Retrovirus-related Pol polyprotein from transposon

Overview
NameRetrovirus-related Pol polyprotein from transposon
Smed IDSMED30013261
Length (bp)5804
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retrovirus-related Pol polyprotein from transposon (SMED30013261) t-SNE clustered cells

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from transposon (SMED30013261) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retrovirus-related Pol polyprotein from transposon (SMED30013261) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from transposon (SMED30013261) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013261

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013261 dd_Smed_v4_15498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013261 dd_Smed_v4_15498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013261 dd_Smed_v4_15498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013261 dd_Smed_v4_15498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013261 dd_Smed_v4_15498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013261 dd_Smed_v4_15498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013261 dd_Smed_v4_15498_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 69.3218 bits (168), Expect = 9.152e-11
Identity = 64/272 (23.53%), Postives = 111/272 (40.81%), Query Frame = 1
Query: 5008 KSPYSSPLVVVAKR-DGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGL-----KGAPPTFLRAMNIMLMDAHH----------AMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFP 5775
            + P ++P   V  R     RL  +Y  L +   +    + ++  ++D++  +  FT ++ +       + E S+   G  T+D         FGL     K   P  L    I+  +  H           + Y  ++ I+S    +HL H+  +  R    N+     K ++  Q V ++  V++   VK +      +  +P P +   ++ F+     Y  F+  FS IA PL        +F WG E+QEAF  LK A  K P+L  P
Sbjct:  609 ECPSTAPWEPVGARMQERARLQEEYWDLQDMLTNRQDYIQMIPELFDQLHGAEWFTKLELRG-----TIVEESV--NGHRTED----VWKAAFGLELEEMKSYQPFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQFYWGVEEQEAFECLKRAFRKAPLLHHP 869          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Human
Match: RTL1 (retrotransposon Gag like 1 [Source:HGNC Symbol;Acc:HGNC:14665])

HSP 1 Score: 69.3218 bits (168), Expect = 9.152e-11
Identity = 64/272 (23.53%), Postives = 111/272 (40.81%), Query Frame = 1
Query: 5008 KSPYSSPLVVVAKR-DGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGL-----KGAPPTFLRAMNIMLMDAHH----------AMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFP 5775
            + P ++P   V  R     RL  +Y  L +   +    + ++  ++D++  +  FT ++ +       + E S+   G  T+D         FGL     K   P  L    I+  +  H           + Y  ++ I+S    +HL H+  +  R    N+     K ++  Q V ++  V++   VK +      +  +P P +   ++ F+     Y  F+  FS IA PL        +F WG E+QEAF  LK A  K P+L  P
Sbjct:  609 ECPSTAPWEPVGARMQERARLQEEYWDLQDMLTNRQDYIQMIPELFDQLHGAEWFTKLELRG-----TIVEESV--NGHRTED----VWKAAFGLELEEMKSYQPFALSPDPIIPQNVIHFILKDMLGFFVLSYGQEVLIYSMSQEEHLHHVRQVLVRFRHHNVYCSLDKSQFHRQTVEFLGFVVTPKGVKLNKNVMTIITGYPTPGSKLSLRNFIEFVFPYRHFVERFSIIAEPLVRQLLSSYQFYWGVEEQEAFECLKRAFRKAPLLHHP 869          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Celegans
Match: K02E2.6 (pep chromosome:WBcel235:V:20380580:20381966:1 gene:WBGene00010507.1 transcript:K02E2.6.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K02E2.6)

HSP 1 Score: 52.373 bits (124), Expect = 1.285e-7
Identity = 31/101 (30.69%), Postives = 55/101 (54.46%), Query Frame = 3
Query: 4080 NLANKPTIKIKVNRHTVHALIDSGSDLTMIEANLLNET*LQAIAPTLT-TATGANGQAINVIGILDCELRLCDQKFRHDIKVT--RECMAECIVGMDILKK 4373
            N    P +++ VN   VH L+D+G+ ++ +  + +N   L+ + PT    A  ANG  I   GI+   LR+ ++ F H + V+  ++C  E ++G D +KK
Sbjct:   22 NRGRLPVVQVGVNGKVVHVLLDTGAGISYLPISKIN---LKDLDPTYQLQAHAANGTPILFHGIVKLALRMGNRVFEHTLHVSDDKDCPTEMLLGTDFMKK 119          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Celegans
Match: K02E2.6 (pep chromosome:WBcel235:V:20380561:20382036:1 gene:WBGene00010507.1 transcript:K02E2.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K02E2.6)

HSP 1 Score: 52.373 bits (124), Expect = 1.285e-7
Identity = 31/101 (30.69%), Postives = 55/101 (54.46%), Query Frame = 3
Query: 4080 NLANKPTIKIKVNRHTVHALIDSGSDLTMIEANLLNET*LQAIAPTLT-TATGANGQAINVIGILDCELRLCDQKFRHDIKVT--RECMAECIVGMDILKK 4373
            N    P +++ VN   VH L+D+G+ ++ +  + +N   L+ + PT    A  ANG  I   GI+   LR+ ++ F H + V+  ++C  E ++G D +KK
Sbjct:   22 NRGRLPVVQVGVNGKVVHVLLDTGAGISYLPISKIN---LKDLDPTYQLQAHAANGTPILFHGIVKLALRMGNRVFEHTLHVSDDKDCPTEMLLGTDFMKK 119          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 216.853 bits (551), Expect = 4.889e-56
Identity = 113/304 (37.17%), Postives = 169/304 (55.59%), Query Frame = 1
Query: 4894 LTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDA--HHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            L  T P K + Y +    +E + K I       IIR S SP  +    V K+DGS+R C DYR LN  TV + +PLPL+   +++++ +  FT +D +  ++ +++ E     T F+T   HFEY ++ FGL  AP  F   +N +L D       VY+DDI IFS  L +H++H+  + +RL+   L VK  KC +  Q V ++ H++S + ++ DP   + V ++P P + K ++ FLG   +Y +FIRNFS +A PLT L      F W N  Q AF+ LK   V  PIL  PD +RQF+V
Sbjct:  519 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSLKTPFRWSNAAQVAFDRLKSCFVSAPILIAPDPSRQFVV 822          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 213.386 bits (542), Expect = 5.680e-55
Identity = 110/304 (36.18%), Postives = 168/304 (55.26%), Query Frame = 1
Query: 4894 LTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDA--HHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            L  T P K + Y +    +E + K I       IIR S SP  +    V K+DGS+R C DYR LN  TV + +PLPL+   +++++ +  FT +D +  ++ +++       + F+T   HFEY ++ FGL  AP  F   +N +L D       VY+DDI IFS  L +H++H+  + +RL+   L VK  KC +  Q V ++ H++S + ++ DP   + V N+P P + K ++ FLG   +Y +FIRNFS +A PLT L      F W +  + AF+ LK   V  PIL  PD +RQF+V
Sbjct:  521 LPGTSPPKGKLYSLSAPEREAMGKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNNITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRAGDEWKSAFNTPRGHFEYCVLPFGLSNAPAVFQAFVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHIRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTALTSSKTPFRWSSAAEAAFSKLKGCFVSAPILITPDPSRQFVV 824          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 211.075 bits (536), Expect = 2.247e-54
Identity = 110/304 (36.18%), Postives = 169/304 (55.59%), Query Frame = 1
Query: 4894 LTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDA--HHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            L  T P K + Y +    +E + K I       IIR S SP  +    V K+DGS+R C DYR LN  TV + +PLPL+   +++++ +  FT +D +  ++ +++       T F+T   HFEY ++ FGL  AP  F   +N +L D       VY+DDI IFS  L +H++H+  + +RL+   L VK  KC +  Q V ++ H++S + ++ DP   + V ++P P + K ++ FLG   +Y +FIRNFS +A PLT L    + F W +  + AF+ LK   V  PIL  PD +RQF+V
Sbjct:  493 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTSLTSSKMPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVV 796          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: CR925755.2 (pep chromosome:GRCz11:17:42486740:42492668:-1 gene:ENSDARG00000116402.1 transcript:ENSDART00000183946.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR925755.2)

HSP 1 Score: 211.075 bits (536), Expect = 2.337e-54
Identity = 111/304 (36.51%), Postives = 166/304 (54.61%), Query Frame = 1
Query: 4894 LTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDA--HHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            L  T P K + Y +    +E + K I       IIR S SP  +    V K+DGS+R C DYR LN  TV + +PLPL+   +++++ +  FT +D +  ++ +++       T F+T   HFEY ++ FGL  AP  F   +N +L D       VY+DDI IFS  L +H++H+  + +RL+   L VK  KC +  Q V ++ H +S + ++ DP   + V N+P P + K ++ FLG   +Y +FIRNF  +A PLT L      F W N  + AF+ LK   V  PIL  PD +RQF+V
Sbjct:  492 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHTVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIRNFRQLAAPLTNLTSSKTPFRWSNAAEAAFSKLKGCFVSAPILIAPDPSRQFVV 795          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 209.534 bits (532), Expect = 8.828e-54
Identity = 110/304 (36.18%), Postives = 166/304 (54.61%), Query Frame = 1
Query: 4894 LTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDA--HHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            L  T P K + Y +    +E + K I       IIR S SP  +    V K+DGS+R C DYR LN  TV + +PLPL+   +++++ +  FT +D +  ++ + +       T F+T   HFEY ++ FGL  AP  F   +N +L D       VY+DDI IFS  L +H++H+  + +RL+   L VK  KC +  Q V ++ H++S + ++ DP   + V N+P P + K ++ FLG   +Y +FI NFS +A PLT L      F W +  + AF+ LK   V  PIL  PD +RQF+V
Sbjct:  519 LPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHIQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIHNFSQLAAPLTSLTSSKTPFRWSSAAEAAFSKLKGCFVSAPILIAPDPSRQFVV 822          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 243.817 bits (621), Expect = 8.773e-67
Identity = 116/336 (34.52%), Postives = 201/336 (59.82%), Query Frame = 1
Query: 4801 KVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAH-HAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVL--EKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            ++ ++LR Y  +F+ +    G+ +  EH+++     PI+   Y++ ++++  +  QI  M  + +I  S SP++SP+V+V K+DGS R C DYR+LN+ T +D +P+P +D + D++ N++  T +D  +G++QI ++ ++   + F T    +++ +M FG++ AP TF R +N +L      A  Y+DDI +FS+   +HL+HL+ ++ ++  A L +KP KC  A  EV Y+ H +    ++PDP   E +  +P P   KQ+  FLG +GYY +FI N+S +A PLT L   ++     W  E + A N LK AL   P+L  PDF+R+F++
Sbjct:  304 QLRKILRSYSPMFSANP---GRTHWAEHKVDTGTQLPIRSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGSTRFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNRLLEGMQDFAQAYLDDIAVFSQTWEEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYSTVAKPLTDLTSRQRSRTIVWTPECESAMNALKQALASSPVLAAPDFSRRFIL 636          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: alkbh5 (alkB homolog 5, RNA demethylase [Source:Xenbase;Acc:XB-GENE-987580])

HSP 1 Score: 223.016 bits (567), Expect = 1.081e-61
Identity = 108/305 (35.41%), Postives = 181/305 (59.34%), Query Frame = 1
Query: 4771 SKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLM-DAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEK 5682
            ++ LT  +  ++ + L +  Q+F+      G   +++H+I       + +RPY+IP++ ++ V  +IK M + ++I  S S +SSP+V+V K DGSIR CND+RKLNE +  D +P+P +D + +++  +R  T +D  KG++Q+ ++E +   T FST +  ++Y  + FGL GAP TF R M+ +L     +A  Y+DD+ IFS D   HL  ++ +   +  A L   P KC    +E  Y+ +VI    VKP     E ++ +P+P + KQ++ FLG+ GYY +F+ NF+++A PLT L K
Sbjct:  192 AETLTNSQKQEMREFLIRNRQIFSDQP---GLTEMIKHDIITGPGVKVNVRPYRIPEARRQAVAGEIKRMLELDVIEESHSEWSSPIVLVPKPDGSIRFCNDFRKLNEVSKFDAYPMPRVDELIERLGQARYITTLDLTKGYWQVPLTEGAKEKTAFSTPEGQWQYKRLPFGLHGAPATFQRMMDRILKPHRGYASAYLDDVVIFSPDWESHLPRVQAVLDSIWKAGLTANPKKCAMGLEEARYLGYVIGRGVVKPQVSKIEGIQQWPRPNSKKQVRAFLGIVGYYRRFVPNFASLASPLTDLTK 493          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.55 bits (558), Expect = 5.628e-57
Identity = 116/359 (32.31%), Postives = 195/359 (54.32%), Query Frame = 1
Query: 4801 KVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAH--HAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLT---------------VLEK--KGVKFT-------WGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            ++ + L ++  +F++++ D+G     +H+I L E KP + R  +I     E + K ++ ++   II+ S+SPY+SP+VVV K++GSIR+C DYR LN++T+ D +  P ++   + +  S+ F+V+D + G+YQ+ M       T F      FE+  M  GL GAP TF R M   + D H    +VY+DD+ +F   L +H + L  ++ RL    LK+ P KC++ +  V YV HV+S + +  DP   E V ++P+P  + +++ FLG  GYY +F++ FS +A PL                +L K  +G  +T       W  E  +AF+ LK  L   P+L + D  + + +
Sbjct:  290 RLRKHLNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRERSRRIAPGDLEDLRKHLEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSKVAQPLNQLLQSNTEVEGSDRDILAKRLRGQGWTRESIEDFWTEECDKAFDQLKYCLTHAPVLAYADATKPYTL 648          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.726 bits (465), Expect = 4.357e-47
Identity = 100/300 (33.33%), Postives = 163/300 (54.33%), Query Frame = 1
Query: 4909 PIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMD--AHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSA-IAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            P + R Y +  +    + + I    +   IR S SP  +    V K+DG +R C DYR LN+ TV + +PLPL+  ++D++K +++F+ +D +  +  I++ E     T F+T D H+EYL+M FGL  AP  F   +N +  D      +VY+DDI IFS+DL  H   +++   RL   +L  K  KC +   ++ ++ ++IS    + DP     ++ +P P + K I+ F+G   YY QFI+ FS+ IA  L+++ K G    W     EAF +LKDA +   +LR P+ +  F +
Sbjct:    2 PPRGRTYPLSPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFI 301          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: denr (density-regulated protein [Source:Xenbase;Acc:XB-GENE-1002798])

HSP 1 Score: 183.726 bits (465), Expect = 5.094e-46
Identity = 100/300 (33.33%), Postives = 163/300 (54.33%), Query Frame = 1
Query: 4909 PIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMD--AHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSA-IAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            P + R Y +  +    + + I    +   IR S SP  +    V K+DG +R C DYR LN+ TV + +PLPL+  ++D++K +++F+ +D +  +  I++ E     T F+T D H+EYL+M FGL  AP  F   +N +  D      +VY+DDI IFS+DL  H   +++   RL   +L  K  KC +   ++ ++ ++IS    + DP     ++ +P P + K I+ F+G   YY QFI+ FS+ IA  L+++ K G    W     EAF +LKDA +   +LR P+ +  F +
Sbjct:  520 PPRGRTYPLSPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLDKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFSSRIAPILSLIRKGGRPNCWPPVALEAFQSLKDAFISASVLRHPEPHLPFFI 819          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 55.0694 bits (131), Expect = 1.327e-6
Identity = 36/142 (25.35%), Postives = 61/142 (42.96%), Query Frame = 1
Query: 5368 DIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQF 5793
            ++ ++S    +H +H+  +  R    N+     K ++  Q    +   IS   VK +      +   P P + + ++  + L   Y  F+ NF+ IA PL         + WG E+QEA  +LK A  K P+L  P     F
Sbjct:  995 EVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPF 1136          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Mouse
Match: Rtl1 (retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:MGI:2656842])

HSP 1 Score: 55.0694 bits (131), Expect = 1.327e-6
Identity = 36/142 (25.35%), Postives = 61/142 (42.96%), Query Frame = 1
Query: 5368 DIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQF 5793
            ++ ++S    +H +H+  +  R    N+     K ++  Q    +   IS   VK +      +   P P + + ++  + L   Y  F+ NF+ IA PL         + WG E+QEA  +LK A  K P+L  P     F
Sbjct:  995 EVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLSSEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPF 1136          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.585e-70
Identity = 150/349 (42.98%), Postives = 211/349 (60.46%), Query Frame = 1
Query: 4780 LTRRENIKVNQLLRKYDQVFAKHEYD-LGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKR-DGS----IRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIML--MDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGN-EQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            L   E  ++  LL+KY  +   HE D L   N  +H IN     P+  + Y  PQ+ ++ V  QI+ M    IIR+S SPY+SP+ VV K+ D S     R+  DYRKLNE TV D HP+P +D I  K+     FT +D  KGF+QI+M   S+  T FST   H+EYL M FGLK AP TF R MN +L  +   H +VY+DDI +FS  L++HL+ L  ++++L  ANLK++  KC++ +QE  ++ HV++ D +KP+P   E ++ +P PT  K+IK FLGLTGYY +FI NF+ IA P+T   KK +K    N E   AF  LK  + + PIL+ PDF ++F +
Sbjct:  165 LNNEEKQRLCALLQKYHDI-QYHEGDKLTFTNQTKHTINTKHNLPLYSK-YSYPQAYEQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTKCLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTL 511          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.690e-68
Identity = 141/348 (40.52%), Postives = 210/348 (60.34%), Query Frame = 1
Query: 4780 LTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKR-DGS----IRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIML--MDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKF-TWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            L + E  K+  LL K+  +  K    L   N ++H +N T   PI  + Y + Q+ +  V  Q++ M    +IR S SPY+SP  VV K+ D S     R+  DYRKLNE T+ D +P+P +D I  K+   + FT +D  KGF+QI+M E SI  T FST   H+EYL M FGL+ AP TF R MN +L  +   H +VY+DDI IFS  L +HL  ++ ++ +L  ANLK++  KC++ ++E  ++ H+++ D +KP+P   + + ++P PT  K+I+ FLGLTGYY +FI N++ IA P+T   KK  K  T   E  EAF  LK  +++ PIL+ PDF ++F++
Sbjct:  163 LNQEETFKLKGLLNKFRNLEYKEGEKLTFTNTIKHVLNTTHNSPIYSKQYPLAQTHEIEVENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVL 510          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 209.92 bits (533), Expect = 5.086e-53
Identity = 111/284 (39.08%), Postives = 163/284 (57.39%), Query Frame = 1
Query: 4915 KIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPIL 5766
            +++PY + +  ++ +NK ++ +     I  SKSP SSP+V+V K+DG+ RLC DYR LN+ T+SD  PLP +D +  ++ N+++FT +D   G++QI M       T F T    +EY +M FGL  AP TF R M     D     VY+DDI IFSE   +H +HL+ + +RL   NL VK  KCK+A +E  ++ + I    + P       +R+FP P  VKQ + FLG+  YY +FI N S IA P+ +      K  W  +Q +A + LKDAL   P+L
Sbjct:  598 RLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICD--KSQWTEKQDKAIDKLKDALCNSPVL 879          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 206.453 bits (524), Expect = 5.303e-52
Identity = 110/284 (38.73%), Postives = 161/284 (56.69%), Query Frame = 1
Query: 4915 KIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPIL 5766
            +++PY + +  ++ +NK ++ +     I  SKSP SSP+V+V K+DG+ RLC DYR LN+ T+SD  PLP +D +  ++ N+++FT +D   G++QI M       T F T    +EY +M FGL  AP TF R M     D     VY+DDI IFSE   +H +HL+ + +RL   NL VK  KCK+A +E  ++ + I    + P       +R+FP P  VKQ + FLG+  YY +FI N S IA P+ +      K  W  +Q +A   LK AL   P+L
Sbjct:  624 RLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICD--KSQWTEKQDKAIEKLKAALCNSPVL 905          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.557e-51
Identity = 114/348 (32.76%), Postives = 189/348 (54.31%), Query Frame = 1
Query: 4804 VNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKR-----DGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMD--AHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVL-----------EKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQF 5793
            +N LL ++ ++F      +     ++ EI      PI  + Y  P +++  V +QI  + +  IIR S SPY+SP+ +V K+     +   R+  D+++LN  T+ D +P+P ++     + N++ FT +D   GF+QI M E+ IP T FST +  +E+L + FGLK AP  F R ++ +L +       VYIDDI +FSED + H ++L  +   L  ANL+V   K  + + +V ++ ++++ D +K DP     +   P PT+VK++K FLG+T YY +FI++++ +A PLT L           +   V  T      ++FN+LK  L    IL FP F + F
Sbjct:   88 LNSLLGEFPRIFEPPLSGMSVETAVKAEIRTNTQDPIYAKSYPYPVNMRGEVERQIDELLQDGIIRPSNSPYNSPIWIVPKKPKPNGEKQYRMVVDFKRLNTVTIPDTYPIPDINATLASLGNAKYFTTLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDDILREHIGKVCYVYIDDIIVFSEDYDTHWKNLRLVLASLSKANLQVNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMTSYYRKFIQDYAKVAKPLTNLTRGLYANIKSSQSSKVPITLDETALQSFNDLKSILCSSEILAFPCFTKPF 435          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A355ABF2 (Uncharacterized protein OS=Flavobacteriaceae bacterium OX=1871037 GN=DDZ39_05755 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 2.192e-107
Identity = 184/458 (40.17%), Postives = 273/458 (59.61%), Query Frame = 1
Query: 4429 VFLDRVVTIPPRTETVCFVATHQEMEGDVIFEPKVEFASKYNTPITQNLATXXXXXXXXXXTNMDNKTLRLYPDTRVGKIVRLKDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMVM 5802
            +++    TIP   E V  +  H   +  VIFEP   FA      +   +       IP+R  N  N  ++L     +G I  +   +  VA+V            E    PN     L   +N  +  + +KY +VFA  ++DLG+ NI++H I L +  PIK RPYK   +L+  + KQ++ M+   +IR+S SP++SP+V+V K+DG++R C DYRKLN  T  D +PLP +D + DK+ NS+ FT +D Q G++QI++SE     T F+T +  +E+ ++ FGL GAP TF R M+ +LMDA HAMVYIDDI I+S D ++HL  +  + +RL +A LK+KP KC+WA+  V ++ H++S + +KPDP N EK++NF +P  VK I+ FLG+ GYY +FI NF+ IA PL  L KK     W  + QE+F  LK+ L+  P+LRFPD N+ F++M
Sbjct: 1202 IYVTEDTTIPKWNEVVMPMQIHCNDDKTVIFEPNDIFADTNCLSVATTVTNTDNSTIPVRFVNYSNDNIQLQQGQHIGTIHEIDVVEVNVAKVF-----------EGGMPPNFPFDYLNNEQNQAMENIFQKYSKVFATDDFDLGKTNIIKHFIPLDKDNPIKQRPYKAAYALKGEIKKQVEDMKHNKVIRNSFSPWASPIVMVKKKDGTMRFCVDYRKLNTVTRKDTYPLPRIDEMLDKLNNSKFFTSLDLQSGYWQIEISEEDKYKTAFTTGEGLYEFNVLPFGLTGAPATFQRCMSHILMDASHAMVYIDDILIYSIDFDEHLHDITMVLQRLELAGLKIKPRKCEWAKSMVTFLGHLVSSEGIKPDPKNVEKIKNFEKPVKVKGIQRFLGMAGYYRKFIPNFAKIASPLFDLTKKNDNTLWTEKHQESFEELKNRLIHFPVLRFPDMNKDFIIM 1648          

HSP 2 Score: 75.0998 bits (183), Expect = 2.192e-107
Identity = 40/100 (40.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query: 4095 PTIKIKVNRHTVHALIDSGSDLTMIEANLLNET*LQAIAPTLTTATGANGQAINVIGILDCELRLCDQKFRHDIKVTRECMAECIVGMDILKKLKDIVFD 4394
            P I +++N  T  ALID+GS  T++    L     + I PT     G +G  +N IG L CEL +C+QK   ++ V +     CI+GM  L KLK IVFD
Sbjct: 1084 PKILVQINGRTRIALIDTGSGATLLNYEGLKPQYRRLIKPTCLKVQGMSGTILNPIGQLLCELTICNQKISSELVVVKNLPYPCIIGMSTLSKLKGIVFD 1183          

HSP 3 Score: 254.988 bits (650), Expect = 8.275e-101
Identity = 130/329 (39.51%), Postives = 207/329 (62.92%), Query Frame = 3
Query: 2613 YVNNKIDFLYHDLQRQMQEMYQEVVLNDCRLNREIIRNRLAISVANPDLIMPML-MEHGTFGRIMGEAIYSYQCKIVEVEIAKYDKCTLELPVLYEGKLRFVAPVTHRILKEGEEPQKSTCNPAMSPLYKI-NNHWITLPDRKPPSKPVEILQAIKLTSKVEFRPLNELSKGGVYTPEDIEEARRAIGFPQVRDRGVTEIITRIYKHYDG-KLDYNLLFGPDHYRQAASNVIKKIWGRFTSFGIFVAGCSGIYAIFMILKIIASQLLSTYSIFKIGGWSWKLLLGMCPLCADFAVFRHDNKEIKMMKQRNLIKHEIVREWDEDYSHRDD 3590
            Y NNK D+LYH   RQ++++Y+E+++NDC+LNREI+R ++A+ V NP++  P++ +  G F R++GE + +++CK VEV+I     CT ELPV+Y+ K  ++ PVT  +L +  + +K  C+P  SP YK+ +N WI  P   P + P +  Q   L + V+F  L +L K G+Y  + +E+AR+ + +PQVRDR +TEI+       DG + +Y LL  P+H+ +AA NV+KK+WGRF  FG  +AG  GIY + + LK    Q+ STY ++KI G+SWKL+LG+ P  A   + +  + +I  ++++   +H      +E   H DD
Sbjct:  696 YFNNKADYLYHHQLRQIEDLYREMIINDCKLNREILRTKMALIVTNPNIAAPVIPLGKGVFSRVLGEVLQTFKCKQVEVKINISSDCTHELPVIYKNKFMYLEPVTRLLLPDVIKVKKIKCSPLFSPAYKLSDNTWIVTPSLTPIAPP-KRFQLTNLRNAVKFSRLKDLMKSGLYDKKAMEDARKYLLYPQVRDRILTEIVETSLG--DGNRPNYELLLSPNHFEKAAKNVMKKVWGRFLIFGQAIAGLMGIYYVVIFLKTFIEQVTSTYELYKIMGFSWKLILGIIPCLARPFISKKLHDKINDVEKKYANRHTYSNRDEEINVHVDD 1021          

HSP 4 Score: 145.591 bits (366), Expect = 8.275e-101
Identity = 88/286 (30.77%), Postives = 149/286 (52.10%), Query Frame = 1
Query: 1699 SMTAYDCSNPSLGKIYSLVDTVDCREAYPDKVTKGEDVEYHVYQETDFYRTRVK*CRLQKATFEYYCGRHSYSVFLEAKLIPRSVPIQVDDCINAFRTSTL*IDNEVTISAEVXXXXXXXXXXXXXXEADGSCVGRTKTRVRDVVNSIVDVEDYSIELREYEGTFEVASGKMMTHPECNVKLGYCRTGAATLVYSTMKEFCELGYLKKTAFTKLNGTRFTSHKYQDGVWGEKKMQHINREDISEKSTPLVLVSKDPNDAIRLVRKGQKMKCSTTVYETNYKGIYLS 2556
            ++ AYDC N  LG  +SL+D  +C EAYP++  K  +  YH+YQE     +  K C + +     +CG HS+S  ++   +   + I   +C +AFR   + + +++ + A+ G  +   I K G I  DG+C G         +   + +E Y I +++ E  F+  + +MM+   C+ K  +C  G  +++Y   K+ C L +LK   F  + G  F ++ + D +    K  +   + I+   TP+VL++   +DAIRLVRK Q +KC  +VY TNY  I +S
Sbjct:  390 AIKAYDCDNAKLGTQFSLLDAEECPEAYPNQFEKRFNRIYHIYQERGLIYSAAKECTVTRRRSIRWCGHHSHSAIIKQPSMIEYLNIGHRNCEDAFRLKEIRLADKLILKAKPGILIQEDIIKVGSIAFDGTCEGGEYWYQGKKIKQALVIETYQITIKKSEVAFDPDTNEMMSRSYCSAKSNFCFDGKTSIIYDIRKQECNLVFLKTVNFDVIRGKIFDNNLFIDKLNSRPKKIYRTEKTINSHITPVVLIANKTSDAIRLVRKDQVVKCGQSVYLTNYDRIVVS 675          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A533UJT0 (RNA-directed DNA polymerase (Fragment) OS=Thaumarchaeota archaeon OX=2026795 GN=E6L00_07210 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 3.582e-86
Identity = 138/334 (41.32%), Postives = 217/334 (64.97%), Query Frame = 1
Query: 4804 VNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDA--HHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            + +L+ KY ++ A     LG+ N+++H+IN  + +PI  + ++  +  +  + +++  M K  II+ S+ P+SSP+V+V K+DGS R C DYRK+N  T++D HPLP +D + ++ + ++ F+ +D   G++QI+M+E     T F+     FE+ +M FGLK APPTF R MN +L D      +VYIDDI I+S+   +HLEH+E I K+L   NL +K SKCKW E+ + ++ HV+ +D +KPDP   +K++N P PT  K ++  LGL GYY +F+R FS IA PL  L KKG +F W   QQ+AF  LK+ L++ PIL +PD+ ++F++
Sbjct:   31 IRRLIEKYKEICAISSTKLGKTNVVKHKINTGDHEPIAQKQFRADKKRRTIIKEEVDKMLKDGIIKKSEGPWSSPVVIVTKKDGSARFCIDYRKINNITITDAHPLPRIDDVLEQFREAKWFSSIDLASGYWQIEMNEKDREKTAFTCHLGLFEFNVMPFGLKNAPPTFQRMMNEILKDWLDEFVVVYIDDIMIYSKTFEEHLEHIEKILKKLKEVNLMLKLSKCKWGERNIEFLGHVVGNDGLKPDPRKIDKIKNLPIPTTQKGVRSVLGLCGYYRKFVRGFSKIAKPLNELLKKGKQFEWTESQQKAFEELKEKLIQYPILSYPDYEKEFIL 364          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A4Y2WT15 (Retrovirus-related Pol polyprotein from transposon 297 (Fragment) OS=Araneus ventricosus OX=182803 GN=pol_3737 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 6.151e-82
Identity = 158/400 (39.50%), Postives = 241/400 (60.25%), Query Frame = 1
Query: 4615 NMDNKTLRLYPDTRVGKIVRLKDPQEKVAQVLSVH---EEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIML--MDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            N+++K L L      G I+    P  +V+ + SV+   + +    I++    N D   L++ +  KV  LL KYD VFA+   +LGQ  I++HEI+LT+  P + +PY++P  L+  + +QI  +    II+ SKS Y++P+++V K D S RL  D RKLN +T+ DN PLP L+ + D +  ++ FT MD   GF+Q+ +  NS  +TG +T+   FEY  + FGL+ A  +F R M+++L  +       YIDDI I S D ++HL  LE +++RLI ANLKVKPSKC + + E+ ++ H +    V PD  N + +++   P + K+++ FLGLTG+Y +FI N+S IA PLT L K  V F WG E+Q+AF  LK+ L+  P L  PDF+R F +
Sbjct:   21 NLEDKPLTL----NKGMIIVQALPIHEVSNIESVNTLSDSKISKKIDWDKTLNFD--HLSKEQKSKVINLLNKYDSVFAQDISELGQCGIVQHEIHLTDPVPTRQKPYRVPYQLKAEMKRQINTLLDAGIIQPSKSAYAAPVLLVKKSDDSYRLVADLRKLNSKTIPDNFPLPNLNEMIDMLTGAKYFTTMDLTSGFHQMLLHPNSTHLTGITTEFGLFEYKRLPFGLRNASSSFQRLMSLVLNGLSDLQIGCYIDDIIIGSNDFDQHLARLELVFQRLITANLKVKPSKCAFLQFEISFLGHTVKEGKVLPDSKNLKSIKDSLPPNSKKKVRSFLGLTGFYRKFIPNYSKIALPLTNLTKDKVPFVWGEEEQKAFELLKNYLITEPCLHLPDFSRPFSI 414          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A4Y2MR82 (Retrovirus-related Pol polyprotein from transposon 17.6 (Fragment) OS=Araneus ventricosus OX=182803 GN=pol_3071 PE=4 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 7.405e-82
Identity = 155/376 (41.22%), Postives = 235/376 (62.50%), Query Frame = 1
Query: 4678 KDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIML--MDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            +D + +   VL+ ++E+   DI + +  N D   L   E  K+  LL KY  VFA+   DLG  +I++HEINLT+  PI+ +PY++P +L++ + KQI  +    II+ S S YS+P+++V K DGS RL  D RKLNE+T+ DN PLP L  + D +  ++ F+ MD   GF+Q+KM  +S  +TG ST+   FEY  M FGL+ A  +F R M+I+L  +      VYIDD+ + S+ +++HLE LE +++RL  ANLK+KPSKC + ++++ Y+ H +    V PD  N + +R    P   KQ++ FLG+ G+Y +FI NFS IA PLT L K+ +KF W   +Q+AF  L+D L+K P L+ PD  ++F +
Sbjct:  252 EDSRPEYVNVLNSNDED---DINWGEKLNLD--HLGSEERAKLLSLLNKYKSVFAQSLKDLGSCDIVQHEINLTDNLPIRQKPYRVPYALKDEMRKQINTLLDAGIIQPSSSAYSAPVMLVKKADGSHRLVADLRKLNEKTIPDNFPLPNLTEMVDMLSGAKYFSSMDLTSGFHQLKMHPSSAHLTGISTEFGLFEYTRMPFGLRNASSSFQRLMSIVLAGLSELQVSVYIDDVIVASKSISEHLERLEIVFQRLTTANLKLKPSKCSFMQKQITYLGHTVKEGMVLPDSRNLDSIRKALPPKTRKQVRSFLGVAGFYRRFIPNFSKIALPLTNLTKEKIKFVWTEVEQQAFETLRDCLIKEPCLKLPDLTKEFSI 622          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A4Y2RJM3 (Retrovirus-related Pol polyprotein from transposon 297 OS=Araneus ventricosus OX=182803 GN=pol_4072 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 2.118e-81
Identity = 157/400 (39.25%), Postives = 241/400 (60.25%), Query Frame = 1
Query: 4615 NMDNKTLRLYPDTRVGKIVRLKDPQEKVAQVLSVH---EEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIML--MDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            N+++K L L      G I+    P  +V+ + SV+   + +    I++    N D   L++ +  KV  LL KY+ VFA+   +LGQ  I++HEI+LT+  P + +PY++P  L+  + +QI  +    II+ SKS Y++P+++V K D S RL  D RKLN +T+ DN PLP L+ + D +  ++ FT MD   GF+Q+ +  NS  +TG +T+   FEY  + FGL+ A  +F R M+++L  +       YIDDI I S D ++HL  LE +++RLI ANLKVKPSKC + + E+ ++ H +    V PD  N + +++   P + K+++ FLGLTG+Y +FI N+S IA PLT L K  V F WG E+Q+AF  LK+ L+  P L  PDF+R F +
Sbjct:    8 NLEDKPLTL----NKGMIIVQALPIHEVSNIESVNTLSDSKNSKKIDWDKTLNFD--HLSKEQKSKVINLLNKYNSVFAQDISELGQCGIVQHEIHLTDPVPTRQKPYRVPYQLKAEMKRQINTLLDAGIIQPSKSAYAAPVLLVKKSDDSYRLVADLRKLNSKTIPDNFPLPNLNEMIDMLTGAKYFTTMDLTSGFHQMLLHPNSTHLTGITTEFGLFEYKRLPFGLRNASSSFQRLMSLVLNGLSDLQIGCYIDDIIIASNDFDQHLARLELVFQRLITANLKVKPSKCAFLQFEISFLGHRVKEGKVLPDSKNLKSIKDSLPPNSKKKVRSFLGLTGFYRKFIPNYSKIALPLTNLTKDKVPFVWGEEEQKAFELLKNYLITEPCLHLPDFSRPFSI 401          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000044431.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000182.1:892613:897532:1 gene:ENSAMXG00000038169.1 transcript:ENSAMXT00000044431.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.774 bits (678), Expect = 1.123e-71
Identity = 127/346 (36.71%), Postives = 206/346 (59.54%), Query Frame = 1
Query: 4771 SKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHH-AMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGV--KFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
             +DLT R+  ++ +L+  Y +VF+      GQ ++++H+I       ++ RPY++PQ+ +E V  +++ M +  II  S SP+SSP+V+V K DGS R CND+R+LN+ +  D++P+P +D + D++  +R  +  D  KG++Q+ +S  + P T FST   H+ Y  + FGL GAP TF R M+++L      A  Y+DD+ + S    +HL HL  +   L+ A L   P+KC     E  Y+ + I    ++P    T  +++ P+PT   Q++ FLGL GYY +F+ NFS+IA PLT + KK    +  W  + ++AF  LK+AL   P+LR PDF++ F+V
Sbjct:  726 GQDLTPRQKQELRELVDHYTKVFSSLP---GQTHLVQHDIKTPPGFVVRQRPYRLPQARREAVETEVQKMLEMGIIEPSDSPWSSPIVLVPKPDGSWRFCNDFRRLNKVSAFDSYPIPRIDDLIDRLGTARFISTFDLTKGYWQVPLSPQAKPKTAFSTPSGHWHYRFLPFGLHGAPATFQRLMDVVLRPCRAFAAAYLDDVVVHSTSWAEHLVHLSKVLDALLEAGLTANPAKCHLGLSEAQYLGYSIGRGILRPQESKTAAIKDCPRPTTKTQVRAFLGLAGYYRRFVPNFSSIAVPLTDMTKKRQPEEVQWSTDAEKAFTQLKEALTSAPVLRNPDFSQPFIV 1068          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000030217.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:12351169:12363564:1 gene:ENSAMXG00000035335.1 transcript:ENSAMXT00000030217.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.848 bits (673), Expect = 8.043e-71
Identity = 147/384 (38.28%), Postives = 217/384 (56.51%), Query Frame = 1
Query: 4687 QEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDA--HHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVL--------EKKGVKFT---WGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            QE VA + S+  E + LD+     P      L+  +  +   LLR+Y +VF++ E D+G   +++HEI LT+  P++ R  ++P S  E V   I+ + +  ++R S SPYSSP+VVV K+DG++RLC DYR+LN +T  D +PLP ++   D +  ++LF+ +D   G+ Q+ M+E     T F T    FE+  M FGL  AP TF R M  +  D      ++Y+DDI IFS   + HLE L+ +  RL   NLK+K  KC + + EV Y+ HVIS   V  DP     V  + +PT VK+++ FLG   YY +F+  F+  A PL  L         K GVKF    W ++ +EAFN LKD LV  P+L + DF + F++
Sbjct:  264 QENVAVMRSLCAEGQPLDLSNLSWPT-----LSLAQEQEGKALLRQYSEVFSQGEGDIGCTTLIQHEIPLTDDAPVRQRYRRLPPSQYEQVKAHIQDLLQREVVRVSCSPYSSPIVVVQKKDGTLRLCVDYRQLNAKTRKDAYPLPRIEESLDALAGAKLFSTLDLTSGYNQVPMAEEDKQKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERVFGDERFQSLLLYLDDIVIFSSTFDSHLERLQMVLGRLQQHNLKLKLEKCNFFQNEVRYLGHVISASGVATDPDKITAVSEWKRPTTVKELRSFLGFASYYRRFVDKFAKYAAPLHQLVGALQKTKSKPGVKFLQGHWSDKCEEAFNLLKDKLVTAPVLAYADFAKPFLL 642          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000054230.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:19483082:19487098:1 gene:ENSAMXG00000038338.1 transcript:ENSAMXT00000054230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 258.455 bits (659), Expect = 3.238e-69
Identity = 140/367 (38.15%), Postives = 206/367 (56.13%), Query Frame = 1
Query: 4753 DAPN----CDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHHA--MVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVL--------EKKG----VKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
             APN     D   LT +E   V  LL+KY+ VF+ H+ DLG  N++EHEI L +  P++ R  +IP S  E V   I  + +  ++R S SPY+SP+V+V K+DGS+R+C DYR LN +T  D  PLP ++   D +  +R F+ +D   G+ Q+ ++E   P T F T    FE+  M FGL  AP TF R M  M  D  +   ++Y+DDI +FS  +++HL+ LE +  RL    LK K SKC + +QEV Y+ HVIS+  V  DP   E V  + +P  V +++ FLG   YY +F+  F+ +A PL  L         KKG    +   W  + +++F  LK  LV  P+L + DF+  F++
Sbjct:  243 SAPNGVEAVDLSALTDQEQGVVRSLLQKYNSVFSAHDGDLGCTNLIEHEIPLLDNIPVRQRHRRIPPSDYELVKAHIDQLLEAQVVRESSSPYASPIVLVKKKDGSLRMCVDYRLLNSKTRKDAFPLPRIEESLDALSGARWFSTLDLASGYNQVPVAEQDKPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGDQQYQSLLLYLDDIIVFSSSVSQHLQRLEVVLGRLQKEGLKAKLSKCVFFKQEVGYLGHVISNKGVSTDPAKIEAVAQWQRPRTVSELRSFLGFASYYRRFVEGFAQLAGPLHKLVAALVGSKTKKGSGQALGMAWTAQCEQSFEALKARLVSAPVLAYADFSLPFIL 609          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000041754.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001938.1:55959:59870:1 gene:ENSAMXG00000043385.1 transcript:ENSAMXT00000041754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.529 bits (654), Expect = 1.136e-68
Identity = 139/393 (35.37%), Postives = 222/393 (56.49%), Query Frame = 1
Query: 4669 VRLKDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYK-IPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHH--AMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVL-------EKKG------VKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            V ++   E    ++S  + +     EY  +   D + LT  +  +   L +KY  +FAK E DLG  +++ HEI L +  P++ +PY+ IP S    V   I+ +    +IR S SP+SSP+V+V K+DGS+RLC DYR+LN +T  D++PLP ++   D +  ++ F+ +D   G+ Q+ + E     T F T    FE+  M FGL  AP TF R M  +  D  +   ++Y+DD+ +FS+ + +HLE LE+++ RL   NLKVK SKC++ + +V Y+ HV+S + V  DP   E V+ +  P+++ +++ FLG   YY +F+  FS +A PL  L        +KG      +   W  E ++AF +LKD L   P+L + DFN+ F+V
Sbjct:  230 VSVESCWEDCVAIISTQDIQCTSPTEYVTS---DFEGLTDLQAQRARALFQKYSNIFAKSEGDLGCTSLISHEIPLLDEVPVR-QPYRRIPPSQYSTVKAHIQQLLDSRVIRESSSPFSSPIVLVTKKDGSLRLCVDYRQLNAKTRRDSYPLPRIEESLDALCGAKWFSTLDLASGYNQVPVEEKDKSKTAFCTPFGLFEFNRMPFGLCNAPGTFQRLMERIFGDCRYQSVLLYLDDVIVFSQTVEEHLERLEEVFSRLQKQNLKVKLSKCQFFQHQVSYLGHVVSAEGVTTDPAKIEVVKEWKSPSHLAELRSFLGFASYYRRFVEGFSKLAAPLHRLVGGLSGPRRKGKTPKTSLAAFWDAECEQAFQSLKDRLTSTPVLAYADFNKPFIV 618          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000045469.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000976.1:426503:430633:1 gene:ENSAMXG00000030479.1 transcript:ENSAMXT00000045469.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.144 bits (653), Expect = 1.969e-68
Identity = 151/423 (35.70%), Postives = 231/423 (54.61%), Query Frame = 1
Query: 4615 NMDNKTLRLYPDTRVGK--IVRL----------KDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDA--HHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPL--TVLEKKGVKFT------------WGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            N+ ++   L P T +G+  +V+L          +D Q  VA V SV + ERD  I++          L+ ++  +   LLR++  +F++H  DLG   +++H I L ++ P++ R  ++P S  + V   I+ + ++ ++R S SPY+SP+VVV K+DGSIRLC DYR+LN +T  D  PLP ++   D +  S+ F+ +D   G+ Q+ + E     T F T    FE+  M FGL  AP TF R M  +  D   H  ++Y+DDI IFS DL +HL+ L+ +  RL   NLK+K  KC + +  V Y+ HVIS   V+ DP     V ++ +PT VK+++ FLG   YY +F+  F+A+A PL   V   +G K              W    + +F  LKD LV+ P+L F DF R F+V
Sbjct:  250 NVGDQDRWLQPKTVLGELHVVQLMSTPKEVQVHRDDQGHVATVQSV-QAERDSSIDFL---QLSWPALSAQDQEQARALLRRHQNLFSEHAGDLGCTTLVQHSIPLLDSVPVRQRYRRLPPSQYDLVKAHIQELVEHQVVRPSSSPYASPIVVVQKKDGSIRLCVDYRQLNAKTRKDAFPLPRIEESLDALSGSKWFSTLDLASGYNQVPVLEKDKEKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDQSFHTLLLYLDDIVIFSSDLQQHLQRLDMVLSRLQQHNLKLKLEKCHFFQTRVSYLGHVISESGVETDPEKIRAVVDWKRPTTVKEVRSFLGFASYYRRFVEGFAALAAPLHKLVGALQGSKKQPRSKMHSIVIPHWDEVCETSFRALKDRLVRAPVLGFADFTRPFIV 668          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000034492.1 (pep primary_assembly:ASM223467v1:15:13490768:13497120:-1 gene:ENSORLG00000024904.1 transcript:ENSORLT00000034492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 272.322 bits (695), Expect = 2.587e-73
Identity = 130/343 (37.90%), Postives = 209/343 (60.93%), Query Frame = 1
Query: 4780 LTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHH-AMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVK--FTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            LTR +  +++Q+ ++   +F+ +    G+  + EH I L E KP++ +PY++PQ L   +++++  M    +I  S S + SP+V+V K+DGS+R+C D+RKLN  +  D +P+P +D + +K+ ++   T +D  KG++Q+ ++ +S P T F T    F++ +M FGL GAP TF R MN +L      +  Y+DD+ IFS    +HL+HL+ +  +L  + L +  SKC+WA+QE  Y+ + +    V+P     E VRN P+P   K+I+ FLGL G+Y +F+ +F+ IA PLT L  KG K    W  E + AFN LK  L   P+LR PDFN++F+V
Sbjct: 1002 LTREQITQLSQVFQEVSSLFSNNP---GRTTLAEHTIRLKEAKPVRQQPYRVPQQLIGKLHEEVDAMLSSGVIEPSNSEWCSPVVIVTKKDGSLRICIDFRKLNSVSEFDAYPMPRIDDLLEKIGSAAYITTLDMCKGYWQVPLAASSRPYTAFQTPSGLFQFTVMPFGLHGAPATFQRLMNKVLQGCEEFSAAYLDDVVIFSSTWEEHLQHLKRVLGKLKDSGLSLNISKCEWAKQETQYLGYQLGKGEVRPQLDKVEAVRNCPRPKTKKEIRSFLGLAGWYRRFVPDFATIAAPLTALTAKGQKNPLCWTEECERAFNALKACLCSTPVLRSPDFNKRFLV 1341          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000030651.1 (pep primary_assembly:ASM223467v1:5:21308959:21315033:-1 gene:ENSORLG00000024220.1 transcript:ENSORLT00000030651.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.381 bits (664), Expect = 1.687e-69
Identity = 133/378 (35.19%), Postives = 220/378 (58.20%), Query Frame = 1
Query: 4684 PQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTR---RENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHH-AMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVK--FTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            P EK   V +V  EE DLD +     +     L+     +  K+  L R+   +F+      G+  ++ H I L + +PI+ RPY++PQ L   +N +++ M +  +I  S S +SSP+V+V K+D S+R+C D+RKLN  +  D +P+P +D + +K+  +   T +D  KG++Q+ +S    P T F T    F++ +M FGL GAP TF R M+ +L   +H +  Y+DD+ I+S    +HL+HL  + ++L  A L +  SKC+WA +E  Y+ +++    V+P     E +RN P+P   K+++ FLGL G+Y +F+  F+ IA PLT L +K  K   TW +E ++AF  LK+ L   P+L+ P+F+++F+V
Sbjct: 1001 PTEKSLLVRAVKTEE-DLDSDLGALTHSTPPSLSHLPPEQTTKIMDLFRETPSLFSAQP---GRTTLISHSIRLKDGRPIRQRPYRVPQKLVGRLNDEVRKMLELGVIEPSNSEWSSPVVIVPKKDDSLRICIDFRKLNAVSEFDAYPMPRIDDLLEKIGAANFITTLDLCKGYWQVPLSNTCRPYTAFKTPAGLFQFTVMPFGLHGAPATFQRLMDRVLQGCNHCSAAYLDDVVIYSHTWEQHLDHLRLVLRKLQNAGLTLNVSKCEWARKETRYLGYLLGGGEVRPQVDKVEVIRNCPRPRTKKEVRSFLGLAGWYRRFVHQFATIAAPLTALTEKRQKNPVTWTDECEQAFQALKNKLCSCPVLKSPNFDQRFLV 1374          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000038047.1 (pep primary_assembly:ASM223467v1:5:20995901:21001966:-1 gene:ENSORLG00000030265.1 transcript:ENSORLT00000038047.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 259.61 bits (662), Expect = 2.714e-69
Identity = 133/378 (35.19%), Postives = 219/378 (57.94%), Query Frame = 1
Query: 4684 PQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTR---RENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHH-AMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVK--FTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            P EK   V +V  EE DLD +     +     L+     +  K+  L R+   +F+      G+  ++ H I L + +PI+ RPY++PQ L   +N ++  M +  +I  S S +SSP+V+V K+D S+R+C D+RKLN  +  D +P+P +D + +K+  +   T +D  KG++Q+ +S    P T F T    F++ +M FGL GAP TF R M+ +L   +H +  Y+DD+ I+S    +HL+HL  + ++L  A L +  SKC+WA +E  Y+ +++    V+P     E +RN P+P   K+++ FLGL G+Y +F+  F+ IA PLT L +K  K   TW +E ++AF  LK+ L   P+L+ P+F+++F+V
Sbjct: 1002 PTEKSLLVRAVKTEE-DLDSDLGALTHSTPPSLSHLPPEQTTKIMDLFRETPSLFSAQP---GRTTLISHSIRLKDGRPIRQRPYRVPQKLVGRLNDEVGRMLELGVIEPSNSEWSSPVVIVPKKDDSLRICIDFRKLNAVSEFDAYPMPRIDDLLEKIGAANFITTLDLCKGYWQVPLSNTCRPYTAFKTPAGLFQFTVMPFGLHGAPATFQRLMDRVLQGCNHCSAAYLDDVVIYSHTWEQHLDHLRLVLRKLQNAGLTLNVSKCEWARKETRYLGYLLGGGEVRPQVDKVEVIRNCPRPRTKKEVRSFLGLAGWYRRFVHQFATIAAPLTALTEKRQKNPVTWTDECEQAFQALKNKLCSCPVLKSPNFDQRFLV 1375          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000040552.1 (pep primary_assembly:ASM223467v1:6:4563337:4567860:1 gene:ENSORLG00000025739.1 transcript:ENSORLT00000040552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 259.225 bits (661), Expect = 3.603e-69
Identity = 132/378 (34.92%), Postives = 220/378 (58.20%), Query Frame = 1
Query: 4684 PQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTR---RENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHH-AMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVK--FTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            P EK   V +V  EE DLD +     +     L+     +  ++  L R+   +F+      G+  ++ H I L + +PI+ RPY++PQ L   +N +++ M +  +I  S S +SSP+V+V K+D S+R+C D+RKLN  +  D +P+P +D + +K+  +   T +D  KG++Q+ +S    P T F T    F++ +M FGL GAP TF R M+ +L   +H +  Y+DD+ I+S    +HL+HL  + ++L  A L +  SKC+WA +E  Y+ +++    V+P     E +RN P+P   K+++ FLGL G+Y +F+  F+ IA PLT L +K  K   TW +E ++AF  LK+ L   P+L+ P+F+++F+V
Sbjct: 1002 PTEKSLLVRAVKTEE-DLDSDLGALTHSTPPSLSHLPPEQTTQIMDLFRETPSLFSAQP---GRTTLISHSIRLKDGRPIRQRPYRVPQKLVGRLNDEVRKMLELGVIEPSNSEWSSPVVIVPKKDDSLRICIDFRKLNAVSEFDAYPMPRIDDLLEKIGAANFITTLDLCKGYWQVPLSNTCRPYTAFKTPAGLFQFTVMPFGLHGAPATFQRLMDRVLQGCNHCSAAYLDDVVIYSHTWEQHLDHLRLVLRKLQNAGLTLNVSKCEWARKETRYLGYLLGGGEVRPQVDKVEVIRNCPRPRTKKEVRSFLGLAGWYRRFVHQFATIAAPLTALTEKRQKNPVTWTDECEQAFQALKNKLCSCPVLKSPNFDQRFLV 1375          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000029819.1 (pep primary_assembly:ASM223467v1:24:6358775:6362914:-1 gene:ENSORLG00000022361.1 transcript:ENSORLT00000029819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 258.455 bits (659), Expect = 3.952e-69
Identity = 145/422 (34.36%), Postives = 221/422 (52.37%), Query Frame = 1
Query: 4615 NMDNKTLRLYPDTRVGKIVRLKDPQEKVAQVLSVHEEERDLDIEYYDAP-------------NCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMD--AHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVL------------EKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMV 5799
            N+ +  +RL+P T VG +          A V+S+ +E  ++  E                  + D   L+  E  KV  LL KY  VF+ HE DLG  +++ HEI L +  P++ R  +IP S      + I  + +  +IR S SP++SP+V++ K+DG +RLC DYR+LN +T  D  PLP ++   D +  +R F+ +D   G++Q+ ++E   P T F T    FE+  M FGL  AP TF R M  M  +      ++Y+DDI +FS  + +HLE LE + +RL +  LKVK +KC + + +V Y+ HVIS   V  DP   E V N+  PT V Q++ F+G   YY +F+  F+ +A PL  L              +G+   W  E Q +F  LK  L   P+L + DF+R F++
Sbjct:  244 NVGSTAVRLHPRTLVGTVA--------PAGVVSLPKEVTEVQSEAAVVAAHAASTLPLAQLESVDLSALSAGEQEKVRALLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGGLRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAKLAAPLHRLVAELEGNKVRKKSARGLTNHWTEECQRSFEALKAKLTTTPVLAYADFSRPFIL 657          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000058681.1 (SMESG000058681.1)

HSP 1 Score: 535.413 bits (1378), Expect = 1.670e-168
Identity = 294/426 (69.01%), Postives = 308/426 (72.30%), Query Frame = 1
Query: 1162 RQIDDDSENHPTFKSMMWRRLQQIMRLLKQNWQIPKDPGVNVKKLTVEIREAMRKIPEVMTRADILDMAERFIEEGLTRGKRIMILAMMFKDAFRVIQKDQSRINPELDRMAKVMSDNFEEWMAENLFWTIKGTVKSTFVLDENIS-NNENHGGNPQNMASFANXXXXXXXXXXXXRQVNSMTAYDCSNPSLGKIYSLVDTVDCREAYPDKVTKGEDVEYHVYQETDFYRTRVK*CRLQKATFEYYCGRHSYSVFLEAKLIPRSVPIQVDDCINAFRTSTL*IDNEVTISAEVXXXXXXXXXXXXXXEADGSCVGRTKTRVRDVVNSIVDVEDYSIELREYEGTFEVASGKMMTHPECNVKLGYCRTGAATLVYSTMKEFCELGYLKKTAFTKLNGTRFTSHKYQDGVWGEKKMQHINREDISEKS 2436
            +QIDDDSENHP FKSMMWRR QQIMRLLKQ+WQIPKDPGVNVKKLTVEIREAMR        ADILDMAERFIE+GLTR K IMILAMMFKD FRVIQKDQSRINPELDRMAKV SDNFE+WM EN FW IKGTVK TFVL+ENIS N  N G NPQNM SF NM+                                             +  GEDVEYHVYQETDFYRTRVK CRLQKATF+                                   TL IDNEVTISAEVGKK GI IT+GG IEADGSCVGRTKTR RDV+NSIVDVEDY IELREYEGTFEVASGKMMTHPECNVKLGYC+TGAATLVYSTM+EFCE GYLKKTAFTKLNG+RFTSHKYQD VWGEKKMQ I REDISEK+
Sbjct:  463 KQIDDDSENHPAFKSMMWRRFQQIMRLLKQDWQIPKDPGVNVKKLTVEIREAMRG-------ADILDMAERFIEKGLTRDKIIMILAMMFKDVFRVIQKDQSRINPELDRMAKVTSDNFEKWMTENRFWAIKGTVKPTFVLNENISTNGGNQGPNPQNMGSFTNMM---------------------------------------------MMMGEDVEYHVYQETDFYRTRVKDCRLQKATFD-----------------------------------TLKIDNEVTISAEVGKKFGITITRGGPIEADGSCVGRTKTRGRDVINSIVDVEDYLIELREYEGTFEVASGKMMTHPECNVKLGYCKTGAATLVYSTMREFCERGYLKKTAFTKLNGSRFTSHKYQDEVWGEKKMQQIKREDISEKA 801          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000029093.1 (SMESG000029093.1)

HSP 1 Score: 401.749 bits (1031), Expect = 2.916e-120
Identity = 240/354 (67.80%), Postives = 258/354 (72.88%), Query Frame = 1
Query: 1219 RLQQIMRLLKQNWQIPKDPGVNVKKLTVEIREAMRKIPEVMTRADILDMAERFIEEGLTRGKRIMILAMMFKDAFRVIQKDQSRINPELDRMAKVMSDNFEEWMAENLFWTIKGTVKSTFVLDENISNN-ENHGGNPQNMASFANXXXXXXXXXXXXRQVNSMTAYDCSNPSLGKIYSLVDTVDCREAYPDKVTKGEDVEYHVYQETDFYRTRVK*CRLQKATFEYYCGRHSYSVFLEAKLIPRSVPIQVDDCINAFRTSTL*IDNEVTISAEVXXXXXXXXXXXXXXEADGSCVGRTKTRVRDVVNSIVDVEDYSIELREYEGTFEVASGKMMTHPECNVKLGYCRTGAATLV 2277
            RLQQI+ LLKQ+WQIPK P VNVKKLTVEIREAMRKIPE M  ADILD AE FIEEGLTRGK IMILAM+FKDAFRVIQKDQSR+N ELD++ KV SDNFE  MAEN FW IK TVK TFVL EN S+N  N   NPQNM SFANM+MMM VMMGILRQVNSMTAYDCSNPSLGKIY LVDTVD REAYPDKVTKGEDV                                  ++ ++ ++I +                TL  DNEVTISAEVGKKLG+ IT+ G IEADGSCVGRTKTR RD +NSIVDVEDY IELREYEGTFEVASGKMMTH ECNVK GYC   AAT V
Sbjct:  229 RLQQILNLLKQDWQIPKYPLVNVKKLTVEIREAMRKIPEAMREADILDTAESFIEEGLTRGKMIMILAMIFKDAFRVIQKDQSRLNLELDKIVKVTSDNFEVCMAENRFWAIKETVKPTFVLYENFSDNGGNKAANPQNMGSFANMMMMMFVMMGILRQVNSMTAYDCSNPSLGKIYLLVDTVDFREAYPDKVTKGEDVN---------------------------------TMSIKKQIISKQ--------------DTLKKDNEVTISAEVGKKLGLTITRRGPIEADGSCVGRTKTRGRDAINSIVDVEDYFIELREYEGTFEVASGKMMTHSECNVKFGYCEIEAATFV 535          

HSP 2 Score: 300.827 bits (769), Expect = 9.001e-86
Identity = 146/163 (89.57%), Postives = 153/163 (93.87%), Query Frame = 3
Query: 3837 TDLEKTPFSPWPKRERQYDTMPTVGMKTMEKVPVYPFSTLEKLKQSYDEQSQPEAERTELEAKRFRENVLGISSICMVATGNLANKPTIKIKVNRHTVHALIDSGSDLTMIEANLLNET*LQAIAPTLTTATGANGQAINVIGILDCELRLCDQKFRHDIKVT 4325
            TDLEKTPFSPWPKRE QYDTMPT+G+KT  KVPVY FSTLEKLK +YD+QSQPEAER ELEAKRFRENVLGISS  MVATGNLANKPTIK+KVNRHTVHALIDSGSDLTMIEANLL+ET +QAI PTLTTATGANGQAINVIGILDCELRLCDQKFRHDIKVT
Sbjct:  536 TDLEKTPFSPWPKRESQYDTMPTLGIKTTAKVPVYSFSTLEKLKPNYDKQSQPEAERIELEAKRFRENVLGISSTFMVATGNLANKPTIKVKVNRHTVHALIDSGSDLTMIEANLLSETEVQAIVPTLTTATGANGQAINVIGILDCELRLCDQKFRHDIKVT 698          

HSP 3 Score: 186.422 bits (472), Expect = 6.698e-48
Identity = 90/103 (87.38%), Postives = 95/103 (92.23%), Query Frame = 1
Query: 4612 TNMDNKTLRLYPDTRVGKIVRLKDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKI 4920
            T MDNKTLR YPD RVGKIV+LKD QE+V QV+SVHEEERD DIEYYDAP+CDSK LTRRENIKVNQLLRKYDQVFAK+EYDLGQVNILEHEINL ETKPIKI
Sbjct:  720 TKMDNKTLRFYPDKRVGKIVKLKDHQEEVVQVMSVHEEERDPDIEYYDAPSCDSKALTRRENIKVNQLLRKYDQVFAKYEYDLGQVNILEHEINLNETKPIKI 822          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 366.311 bits (939), Expect = 8.326e-119
Identity = 195/458 (42.58%), Postives = 294/458 (64.19%), Query Frame = 1
Query: 4429 VFLDRVVTIPPRTETVCFVATHQEMEGDVIFEPKVEFASKYNTPITQNLATXXXXXXXXXXTNMDNKTLRLYPDTRVGKIVRLKDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMVM 5802
            VFL++ + +P R+E + +       + + IFEP  +   KY  P+   +  ++++ +P+RI N + K +++ P T++GK+ + +   EK  ++          +I+ Y  P   S DLT  +  +  +LL+KY  VFAKHEYDLG   ++EHEI L +  PIK++PY+IP   QE  ++QIK M+++ IIR S SP+SS + VV K+DG +R C DYRKLN+ T  D +P+P+   ++D+M   + FTV+D  KG+ Q K+ E     T FS     +E+ ++ FGL GAP TF R MN +L D  HA+VYIDDI IFS    +HL+ +E +++RL+ ANLK+KPSKC+W + EV+YV H+IS + ++P+P N +K++ +P P NV Q++ FLGL  YY +FI++FS +A PL VL KK  +F WG  QQEAF  LK +L+K PILR P+F   F++M
Sbjct: 3233 VFLNQTLELPARSEVIYYADVLDVSDDECIFEPNEKLIEKYEIPMCDEVVKVKDQTVPVRIVNQNTKPIQMKPKTKLGKLTKFE--IEKTPKL--------PRNIKIYKQPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEESDRQIKAMKEFKIIRDSSSPFSSSIAVVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSNTFKEHLKDVETVFRRLLKANLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVKKIKEYPIPENVDQVRQFLGLASYYRKFIKSFSHVAQPLNVLLKKQTQFKWGKSQQEAFKLLKKSLIKKPILRCPNFRIPFILM 3680          

HSP 2 Score: 83.1889 bits (204), Expect = 8.326e-119
Identity = 58/191 (30.37%), Postives = 95/191 (49.74%), Query Frame = 3
Query: 3870 PKRERQYDTMPTV-GMKTMEK---------VPVYPFSTLEKLKQSYDEQSQPEAERTE-LEAKRFRENVLGI-SSICMVATGNLANKPTIKIKVNRHTVHALIDSGSDLTMIEANLLNET*LQAIAPTLTTATGANGQAINVIGILDCELRLCDQKFRHDIKVTRECMAECIVGMDILKKLKDIVFDCATG 4406
            P+ +   + MP + G++T+ K          P YP   L+++K    E  Q E +  E   A+  R+N+LG+  S  M+  GN   +P I I  NR  V +L+DSGS  T++  +LL       + PT       +   +++IG L  EL + D +  H + V R     C++GMD++++L+ I  D  TG
Sbjct: 3028 PELQFLLEPMPKLSGIETLSKWYTPTFLPTAPKYPTEKLKEMKPV--EHIQFELDNIEPTSAEIERKNMLGLPCSYAMMTLGNKGKQPRINILFNRRKVESLLDSGSSNTIVSDDLLTMEEKSKMKPTSKVIRSMSHNVLSIIGKLKAELIIGDHELVHHVSVMRNSPVGCLIGMDVMEQLQGISLDLKTG 3216          

HSP 3 Score: 217.624 bits (553), Expect = 2.763e-110
Identity = 112/307 (36.48%), Postives = 179/307 (58.31%), Query Frame = 1
Query: 1690 QVNSMTAYDCSNPSLGKIYSLVDTVDCREAYPDKVTKGEDVEYHVYQETDFYRTRVK*CRLQKATFEYYCGRHSYSVFLEAKLIPRSVPIQVDDCINAFRTSTL*IDNEVTISAEVXXXXXXXXXXXXXXEADGSCVGRTKTRVRDVVNSIVDVEDYSIELREYEGTFEVASGKMMTHPECNVKLGYCRTGAATLVYSTMKEFCELGYLKKTAFTKLNGTRFTSHKYQDGVWGEKKMQHINREDISEKSTPLVLVSKDPNDAIRLVRKGQKMKCSTTVYETNYKGIYLSHKYIPAAE-KIHTSDVKI 2607
            Q   MTAYDCS   +GKIYS+VD  +C E YP K+    DV+Y+VYQE+D  R +V+ C  ++ TF ++CG+ S++  ++   IPR V +  ++C+ AF+T  L I+ E+ + A+V +++   +   G+I+ DG+C G        ++   V +E+Y  +LRE+EG F+  +GK+ THP CN++   C+TG + LV+    + C L +LK   F +L+G +F        +   K    I    +  + T  VL+S  P D +R ++K    KC   VY TNYKG+Y+S   +  A+ KIHT+D+K+
Sbjct: 2448 QATGMTAYDCSQTEMGKIYSVVDMAECPEVYPKKLKVENDVKYYVYQESDLRRAKVRECIAKRTTFVFFCGKWSHTSLIKMHAIPRPVEVMPENCLAAFQTEELKINPEIKLKAKVNQRIRETVVVKGVIQQDGTCEGEPYKVNGKIIKQSVVIEEYLTKLREFEGVFDDKTGKLQTHPFCNMRQSNCQTGESILVFDVKTDICNLAHLKTMTFKELSGEQFRESLDNFNI-NYKSNGTIRSTPVWTRKTTPVLMSTLPTDGMRFIKKEATNKCGQMVYATNYKGVYVSKMMVQEAKTKIHTNDIKL 2753          

HSP 4 Score: 203.756 bits (517), Expect = 2.763e-110
Identity = 103/229 (44.98%), Postives = 152/229 (66.38%), Query Frame = 3
Query: 2613 YVNNKIDFLYHDLQRQMQEMYQEVVLNDCRLNREIIRNRLAISVANPDLIMPMLM-EHGTFGRIMGEAIYSYQCKIVEVEIAKYDKCTLELPVLYEGKLRFVAPVTHRILKEGEEPQKSTCNPAMSPLYKI-NNHWITLPDRKPPSKPVEILQAIKLTSKVEFRPLNELSKGGVYTPEDIEEARRAIGFPQVRDRGVTEIITRIYKHYDGKLDYNLLFGPDH-YRQAAS 3290
            Y NNKID+LYH  Q  M+ +Y+E++LNDC+LN+EI+RNR+A+++ NP+L+ PML+ E+G F RI GEA+YSY+CK V V+I KY+KCT ELPV   GK+RF+ P+T  +L E  +P+   CN  ++PLY++  + WI LPD +    P + L+   L   V F  LN +++ G Y  EDIEEA+R + FP  ++R ++E+I  I  + + +      F   H YR+ AS
Sbjct: 2756 YFNNKIDYLYHFSQNIMENIYREMILNDCKLNKEILRNRMAMAITNPNLVAPMLISENGVFARIFGEALYSYKCKAVTVKIMKYEKCTNELPVSINGKMRFMEPITRILLDEHTKPKFLQCNRLLAPLYRLAQDSWIALPDYRGVRTP-DKLELTNLEYLVNFTSLNRMAQMGFYASEDIEEAQRNLLFPSKKERVISEMIDTILPNGEAR-----FFITHHQYREMAS 2978          

HSP 5 Score: 122.865 bits (307), Expect = 2.166e-27
Identity = 80/263 (30.42%), Postives = 127/263 (48.29%), Query Frame = 1
Query:  223 DFMRYPTIPVKPYNGNPGEFPEFMPEYFQMARALGLPEPVMILRLPLYLKGMANEKYNDV---ILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGQHVGEFAYQIMMLAERVF---GDRARWNEATLALVKDQFWAGLSSAMRNALSLHIRDNFEELTRKAVLIESSIE-----------------------KVNNFAISTNKSD-----------------------IECFNCHKRGHLSKDC--NSKRSNSP 849
            D+     +PV+ Y G+P EF +F  +Y+  A A G  + +M+ RLPLYLKG A E +  +   ++AN    W +L+ AL  +++ GD  RI+RQ+FYNR Q   + V EFAY +  LAE+ F    ++    +    L++DQF  G+   ++ AL     +NF+EL +KA+ IE +++                       K N F  ST+ S                        I+C +C   GH+++ C  N++R   P
Sbjct: 1565 DYASCQKLPVQQYGGDPVEFVDFKADYYMYATAYGWSQSIMVQRLPLYLKGAAREAWQQIDKRLIAND---WTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAEKAFEIKPEQVDVVKQVKELLQDQFLTGVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIDESRDRSVSRIKNNLFQKSTSPSPKFRVKSPSTSPSPQRDRVNLQGRIQCHSCRGYGHMARSCPRNNERFQKP 1824          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 202.601 bits (514), Expect = 3.888e-104
Identity = 107/304 (35.20%), Postives = 174/304 (57.24%), Query Frame = 1
Query: 1699 SMTAYDCSNPSLGKIYSLVDTVDCREAYPDKVTKGEDVEYHVYQETDFYRTRVK*CRLQKATFEYYCGRHSYSVFLEAKLIPRSVPIQVDDCINAFRTSTL*IDNEVTISAEVXXXXXXXXXXXXXXEADGSCVGRTKTRVRDVVNSIVDVEDYSIELREYEGTFEVASGKMMTHPECNVKLGYCRTGAATLVYSTMKEFCELGYLKKTAFTKLNGTRFTSHKYQDGVWGEKKMQHINREDISEKSTPLVLVSKDPNDAIRLVRKGQKMKCSTTVYETNYKGIYLSHKYIPAAE-KIHTSDVKI 2607
             MTAYDCS   +GKIYS+VD  +C +AYP K+    DV+Y+VYQE+D  R +V+ C +++ TF ++CG+ S++  ++   I R + +  ++C+ AF+T  L I+ E+ + A++  ++   +   G+I  DG+C G             + +E+Y  ELRE+EG F+  +GK+ THP CN++   C+TG + LV+      C L +LK   F +L+G +F        +   K    I    +  + T  VL+S  P D++R ++K    KC   VY TNY+G+Y+S      A+ KIHT+D+K+
Sbjct:  998 GMTAYDCSQTEMGKIYSVVDMAECPDAYPKKLKVENDVKYYVYQESDLRRAKVRECIVKRTTFVFFCGKWSHTSLIKMHAISRQLEVMPENCLAAFQTEELKINPEIKLKAKINHRIRETVVVKGVITQDGTCEGE----------PYMVIEEYLTELREFEGVFDDETGKLQTHPFCNMRQSNCQTGESILVFDVKTNVCNLAHLKTMTFKELSGEQFRESPDNFNI-NYKSNGTIRSTPVWTRKTTPVLMSTLPTDSMRFIKKEATNKCGQMVYATNYRGVYVSKMMGHEAKTKIHTNDIKL 1290          

HSP 2 Score: 197.978 bits (502), Expect = 3.888e-104
Identity = 99/228 (43.42%), Postives = 149/228 (65.35%), Query Frame = 3
Query: 2613 YVNNKIDFLYHDLQRQMQEMYQEVVLNDCRLNREIIRNRLAISVANPDLIMPMLM-EHGTFGRIMGEAIYSYQCKIVEVEIAKYDKCTLELPVLYEGKLRFVAPVTHRILKEGEEPQKSTCNPAMSPLYKI-NNHWITLPDRKPPSKPVEILQAIKLTSKVEFRPLNELSKGGVYTPEDIEEARRAIGFPQVRDRGVTEIITRIYKHYDGKLDYNLLFGPDHYRQAAS 3290
            Y NNKID+LYH  Q  M+ +Y+E++LNDC+LN+EI+R+R+A+++ NP+L+ PML+ E+G F RI GEA YSY+CK V V+I KY+KCT ELPV   GK+RF+ P+T  +L E  + +   CN  ++PLY++  + WI LPD +    P + L+   L   V F  LN++++ G Y  EDIEEA+R + FP  ++R ++E+I  I  + + +           YR+ AS
Sbjct: 1293 YFNNKIDYLYHFSQNIMENIYREMILNDCKLNKEILRSRMAMAITNPNLVAPMLISENGVFARIFGEAFYSYKCKAVTVKIMKYEKCTNELPVSINGKMRFMEPITRILLDEHTKQKILQCNRLLAPLYRLAQDSWIALPDYRGVRTP-DKLELTNLEYLVNFTSLNKMAQMGFYASEDIEEAQRNLLFPSKKERVISEMIDTILPNGEAR----FFITHHQYRETAS 1515          

HSP 3 Score: 310.457 bits (794), Expect = 1.898e-100
Identity = 166/458 (36.24%), Postives = 261/458 (56.99%), Query Frame = 1
Query: 4429 VFLDRVVTIPPRTETVCFVATHQEMEGDVIFEPKVEFASKYNTPITQNLATXXXXXXXXXXTNMDNKTLRLYPDTRVGKIVRLKDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMVM 5802
            VFL++ + +P R+E + +       + + IFEP  +   KY  P+   +  ++++ +P+RI N + K +++ P TR+GK+ + +   EK+ ++          +I+ Y  P   S DLT  +  +  +LL+KY  VFAKHEYDLG   ++EHEI L +  PIK++PY+IP   QE + ++                                              D +P+P+   ++D+M   + FTV+D  KG+ Q K+ E     T FS     +E+ ++ FGL GAP TF R+MN +L D  HA+VYIDD+ IFS    +HL+ +E +++RL+ A LK+KPSKC+W + EV+YV H+IS + ++P+P N  K++ +P P NV Q++ FLGL  YY +FI++FS +A  L VL KK ++  WG  QQEAF  LK++L+K PILR P+F   F++M
Sbjct: 1770 VFLNQTLELPARSEVIYYADVLDVSDDECIFEPNEKLIEKYEIPMCDEVVKVKDQTVPVRIVNQNTKPIQMKPKTRLGKLTKFE--IEKIPKLPR--------NIKIYKEPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEEITRK----------------------------------------------DTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRSMNFVLRDIPHALVYIDDVIIFSNTFKEHLKDVETVFRRLLKAKLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVRKIKEYPIPENVDQVRQFLGLASYYRKFIKSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILM 2171          

HSP 4 Score: 78.1814 bits (191), Expect = 1.898e-100
Identity = 60/204 (29.41%), Postives = 99/204 (48.53%), Query Frame = 3
Query: 3870 PKRERQYDTMPTV-GMKTMEK------VPVYPFSTLEKLKQSYD-EQSQPEAERTE-LEAKRFRENVLGI-SSICMVATGNLANKPTIKIKVNRHTVHALIDSGSDLTMIEANLLNET*LQAIAPTLTTATGANGQAINVIGILDCELRLCDQKFRHDIKVTRECMAECIVGMDILKKLKDIVFDCATGEYI*YRRGFPRPSGH 4451
            P+ +   + MP + G++T+ K      +P  P  + EKLK+    E  Q E +  E   A+  R+N+LG+  S  M+  GN   +P I I  N   V AL+DSGS  T++  +LL       + PT       +   +++I  L  EL + D +  H + V R     C++GMD++++L++I     TG  +   +G     GH
Sbjct: 1565 PELQFLLEPMPKLSGIETLSKWYTPTFLPTAPTYSTEKLKEMKPVEHIQFELDNIEPTSAEIERKNMLGLPCSYAMMTLGNKGKQPRINILFNGRKVEALLDSGSSNTIVSDDLLTIEEKSKMKPTSKVIRSMSHNVLSIIEKLKAELIIGDHELEHYVSVMRNSPVGCLIGMDVMEQLQEISLHLKTGRLM---KGQTDEKGH 1765          

HSP 5 Score: 114.39 bits (285), Expect = 7.318e-25
Identity = 81/274 (29.56%), Postives = 126/274 (45.99%), Query Frame = 1
Query:  217 AADFMRYPTIPVKPYNGNPGEFPEFMPEYFQMARALGLPEPVMILRLPLYLKGMANEKYNDV---ILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGQHVGEFAYQIMMLAERVF---GDRARWNEATLALVKDQFWAGLSSAMRNALSLHIRDNFEELTRKAVLIESSIE-----------------------KVNNFAISTNKS----------------------DIECFNCHKRGHLSKDC----NSKRSNSPGDKLCTRC 873
            + D+     +PV+ Y G+P +F +FM +Y+  A A G  + +M+ RL L LKG A E +  +    +AN    W +L+ AL  +++ GD  RI+RQ+FYNR Q   + V EFAY +  LA++ F    ++    +    L++DQF  G+   ++ AL     +NF+EL +K + IE +++                       K N F  ST+ S                       ++C +C K GH    C    NS RS SP    C  C
Sbjct:   32 SNDYASCQKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIAND---WTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKEIKKALCYVDFNNFDELIKKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKSTSPSPKFRVKFEPRKSTCSPNEERERPVQCSHCQKLGHNINQCWFKNNSGRSPSPVQ--CDHC 300          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 202.601 bits (514), Expect = 4.331e-104
Identity = 108/307 (35.18%), Postives = 175/307 (57.00%), Query Frame = 1
Query: 1699 SMTAYDCSNPSLGKIYSLVDTVDCREAYPDKVTKGEDVEYHVYQETDFYRTRVK*CRLQKATFEYYCGRHSYSVFLEAKLIPRSVPIQVDDCINAFRTSTL*IDNEVTISAEVXXXXXXXXXXXXXXEADGSCVGRTKTRVRDVVNSIVDVEDYSIELREYEGTFEVASGKMMTHPECNVKLGYCRTGAATLVYSTMKEFCELGYLKKTAFTKLNGTRFTSHKYQDGVWGEKKMQHINREDISEKSTPLVLVSKDPNDAIRLVRKGQKMKCSTTVYETNYKGIYLS----HKYIPAAEKIHTSDVKI 2607
             MTAYDCS   +GKIYS+VD  +C +AYP K+    DV+Y+VYQE+D  R +V+ C +++ TF ++CG+ S++  ++   I R + +  ++C+ AF+T  L I+ E+ + A++  ++   +   G+I  DG+C G             + +E+Y  ELRE+EG F+  +GK+ THP CN++   C+TG + LV+      C L +LK   F +L+G +F        +   K    I    +  + T  VL+S  P D++R ++K    KC   VY TNY+G+Y+S    H+   A  KIHT+D+K+
Sbjct:  998 GMTAYDCSQTEMGKIYSVVDMAECPDAYPKKLKVENDVKYYVYQESDLRRAKVRECIVKRTTFVFFCGKWSHTSLIKMHAISRQLEVMPENCLAAFQTEELKINPEIKLKAKINHRIRETVVVKGVITQDGTCEGE----------PYMVIEEYLTELREFEGVFDDETGKLQTHPFCNMRQSNCQTGESILVFDVKTNVCNLAHLKTMTFKELSGEQFRESPDNFNI-NYKSNGTIRSTPVWTRKTTPVLMSTLPTDSMRFIKKEATNKCGQMVYATNYRGVYVSKMMGHE---AKTKIHTNDIKL 1290          

HSP 2 Score: 197.978 bits (502), Expect = 4.331e-104
Identity = 99/228 (43.42%), Postives = 149/228 (65.35%), Query Frame = 3
Query: 2613 YVNNKIDFLYHDLQRQMQEMYQEVVLNDCRLNREIIRNRLAISVANPDLIMPMLM-EHGTFGRIMGEAIYSYQCKIVEVEIAKYDKCTLELPVLYEGKLRFVAPVTHRILKEGEEPQKSTCNPAMSPLYKI-NNHWITLPDRKPPSKPVEILQAIKLTSKVEFRPLNELSKGGVYTPEDIEEARRAIGFPQVRDRGVTEIITRIYKHYDGKLDYNLLFGPDHYRQAAS 3290
            Y NNKID+LYH  Q  M+ +Y+E++LNDC+LN+EI+R+R+A+++ NP+L+ PML+ E+G F RI GEA YSY+CK V V+I KY+KCT ELPV   GK+RF+ P+T  +L E  + +   CN  ++PLY++  + WI LPD +    P + L+   L   V F  LN++++ G Y  EDIEEA+R + FP  ++R ++E+I  I  + + +           YR+ AS
Sbjct: 1293 YFNNKIDYLYHFSQNIMENIYREMILNDCKLNKEILRSRMAMAITNPNLVAPMLISENGVFARIFGEAFYSYKCKAVTVKIMKYEKCTNELPVSINGKMRFMEPITRILLDEHTKQKILQCNRLLAPLYRLAQDSWIALPDYRGVRTP-DKLELTNLEYLVNFTSLNKMAQMGFYASEDIEEAQRNLLFPSKKERVISEMIDTILPNGEAR----FFITHHQYRETAS 1515          

HSP 3 Score: 310.071 bits (793), Expect = 2.278e-100
Identity = 166/458 (36.24%), Postives = 261/458 (56.99%), Query Frame = 1
Query: 4429 VFLDRVVTIPPRTETVCFVATHQEMEGDVIFEPKVEFASKYNTPITQNLATXXXXXXXXXXTNMDNKTLRLYPDTRVGKIVRLKDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENIKVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQEPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQTVSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTDDDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHHAMVYIDDIFIFSEDLNKHLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNTEKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFTWGNEQQEAFNNLKDALVKPPILRFPDFNRQFMVM 5802
            VFL++ + +P R+E + +       + + IFEP  +   KY  P+   +  ++++ +P+RI N + K +++ P TR+GK+ + +   EK+ ++          +I+ Y  P   S DLT  +  +  +LL+KY  VFAKHEYDLG   ++EHEI L +  PIK++PY+IP   QE + ++                                              D +P+P+   ++D+M   + FTV+D  KG+ Q K+ E     T FS     +E+ ++ FGL GAP TF R+MN +L D  HA+VYIDD+ IFS    +HL+ +E +++RL+ A LK+KPSKC+W + EV+YV H+IS + ++P+P N  K++ +P P NV Q++ FLGL  YY +FI++FS +A  L VL KK ++  WG  QQEAF  LK++L+K PILR P+F   F++M
Sbjct: 1770 VFLNQTLELPARSEVIYYADVLDVSDDECIFEPNEKLIEKYEIPMCDEVVKVKDQTVPVRIVNQNTKPIQMKPKTRLGKLTKFE--IEKIPKLPR--------NIKIYKEPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEEITRK----------------------------------------------DTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRSMNFVLRDIPHALVYIDDVIIFSNTFKEHLKDVETVFRRLLKAKLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVRKIKEYPIPENVDQVRQFLGLASYYRKFIKSFSHVAQLLNVLLKKQIQSKWGKAQQEAFELLKESLIKKPILRCPNFRIPFILM 2171          

HSP 4 Score: 78.1814 bits (191), Expect = 2.278e-100
Identity = 60/204 (29.41%), Postives = 99/204 (48.53%), Query Frame = 3
Query: 3870 PKRERQYDTMPTV-GMKTMEK------VPVYPFSTLEKLKQSYD-EQSQPEAERTE-LEAKRFRENVLGI-SSICMVATGNLANKPTIKIKVNRHTVHALIDSGSDLTMIEANLLNET*LQAIAPTLTTATGANGQAINVIGILDCELRLCDQKFRHDIKVTRECMAECIVGMDILKKLKDIVFDCATGEYI*YRRGFPRPSGH 4451
            P+ +   + MP + G++T+ K      +P  P  + EKLK+    E  Q E +  E   A+  R+N+LG+  S  M+  GN   +P I I  N   V AL+DSGS  T++  +LL       + PT       +   +++I  L  EL + D +  H + V R     C++GMD++++L++I     TG  +   +G     GH
Sbjct: 1565 PELQFLLEPMPKLSGIETLSKWYTPTFLPTAPTYSTEKLKEMKPVEHIQFELDNIEPTSAEIERKNMLGLPCSYAMMTLGNKGKQPRINILFNGRKVEALLDSGSSNTIVSDDLLTIEEKSKMKPTSKVIRSMSHNVLSIIEKLKAELIIGDHELEHYVSVMRNSPVGCLIGMDVMEQLQEISLHLKTGRLM---KGQTDEKGH 1765          

HSP 5 Score: 114.39 bits (285), Expect = 8.458e-25
Identity = 81/274 (29.56%), Postives = 126/274 (45.99%), Query Frame = 1
Query:  217 AADFMRYPTIPVKPYNGNPGEFPEFMPEYFQMARALGLPEPVMILRLPLYLKGMANEKYNDV---ILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGQHVGEFAYQIMMLAERVF---GDRARWNEATLALVKDQFWAGLSSAMRNALSLHIRDNFEELTRKAVLIESSIE-----------------------KVNNFAISTNKS----------------------DIECFNCHKRGHLSKDC----NSKRSNSPGDKLCTRC 873
            + D+     +PV+ Y G+P +F +FM +Y+  A A G  + +M+ RL L LKG A E +  +    +AN    W +L+ AL  +++ GD  RI+RQ+FYNR Q   + V EFAY +  LA++ F    ++    +    L++DQF  G+   ++ AL     +NF+EL +K + IE +++                       K N F  ST+ S                       ++C +C K GH    C    NS RS SP    C  C
Sbjct:   32 SNDYASCQKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIAND---WTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKEIKKALCYVDFNNFDELIKKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKSTSPSPKFRVKFEPRKSTCSPNEERERPVQCSHCQKLGHNINQCWFKNNSGRSPSPVQ--CDHC 300          
The following BLAST results are available for this feature:
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RTL19.152e-1123.53retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
RTL19.152e-1123.53retrotransposon Gag like 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
K02E2.61.285e-730.69pep chromosome:WBcel235:V:20380580:20381966:1 gene... [more]
K02E2.61.285e-730.69pep chromosome:WBcel235:V:20380561:20382036:1 gene... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX511082.14.889e-5637.17pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
CR855320.15.680e-5536.18pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
BX546500.12.247e-5436.18pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
CR925755.22.337e-5436.51pep chromosome:GRCz11:17:42486740:42492668:-1 gene... [more]
BX511224.18.828e-5436.18pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa68.773e-6734.52annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
alkbh51.081e-6135.41alkB homolog 5, RNA demethylase [Source:Xenbase;Ac... [more]
ENSXETT00000006041.15.628e-5732.31pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000035398.14.357e-4733.33pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
denr5.094e-4633.33density-regulated protein [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rtl11.327e-625.35retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
Rtl11.327e-625.35retrotransposon Gaglike 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04323|POL3_DROME1.585e-7042.98Retrovirus-related Pol polyprotein from transposon... [more]
sp|P20825|POL2_DROME1.690e-6840.52Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q99315|YG31B_YEAST5.086e-5339.08Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q7LHG5|YI31B_YEAST5.303e-5238.73Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q8I7P9|POL5_DROME1.557e-5132.76Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A355ABF22.192e-10740.17Uncharacterized protein OS=Flavobacteriaceae bacte... [more]
A0A533UJT03.582e-8641.32RNA-directed DNA polymerase (Fragment) OS=Thaumarc... [more]
A0A4Y2WT156.151e-8239.50Retrovirus-related Pol polyprotein from transposon... [more]
A0A4Y2MR827.405e-8241.22Retrovirus-related Pol polyprotein from transposon... [more]
A0A4Y2RJM32.118e-8139.25Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044431.11.123e-7136.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030217.18.043e-7138.28pep primary_assembly:Astyanax_mexicanus-2.0:16:123... [more]
ENSAMXT00000054230.13.238e-6938.15pep primary_assembly:Astyanax_mexicanus-2.0:14:194... [more]
ENSAMXT00000041754.11.136e-6835.37pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045469.11.969e-6835.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034492.12.587e-7337.90pep primary_assembly:ASM223467v1:15:13490768:13497... [more]
ENSORLT00000030651.11.687e-6935.19pep primary_assembly:ASM223467v1:5:21308959:213150... [more]
ENSORLT00000038047.12.714e-6935.19pep primary_assembly:ASM223467v1:5:20995901:210019... [more]
ENSORLT00000040552.13.603e-6934.92pep primary_assembly:ASM223467v1:6:4563337:4567860... [more]
ENSORLT00000029819.13.952e-6934.36pep primary_assembly:ASM223467v1:24:6358775:636291... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058681.11.670e-16869.01SMESG000058681.1[more]
SMESG000029093.12.916e-12067.80SMESG000029093.1[more]
SMESG000080881.18.326e-11942.58SMESG000080881.1[more]
SMESG000057446.13.888e-10435.20SMESG000057446.1[more]
SMESG000057446.14.331e-10435.18SMESG000057446.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013261 ID=SMED30013261|Name=Retrovirus-related Pol polyprotein from transposon|organism=Schmidtea mediterranea sexual|type=transcript|length=5804bp
AAAGGCGGATTTGAATAATTAAGGCAGATATTAAATTTTTTTTAAATCAT
TGAGCTACGAAATCGTAGATTGCAAAATTTCAGAGAGGGTATTAGAAATA
GACAAATAATGGCAGATGCACAGAATTTATTAAATAATAATTTGACAAAT
ATTAATAATAACTTACCCAATGTTAATAATTTACCGAATGTTAATAATAT
ACCAGAACAACCACCAGCGGCGGATTTTATGAGATACCCAACTATACCAG
TAAAACCATATAATGGAAATCCAGGTGAATTTCCTGAGTTTATGCCCGAA
TATTTTCAAATGGCGAGAGCATTAGGCCTTCCTGAACCAGTTATGATTTT
AAGATTGCCCCTATATCTAAAAGGTATGGCGAATGAAAAATATAATGATG
TCATTTTAGCAAACCACCCAGTAGCGTGGAATGAGCTTAGAGTAGCATTG
ACTAATAGAATTTTACCCGGGGATGCCACGAGAATATTACGACAACAATT
TTATAATAGACGACAGAATTCGGGTCAGCATGTTGGGGAATTCGCGTATC
AAATCATGATGCTAGCTGAACGAGTTTTCGGAGATAGAGCCCGTTGGAAC
GAGGCTACCCTTGCATTAGTTAAAGACCAGTTTTGGGCAGGTCTATCATC
GGCAATGAGAAATGCGTTGAGTTTGCACATAAGGGATAATTTTGAGGAAT
TGACTAGAAAAGCAGTTTTAATAGAAAGTAGTATAGAGAAAGTTAATAAT
TTTGCGATTAGTACGAATAAATCTGATATCGAGTGTTTTAATTGTCATAA
AAGAGGACATCTATCTAAAGATTGTAATAGTAAGAGGAGTAATTCACCAG
GGGATAAATTATGTACGAGATGTTTTTCAAATCGAGGTTTTCAAAGTAAT
AATAATAATTATTATCGAAATAATAATGTACAGAGAAATGAGGTAAATTC
GACAATAAAGTAAAGTGTCATAAATGTGGAAAATTTGGTCATATGATGCA
TTCTTGTCCACAGAATCAGATGAATAATGCCAACATCAATTATAATAATA
ATAATCGGTCAAAAACAACTACGTTCGCAGTCATTTCGGAACAGAGACTA
ACTTATCTACGACAACTTGAATTAGAGATTCAAGAGGAAAGAAACCGGTT
AGCTCGGCTAACGACAAATTGATGATGATAGTGAAAATCATCCCACATTT
AAATCAATGATGTGGAGAAGATTGCAACAGATCATGAGGCTTTTAAAACA
AAACTGGCAGATCCCAAAAGATCCAGGCGTAAATGTGAAAAAGTTAACAG
TAGAAATTAGAGAAGCTATGAGGAAAATTCCTGAAGTTATGACAAGAGCA
GATATACTAGATATGGCTGAACGATTTATCGAAGAAGGCCTGACAAGAGG
TAAAAGGATAATGATCCTGGCAATGATGTTCAAGGATGCGTTTAGAGTAA
TACAAAAAGATCAGTCACGTATAAATCCAGAACTAGATAGAATGGCTAAA
GTTATGTCAGATAACTTCGAGGAATGGATGGCCGAAAATCTGTTCTGGAC
GATCAAAGGAACGGTAAAATCGACGTTTGTGTTAGATGAAAACATTTCAA
ACAATGAAAATCATGGAGGAAATCCACAAAATATGGCAAGCTTCGCGAAT
ATGATTATGATGATGTTGGTAATGATGGGAATATTACGACAAGTGAATTC
AATGACGGCATACGACTGCAGTAATCCGTCATTAGGCAAAATTTATTCGT
TGGTAGATACAGTGGATTGCAGGGAAGCATATCCAGATAAAGTAACCAAG
GGAGAGGATGTGGAATACCATGTTTATCAAGAAACAGATTTTTACCGAAC
AAGAGTGAAATAGTGCAGATTGCAGAAAGCAACATTTGAATATTATTGTG
GCAGACACAGTTATTCGGTATTTCTGGAAGCAAAATTGATACCCAGATCA
GTACCAATACAGGTGGATGACTGTATAAATGCATTTCGTACCAGTACTCT
TTAAATAGACAATGAAGTAACGATTTCAGCGGAAGTCGGGAAGAAACTCG
GGATAATTATCACCAAGGGAGGTCTAATAGAAGCAGATGGATCATGTGTG
GGCAGAACCAAAACAAGAGTCAGAGATGTGGTAAACAGTATAGTAGACGT
CGAAGATTATTCAATAGAATTACGAGAGTACGAAGGAACATTTGAGGTGG
CATCAGGAAAAATGATGACCCATCCGGAATGCAATGTAAAGCTGGGATAT
TGTAGAACGGGAGCTGCTACACTCGTGTACTCAACCATGAAAGAATTTTG
CGAATTGGGATATCTAAAGAAAACAGCATTTACAAAGTTAAATGGAACAA
GATTTACGAGCCATAAATACCAAGATGGAGTATGGGGAGAAAAGAAAATG
CAGCATATCAATAGAGAGGATATCTCTGAAAAAAGCACACCATTGGTGCT
AGTGTCCAAAGACCCTAATGATGCCATACGTTTGGTCCGAAAAGGTCAAA
AAATGAAATGTAGCACAACGGTTTATGAAACCAATTACAAGGGTATATAT
CTGTCTCATAAATATATACCAGCAGCAGAAAAGATCCATACGTCAGACGT
GAAAATTATAAATACGTAAACAACAAAATTGATTTCTTGTATCATGATTT
GCAAAGGCAAATGCAAGAGATGTACCAAGAGGTAGTACTGAACGATTGTC
GGCTGAACAGAGAAATAATACGAAATAGATTAGCAATTTCTGTGGCAAAT
CCAGATCTAATAATGCCAATGTTGATGGAACATGGAACATTCGGCAGGAT
CATGGGTGAGGCCATCTACAGTTATCAATGCAAGATAGTTGAAGTAGAGA
TTGCCAAGTATGATAAATGCACTCTGGAACTCCCAGTGTTATACGAAGGT
AAGCTACGTTTCGTGGCACCTGTGACGCATAGAATCTTAAAAGAAGGGGA
AGAACCCCAGAAATCAACGTGTAATCCGGCAATGTCACCGCTTTACAAGA
TAAACAATCACTGGATAACATTACCAGATCGTAAACCACCATCGAAGCCA
GTAGAAATACTTCAAGCTATCAAGTTGACATCAAAAGTGGAATTCAGACC
ACTAAATGAATTGTCCAAGGGAGGGGTATATACTCCTGAAGACATAGAGG
AAGCCAGGAGAGCTATTGGTTTTCCACAAGTGCGTGATCGAGGGGTTACA
GAAATAATAACCAGGATCTACAAGCACTATGATGGAAAACTGGATTATAA
TTTATTATTCGGACCAGATCATTACAGACAAGCAGCATCAAATGTAATAA
AGAAAATCTGGGGAAGATTTACCAGTTTTGGCATCTTCGTAGCAGGATGT
TCAGGAATATATGCAATATTTATGATACTAAAAATTATCGCATCACAACT
ATTATCTACGTATAGTATCTTCAAGATCGGAGGATGGTCTTGGAAGCTAT
TATTGGGAATGTGCCCATTATGTGCAGATTTCGCAGTATTCAGACATGAT
AACAAGGAAATTAAAATGATGAAGCAGAGAAACTTAATCAAGCACGAAAT
AGTGAGAGAGTGGGACGAGGATTATAGTCATCGAGACGATGACAATTCTG
ACGAGGGAGGTAACATAGAGGGCAATACAGCCCAAGATTACAACTCATCA
AAATCAGACAACAAAAAACCGAATTTTCAAAATTTTGAAAGCGGTAAATT
TCTACAGTACCCTTCTCAGCGGAGAAATAGTAGAAAACAGAACTTTGCCA
AAAGGTTTAGACCCCCGTATGAGGCCAACAAACGGATCATACCAAGGGAA
GTCGAGCAAGAGATTCTATATCGCTATGATGATAGAACAGATTTGGAAAA
AACTCCATTTTCACCATGGCCAAAACGTGAAAGACAATACGATACAATGC
CCACAGTGGGAATGAAAACTATGGAAAAAGTACCAGTATACCCGTTTAGC
ACTTTGGAGAAATTGAAACAAAGTTATGACGAACAAAGTCAGCCAGAAGC
AGAAAGAACCGAACTTGAAGCCAAGAGATTCAGAGAAAACGTTTTGGGAA
TTTCATCGATATGTATGGTAGCCACAGGAAATTTGGCAAATAAACCAACA
ATCAAAATAAAAGTTAACAGACATACAGTCCATGCACTGATCGACTCAGG
ATCAGATTTGACCATGATAGAGGCAAACTTGTTAAATGAAACTTAGCTGC
AAGCAATTGCTCCCACTTTGACAACAGCGACAGGAGCTAACGGTCAAGCA
ATCAATGTCATTGGAATATTAGACTGTGAATTGAGACTTTGTGACCAAAA
GTTCAGGCATGACATAAAAGTCACCAGAGAATGCATGGCGGAATGCATTG
TGGGTATGGATATACTCAAAAAGTTGAAAGACATTGTATTTGATTGTGCA
ACAGGCGAGTATATATAATATAGACGTGGTTTTCCTAGACCGAGTGGTCA
CTATACCACCGCGGACAGAAACAGTTTGTTTTGTGGCAACTCATCAAGAA
ATGGAAGGAGATGTTATTTTCGAACCAAAAGTGGAATTCGCGAGTAAATA
TAATACTCCCATTACACAAAATTTAGCAACGATACGGGAAGAGAGAATCC
CAATCAGAATAACGAATATGGATAATAAAACGTTGAGATTGTATCCAGAT
ACACGAGTTGGGAAAATTGTGAGACTAAAAGACCCCCAAGAGAAAGTTGC
ACAAGTATTGTCAGTACATGAAGAGGAAAGAGATCTAGATATCGAGTACT
ATGATGCTCCGAATTGTGATAGTAAAGACCTCACGAGAAGGGAAAATATC
AAGGTAAACCAATTACTGCGAAAATATGACCAAGTTTTTGCAAAACATGA
ATATGACTTAGGCCAAGTAAATATTTTAGAACATGAAATTAATTTAACTG
AAACTAAACCTATTAAAATCAGACCGTATAAAATCCCACAAAGCTTACAA
GAACCAGTAAATAAACAAATTAAATTAATGCAAAAGTATAATATAATTAG
ATCAAGTAAATCTCCTTATTCTTCTCCACTTGTGGTTGTAGCTAAAAGGG
ACGGGTCGATAAGATTATGTAATGATTATCGTAAATTAAATGAGCAGACT
GTAAGTGATAATCACCCGCTGCCACTGTTAGACTATATATATGATAAAAT
GAAAAATTCGAGACTTTTCACGGTGATGGATGCACAAAAAGGTTTTTACC
AAATTAAAATGAGTGAAAATTCGATACCGATGACAGGCTTTTCTACAGAC
GATGATCACTTCGAGTATTTAATGATGACTTTCGGATTAAAAGGAGCACC
TCCAACATTTCTGAGGGCGATGAATATAATGTTGATGGATGCACATCATG
CGATGGTGTATATTGATGATATTTTCATATTTTCGGAAGACTTAAATAAA
CATCTAGAACATCTAGAGGACATTTATAAAAGATTAATAATGGCTAATCT
CAAAGTGAAACCCAGTAAATGTAAATGGGCAGAGCAAGAAGTGATTTACG
TGGAACATGTGATATCTCATGATTGTGTAAAACCAGATCCACCTAACACA
GAGAAAGTGAGAAACTTTCCCCAACCAACGAATGTCAAACAAATCAAAGG
ATTCTTAGGTTTGACGGGGTATTACCCGCAATTCATTAGAAATTTTTCCG
CGATTGCATTTCCATTGACTGTCCTAGAGAAGAAAGGAGTCAAATTTACT
TGGGGAAATGAGCAACAAGAAGCCTTTAACAATCTAAAAGATGCGTTGGT
AAAACCACCCATCTTGAGATTCCCAGATTTCAATAGACAATTTATGGTGA
TGAT
back to top

protein sequence of SMED30013261-orf-1

>SMED30013261-orf-1 ID=SMED30013261-orf-1|Name=SMED30013261-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=434bp
MEGDVIFEPKVEFASKYNTPITQNLATIREERIPIRITNMDNKTLRLYPD
TRVGKIVRLKDPQEKVAQVLSVHEEERDLDIEYYDAPNCDSKDLTRRENI
KVNQLLRKYDQVFAKHEYDLGQVNILEHEINLTETKPIKIRPYKIPQSLQ
EPVNKQIKLMQKYNIIRSSKSPYSSPLVVVAKRDGSIRLCNDYRKLNEQT
VSDNHPLPLLDYIYDKMKNSRLFTVMDAQKGFYQIKMSENSIPMTGFSTD
DDHFEYLMMTFGLKGAPPTFLRAMNIMLMDAHHAMVYIDDIFIFSEDLNK
HLEHLEDIYKRLIMANLKVKPSKCKWAEQEVIYVEHVISHDCVKPDPPNT
EKVRNFPQPTNVKQIKGFLGLTGYYPQFIRNFSAIAFPLTVLEKKGVKFT
WGNEQQEAFNNLKDALVKPPILRFPDFNRQFMVM
back to top

protein sequence of SMED30013261-orf-2

>SMED30013261-orf-2 ID=SMED30013261-orf-2|Name=SMED30013261-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=136bp
MMTHPECNVKLGYCRTGAATLVYSTMKEFCELGYLKKTAFTKLNGTRFTS
HKYQDGVWGEKKMQHINREDISEKSTPLVLVSKDPNDAIRLVRKGQKMKC
STTVYETNYKGIYLSHKYIPAAEKIHTSDVKIINT*
back to top

protein sequence of SMED30013261-orf-3

>SMED30013261-orf-3 ID=SMED30013261-orf-3|Name=SMED30013261-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=512bp
MQEMYQEVVLNDCRLNREIIRNRLAISVANPDLIMPMLMEHGTFGRIMGE
AIYSYQCKIVEVEIAKYDKCTLELPVLYEGKLRFVAPVTHRILKEGEEPQ
KSTCNPAMSPLYKINNHWITLPDRKPPSKPVEILQAIKLTSKVEFRPLNE
LSKGGVYTPEDIEEARRAIGFPQVRDRGVTEIITRIYKHYDGKLDYNLLF
GPDHYRQAASNVIKKIWGRFTSFGIFVAGCSGIYAIFMILKIIASQLLST
YSIFKIGGWSWKLLLGMCPLCADFAVFRHDNKEIKMMKQRNLIKHEIVRE
WDEDYSHRDDDNSDEGGNIEGNTAQDYNSSKSDNKKPNFQNFESGKFLQY
PSQRRNSRKQNFAKRFRPPYEANKRIIPREVEQEILYRYDDRTDLEKTPF
SPWPKRERQYDTMPTVGMKTMEKVPVYPFSTLEKLKQSYDEQSQPEAERT
ELEAKRFRENVLGISSICMVATGNLANKPTIKIKVNRHTVHALIDSGSDL
TMIEANLLNET*
back to top

protein sequence of SMED30013261-orf-4

>SMED30013261-orf-4 ID=SMED30013261-orf-4|Name=SMED30013261-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=285bp
MADAQNLLNNNLTNINNNLPNVNNLPNVNNIPEQPPAADFMRYPTIPVKP
YNGNPGEFPEFMPEYFQMARALGLPEPVMILRLPLYLKGMANEKYNDVIL
ANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGQHVGEFAYQIM
MLAERVFGDRARWNEATLALVKDQFWAGLSSAMRNALSLHIRDNFEELTR
KAVLIESSIEKVNNFAISTNKSDIECFNCHKRGHLSKDCNSKRSNSPGDK
LCTRCFSNRGFQSNNNNYYRNNNVQRNEVNSTIK*
back to top

protein sequence of SMED30013261-orf-5

>SMED30013261-orf-5 ID=SMED30013261-orf-5|Name=SMED30013261-orf-5|organism=Schmidtea mediterranea sexual|type=polypeptide|length=219bp
MMWRRLQQIMRLLKQNWQIPKDPGVNVKKLTVEIREAMRKIPEVMTRADI
LDMAERFIEEGLTRGKRIMILAMMFKDAFRVIQKDQSRINPELDRMAKVM
SDNFEEWMAENLFWTIKGTVKSTFVLDENISNNENHGGNPQNMASFANMI
MMMLVMMGILRQVNSMTAYDCSNPSLGKIYSLVDTVDCREAYPDKVTKGE
DVEYHVYQETDFYRTRVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
GO:0006508proteolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR021109Peptidase_aspartic_dom_sf
IPR000477RT_dom
IPR001878Znf_CCHC
IPR001969Aspartic_peptidase_AS
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0004190aspartic-type endopeptidase activity