQCKCGDAEVKVSINTGCQHNHISSTCCRRLGLKSSSESKPPGVSR-------VNTVTSLQLQLGKERVQCSAQVVDDEAFEIRLGLHTLQELKCCVDLNARVLRFHSTGQELPFL 288          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Yeast
Match: DDI1 (DNA damage-inducible v-SNARE binding protein; role in suppression of protein secretion; may play a role in S-phase checkpoint control; has ubiquitin-associated (UBA), ubiquitin-like (UBL), and retroviral-like proteinase (RVP) domains [Source:SGD;Acc:S000000945])

HSP 1 Score: 156.762 bits (395), Expect = 8.629e-44
Identity = 95/234 (40.60%), Postives = 134/234 (57.26%), Query Frame = 2
Query:  455 EQFRQQLLKSPPDILSQYKTFNPTLCDYLHDPVKFKQIHEEQ--QRAVENNNRELEILN---------SGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELP 1123
            EQFRQ+LL +   + SQ     P L D ++DP+ F++       QR     N  +               N  DP  + +I EL+ ++ ID Q+ +A+E+ PE F Q  MLYIN  IN    KAFVD+GAQ T +S   A+K  +  +ID R+ G ARGVGT  I+GR+H  Q+++   ++  S +VL D ++D+LIGLDMLKR+   ++LK NVL I    VET FL E E+P
Sbjct:   95 EQFRQELLNNQ-MLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRYGGYNTAMNPFGIPQDEYTRLMANPDDPDNKKRIAELLDQQAIDEQLRNAIEYTPEMFTQVPMLYINIEINNYPVKAFVDTGAQTTIMSTRLAKKTGLSRMIDKRFIGEARGVGTGKIIGRIHQAQVKIETQYIPCSFTVL-DTDIDVLIGLDMLKRHLACVDLKENVLRIA--EVETSFLSEAEIP 324          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Nematostella
Match: EDO40834 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5W6])

HSP 1 Score: 78.5666 bits (192), Expect = 1.440e-16
Identity = 46/112 (41.07%), Postives = 67/112 (59.82%), Query Frame = 2
Query:  488 PDILSQYKTFNPTLCDYL--HDPVKFKQI-HEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQ 814
            P  +S  K  NP L D L   +  KF  + ++++Q   E   R +  +N+ ++ D + Q +I E I+  NI+  ME AME++PESFA+  MLYIN ++N    KAFVDSGAQ
Sbjct:  136 PHQMSLLKERNPELADALISGNLQKFADVLNKQRQERAERELRRIRTMNA-DMFDAEAQREIAEEIRMSNINQNMETAMEYSPESFAKVIMLYINIKLNGYPVKAFVDSGAQ 246          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Medaka
Match: ddi2 (DNA damage inducible 1 homolog 2 [Source:NCBI gene;Acc:101159071])

HSP 1 Score: 240.736 bits (613), Expect = 7.320e-75
Identity = 141/314 (44.90%), Postives = 186/314 (59.24%), Query Frame = 2
Query:  278 PSSLLGNLGIRDGDVLL---TSRKIQQTATTSSN--RIDFSGIN----PSLLSRGGSAQKRPLVTSIAEQFR-------------QQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            P+  LGN G++DGDV++     R+   T  + S   RIDF  I      S  ++  S Q +P   S    FR             QQ+L S P  LS  K  NP L + L   D  +F ++  EQQ+      +E   L + +  D + Q+KIEE I++ N++  M  AME  PESF Q  MLYINCR+N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LEDQ MDML+GLDMLKR+QCSI+LK+N+L IG+   ET FL E ELP+ A+L + 
Sbjct:   57 PTRALGNYGVKDGDVVVLRQADRRPPPTLPSLSGLPRIDFRSITVPGTSSSTNQRSSPQPQP---STPTAFRGTLPQGLDDPALLQQMLLSNPHELSLLKERNPPLAEALLSGDLERFTKVLLEQQQDRAKREQERIRLLTADPFDLEAQAKIEEDIRQHNVEENMTIAMEEAPESFGQVVMLYINCRVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNLLVIGTTGTETRFLSEAELPECARLAYG 367          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Medaka
Match: ddi2 (DNA damage inducible 1 homolog 2 [Source:NCBI gene;Acc:101159071])

HSP 1 Score: 230.335 bits (586), Expect = 6.531e-71
Identity = 141/335 (42.09%), Postives = 184/335 (54.93%), Query Frame = 2
Query:  278 PSSLLGNLGIRDGDVLL---TSRKIQQTATTSSN--RIDFSGIN-PSLLSRGGS-AQKRPLVTSIAEQ-----------------------FR-------------QQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            P+  LGN G++DGDV++     R+   T  + S   RIDF  I  P   S     +  RPL                              FR             QQ+L S P  LS  K  NP L + L   D  +F ++  EQQ+      +E   L + +  D + Q+KIEE I++ N++  M  AME  PESF Q  MLYINCR+N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LEDQ MDML+GLDMLKR+QCSI+LK+N+L IG+   ET FL E ELP+ A+L + 
Sbjct:   57 PTRALGNYGVKDGDVVVLRQADRRPPPTLPSLSGLPRIDFRSITVPGTSSSTNQRSSARPLPPQQQPSQPQQPQQPQPQPQPQPQPSTPTAFRGTLPQGLDDPALLQQMLLSNPHELSLLKERNPPLAEALLSGDLERFTKVLLEQQQDRAKREQERIRLLTADPFDLEAQAKIEEDIRQHNVEENMTIAMEEAPESFGQVVMLYINCRVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNLLVIGTTGTETRFLSEAELPECARLAYG 391          
BLAST of DNA damage-inducible protein 1 vs. Ensembl Medaka
Match: ddi2 (DNA damage inducible 1 homolog 2 [Source:NCBI gene;Acc:101159071])

HSP 1 Score: 231.491 bits (589), Expect = 1.256e-67
Identity = 141/335 (42.09%), Postives = 184/335 (54.93%), Query Frame = 2
Query:  278 PSSLLGNLGIRDGDVLL---TSRKIQQTATTSSN--RIDFSGIN-PSLLSRGGS-AQKRPLVTSIAEQ-----------------------FR-------------QQLLKSPPDILSQYKTFNPTLCDYL--HDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFN 1147
            P+  LGN G++DGDV++     R+   T  + S   RIDF  I  P   S     +  RPL                              FR             QQ+L S P  LS  K  NP L + L   D  +F ++  EQQ+      +E   L + +  D + Q+KIEE I++ N++  M  AME  PESF Q  MLYINCR+N    KAFVDSGAQMT +S   A +C++  L+D RW GIA+GVGTQ I+GRVH  Q+Q+ G FL  S S+LEDQ MDML+GLDMLKR+QCSI+LK+N+L IG+   ET FL E ELP+ A+L + 
Sbjct:   57 PTRALGNYGVKDGDVVVLRQADRRPPPTLPSLSGLPRIDFRSITVPGTSSSTNQRSSARPLPPQQQPSQPQQPQQPQPQPQPQPQPSTPTAFRGTLPQGLDDPALLQQMLLSNPHELSLLKERNPPLAEALLSGDLERFTKVLLEQQQDRAKREQERIRLLTADPFDLEAQAKIEEDIRQHNVEENMTIAMEEAPESFGQVVMLYINCRVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNLLVIGTTGTETRFLSEAELPECARLAYG 391          
BLAST of DNA damage-inducible protein 1 vs. Planmine SMEST
Match: SMESG000052541.1 (SMESG000052541.1)

HSP 1 Score: 506.138 bits (1302), Expect = 0.000e+0
Identity = 272/341 (79.77%), Postives = 279/341 (81.82%), Query Frame = 2
Query:  119 MRIVLVNDLSEPETIDIDQNTDFATFEMIAGSYVNIDPASXXXXXXXXXXXXLPSSLLGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYLHDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLN 1141
            MRIVLVNDLSEPETIDIDQNTDF TFEMIAGSYVNIDPASIIIKKEGKII+GLPSSL+GNLGIRDGDVLLTSRKIQQTATTSSNRIDFS INPSLLSRG  AQK P       QF Q LLKS PDIL                                         NSG LLD QVQ +IEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCR+NQ +AKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQL VAGVFLQ+SVSVLE+ EMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLN
Sbjct:    1 MRIVLVNDLSEPETIDIDQNTDFTTFEMIAGSYVNIDPASIIIKKEGKIIRGLPSSLIGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSAINPSLLSRGARAQKPP-------QFPQPLLKSNPDIL-----------------------------------------NSGTLLDLQVQGQIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRVNQFDAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLHVAGVFLQISVSVLENMEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLN 293          
BLAST of DNA damage-inducible protein 1 vs. Planmine SMEST
Match: SMESG000052590.1 (SMESG000052590.1)

HSP 1 Score: 504.982 bits (1299), Expect = 2.484e-180
Identity = 272/341 (79.77%), Postives = 279/341 (81.82%), Query Frame = 2
Query:  119 MRIVLVNDLSEPETIDIDQNTDFATFEMIAGSYVNIDPASXXXXXXXXXXXXLPSSLLGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYLHDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLN 1141
            MRIVLVNDLSEPETIDIDQNTDF TFEMIAGSYVNIDPASIIIKKEGKII+GLPSSL+GNLGIRDGDVLLTSRKIQQTATTSSNRIDFS INPSLLSRG  AQK P       QF Q LLKS PDIL                                         NSGNLLD QVQ +IEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCR+NQ +AKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQ IVGRVHCVQLQV GVFLQ+SVSVLE+ EMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLN
Sbjct:    1 MRIVLVNDLSEPETIDIDQNTDFTTFEMIAGSYVNIDPASIIIKKEGKIIRGLPSSLIGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSAINPSLLSRGARAQKPP-------QFPQPLLKSNPDIL-----------------------------------------NSGNLLDLQVQGQIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRVNQFDAKAFVDSGAQMTFISLNFARKCHVDHLIDSRWKGIARGVGTQLIVGRVHCVQLQVTGVFLQISVSVLENMEMDMLIGLDMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLN 293          
BLAST of DNA damage-inducible protein 1 vs. Planmine SMEST
Match: SMESG000052545.1 (SMESG000052545.1)

HSP 1 Score: 457.603 bits (1176), Expect = 6.712e-162
Identity = 237/237 (100.00%), Postives = 237/237 (100.00%), Query Frame = 2
Query:  119 MRIVLVNDLSEPETIDIDQNTDFATFEMIAGSYVNIDPASXXXXXXXXXXXXLPSSLLGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYLHDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFIS 829
            MRIVLVNDLSEPETIDIDQNTDFATFEMIAGSYVNIDPASIIIKKEGKIIKGLPSSLLGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYLHDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFIS
Sbjct:    1 MRIVLVNDLSEPETIDIDQNTDFATFEMIAGSYVNIDPASIIIKKEGKIIKGLPSSLLGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGGSAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYLHDPVKFKQIHEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAMEHNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFIS 237          

HSP 2 Score: 84.3445 bits (207), Expect = 4.249e-18
Identity = 39/43 (90.70%), Postives = 40/43 (93.02%), Query Frame = 3
Query:  879 GKESPEESARSTLLVGSIACNCRSLECFCRCQSAYSRTKKWIC 1007
            GKE PE SARSTLLV SIACNCRSLECFCRCQSAYSRT+KWIC
Sbjct:  238 GKELPEASARSTLLVESIACNCRSLECFCRCQSAYSRTRKWIC 280          
The following BLAST results are available for this feature:
BLAST of DNA damage-inducible protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DDI29.865e-7243.04DNA damage inducible 1 homolog 2 [Source:HGNC Symb... [more]
DDI11.960e-7143.77DNA damage inducible 1 homolog 1 [Source:HGNC Symb... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ddi-11.815e-3443.79pep chromosome:WBcel235:IV:6522874:6524568:1 gene:... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rngo1.473e-6341.88gene:FBgn0030753 transcript:FBtr0343349[more]
rngo1.473e-6341.88gene:FBgn0030753 transcript:FBtr0074278[more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ddi21.506e-7444.10DNA-damage inducible protein 2 [Source:NCBI gene;A... [more]
ddi21.592e-7444.10DNA-damage inducible protein 2 [Source:NCBI gene;A... [more]
nrip23.623e-625.40nuclear receptor interacting protein 2 [Source:ZFI... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ddi25.330e-7243.46DNA damage inducible 1 homolog 2 [Source:NCBI gene... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ddi21.396e-7345.63DNA-damage inducible protein 2 [Source:MGI Symbol;... [more]
Ddi17.517e-6951.75DNA-damage inducible 1 [Source:MGI Symbol;Acc:MGI:... [more]
Nrip31.069e-626.23nuclear receptor interacting protein 3 [Source:MGI... [more]
Nrip31.140e-626.23nuclear receptor interacting protein 3 [Source:MGI... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6TH22|DDI2_DANRE1.202e-7344.10Protein DDI1 homolog 2 OS=Danio rerio OX=7955 GN=d... [more]
sp|A2ADY9|DDI2_MOUSE9.767e-7345.63Protein DDI1 homolog 2 OS=Mus musculus OX=10090 GN... [more]
sp|Q2T9Z1|DDI1_BOVIN1.962e-7243.32Protein DDI1 homolog 1 OS=Bos taurus OX=9913 GN=DD... [more]
sp|Q7ZYA7|DDI2_XENLA2.486e-7243.93Protein DDI1 homolog 2 OS=Xenopus laevis OX=8355 G... [more]
sp|Q5TDH0|DDI2_HUMAN4.738e-7143.04Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NI131.029e-7742.91DNA damage-inducible protein 1 OS=Paragonimus west... [more]
A0A1E1X5B38.284e-7747.52Putative dna damage inducible protein OS=Amblyomma... [more]
A0A1E1XPG11.087e-7647.52Putative dna damage inducible protein OS=Amblyomma... [more]
A0A023G1U02.116e-7547.48Putative dna damage inducible protein (Fragment) O... [more]
A0A131XDS14.119e-7545.39Putative dna damage inducible protein OS=Hyalomma ... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ddi21.149e-6944.90DNA damage inducible 1 homolog 2 [Source:NCBI gene... [more]
nrip23.206e-826.67nuclear receptor-interacting protein 3 [Source:NCB... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DDI18.629e-4440.60DNA damage-inducible v-SNARE binding protein; role... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO408341.440e-1641.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ddi27.320e-7544.90DNA damage inducible 1 homolog 2 [Source:NCBI gene... [more]
ddi26.531e-7142.09DNA damage inducible 1 homolog 2 [Source:NCBI gene... [more]
ddi21.256e-6742.09DNA damage inducible 1 homolog 2 [Source:NCBI gene... [more]
back to top
BLAST of DNA damage-inducible protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052541.10.000e+079.77SMESG000052541.1[more]
SMESG000052590.12.484e-18079.77SMESG000052590.1[more]
SMESG000052545.16.712e-162100.00SMESG000052545.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013263 ID=SMED30013263|Name=DNA damage-inducible protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1292bp
GTTTGTTTGAAATTATCGATTGTTTTGAATTATTTGAACTAATTTATAGT
TGTTATACATTGAGTTAAGCTTTAATAATTATTTGTTTTAAAATATTTAA
TTCCTATATTTTATAATCATGAGAATTGTACTTGTAAATGATTTATCTGA
ACCAGAAACTATCGATATTGACCAAAATACTGACTTTGCTACTTTTGAAA
TGATCGCTGGATCTTATGTTAACATTGACCCGGCTAGTATTATAATCAAA
AAAGAAGGAAAAATAATCAAAGGTTTGCCTTCAAGTCTATTAGGCAATCT
AGGTATTCGAGACGGGGATGTTTTGTTGACTTCCAGAAAAATTCAACAAA
CTGCGACAACTAGTTCGAATCGTATCGATTTTTCTGGTATTAATCCTTCT
CTATTATCACGAGGAGGAAGTGCACAAAAACGTCCACTTGTTACTTCTAT
AGCTGAACAATTTCGTCAACAGCTATTGAAATCACCTCCAGATATATTAA
GTCAATATAAGACTTTCAATCCAACTTTATGTGATTATTTACATGATCCT
GTTAAATTTAAACAGATCCATGAAGAACAACAGAGGGCAGTTGAAAACAA
CAATAGAGAATTAGAAATATTAAACAGTGGTAATTTATTAGATCCGCAAG
TGCAAAGCAAAATTGAGGAACTAATTAAAAAGAAAAATATCGATTCCCAA
ATGGAGCATGCAATGGAACACAATCCAGAATCATTTGCTCAAACGACAAT
GCTCTACATCAATTGCCGAATCAATCAATTAAACGCTAAAGCGTTCGTAG
ATTCGGGTGCCCAGATGACTTTTATCAGTCTGAATTTCGCCCGGAAATGT
CATGTAGATCATTTAATTGACAGCAGGTGGAAAGGAATCGCCAGAGGAGT
CGGCACGCAGCACATTGTTGGTCGGGTCCATTGCGTGCAACTGCAGGTCG
CTGGAGTGTTTCTGCAGATGTCAGTCAGCGTACTCGAGGACCAAGAAATG
GATATGCTAATCGGGTTGGACATGCTCAAGCGCTACCAGTGCAGCATCAA
TCTGAAACGGAACGTCCTAGAAATCGGCAGCAACAACGTCGAAACGCCAT
TTTTACCGGAAAACGAATTGCCAGATTATGCCAAACTCAATTTCAACAAT
TCCTCTTAGCCTGATTTATCGCCCCGTTCTCGACTGCTGCAGCGAGTGGG
GGGTGGAGAGGGGGCAAATTGACCCGGCTGCCAGTCGAATATATTTTGAT
AAGATCTTTTTTTAATATAAAATTTTAAATTTGTTTTGCCAT
back to top

protein sequence of SMED30013263-orf-1

>SMED30013263-orf-1 ID=SMED30013263-orf-1|Name=SMED30013263-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=347bp
MRIVLVNDLSEPETIDIDQNTDFATFEMIAGSYVNIDPASIIIKKEGKII
KGLPSSLLGNLGIRDGDVLLTSRKIQQTATTSSNRIDFSGINPSLLSRGG
SAQKRPLVTSIAEQFRQQLLKSPPDILSQYKTFNPTLCDYLHDPVKFKQI
HEEQQRAVENNNRELEILNSGNLLDPQVQSKIEELIKKKNIDSQMEHAME
HNPESFAQTTMLYINCRINQLNAKAFVDSGAQMTFISLNFARKCHVDHLI
DSRWKGIARGVGTQHIVGRVHCVQLQVAGVFLQMSVSVLEDQEMDMLIGL
DMLKRYQCSINLKRNVLEIGSNNVETPFLPENELPDYAKLNFNNSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR019103Peptidase_aspartic_DDI1-type
IPR021109Peptidase_aspartic_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 148..168
NoneNo IPR availablePANTHERPTHR12917ASPARTYL PROTEASE DDI-RELATEDcoord: 8..340
IPR019103Aspartic peptidase, DDI1-typePFAMPF09668Asp_proteasecoord: 188..311
e-value: 1.1E-50
score: 170.6
IPR019103Aspartic peptidase, DDI1-typeCDDcd05479RP_DDIcoord: 196..319
e-value: 7.73151E-66
score: 202.012
IPR021109Aspartic peptidase domain superfamilyGENE3DG3DSA:2.40.70.10coord: 189..336
e-value: 5.5E-45
score: 154.5
IPR021109Aspartic peptidase domain superfamilySUPERFAMILYSSF50630Acid proteasescoord: 196..312