SAM domain-containing protein

Overview
NameSAM domain-containing protein
Smed IDSMED30013260
Length (bp)4478
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SAM domain-containing protein (SMED30013260) t-SNE clustered cells

Violin plots show distribution of expression levels for SAM domain-containing protein (SMED30013260) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SAM domain-containing protein (SMED30013260) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SAM domain-containing protein (SMED30013260) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013260

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013260h1SMcG0004379 Contig3247newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013260h1SMcG0017040 Contig3247newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30013260h1SMcG0004379 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013260h1SMcG0004379 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013260h1SMcG0004379 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013260h1SMcG0004379 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013260h1SMcG0004379 Contig37452uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013260h1SMcG0004379 Contig37452newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30013260h1SMcG0010492 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013260h1SMcG0010492 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013260h1SMcG0010492 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013260h1SMcG0010492 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013260h1SMcG0004379 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013260h1SMcG0004379 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013260h1SMcG0004379 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013260h1SMcG0004379 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013260h1SMcG0004379 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013260h1SMcG0004379 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013260h1SMcG0004379 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013260h1SMcG0004379 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013260h1SMcG0010492 dd_Smed_v4_1968_2_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SAM domain-containing protein vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 223.402 bits (568), Expect = 1.923e-59
Identity = 147/368 (39.95%), Postives = 209/368 (56.79%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  457 SEPEFKRGG-TRATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 774          
BLAST of SAM domain-containing protein vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 224.557 bits (571), Expect = 3.180e-59
Identity = 147/368 (39.95%), Postives = 209/368 (56.79%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  604 SEPEFKRGG-TRATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 921          
BLAST of SAM domain-containing protein vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 223.016 bits (567), Expect = 8.472e-59
Identity = 147/368 (39.95%), Postives = 209/368 (56.79%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  579 SEPEFKRGG-TRATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 896          
BLAST of SAM domain-containing protein vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 223.016 bits (567), Expect = 9.659e-59
Identity = 147/368 (39.95%), Postives = 209/368 (56.79%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  610 SEPEFKRGG-TRATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 927          
BLAST of SAM domain-containing protein vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 218.009 bits (554), Expect = 2.152e-58
Identity = 141/350 (40.29%), Postives = 202/350 (57.71%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFN 2217
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N
Sbjct:  441 SEPEFKRGG-TRATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSN 740          
BLAST of SAM domain-containing protein vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 156.762 bits (395), Expect = 3.747e-39
Identity = 112/354 (31.64%), Postives = 179/354 (50.56%), Query Frame = 1
Query: 1297 NLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETS---EELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2349
            +L +++  P  S F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  319 HLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 639          
BLAST of SAM domain-containing protein vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 156.762 bits (395), Expect = 5.625e-39
Identity = 112/354 (31.64%), Postives = 179/354 (50.56%), Query Frame = 1
Query: 1297 NLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETS---EELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2349
            +L +++  P  S F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  361 HLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 681          
BLAST of SAM domain-containing protein vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 157.532 bits (397), Expect = 9.896e-39
Identity = 112/354 (31.64%), Postives = 179/354 (50.56%), Query Frame = 1
Query: 1297 NLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETS---EELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2349
            +L +++  P  S F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  551 HLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 871          
BLAST of SAM domain-containing protein vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 157.532 bits (397), Expect = 9.896e-39
Identity = 112/354 (31.64%), Postives = 179/354 (50.56%), Query Frame = 1
Query: 1297 NLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETS---EELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2349
            +L +++  P  S F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  551 HLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 871          
BLAST of SAM domain-containing protein vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 157.532 bits (397), Expect = 1.180e-38
Identity = 112/354 (31.64%), Postives = 179/354 (50.56%), Query Frame = 1
Query: 1297 NLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETS---EELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2349
            +L +++  P  S F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  593 HLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 913          
BLAST of SAM domain-containing protein vs. Ensembl Fly
Match: Liprin-beta (gene:FBgn0036376 transcript:FBtr0075814)

HSP 1 Score: 192.971 bits (489), Expect = 9.120e-51
Identity = 131/368 (35.60%), Postives = 196/368 (53.26%), Query Frame = 1
Query: 1159 AAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTN--GLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSE-TGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSE 2253
            A E +  +F R    R TAG R+          E + Q  L   N           +  +  W    VC +L  +GLG Y +NCRKWL     + F  AS  +IE+ELN+   LH KK+L     L    +T   +  LT     +   +  R WLDDIGL  Y   F    IDG ML ++TLEDL  L +++ LH+ SL+ GI  +R + ++   LIRR  +     ++  T    N+E+           WT H++M WL+ I+L EY  N+RG+G+HGAL++ E RFNA+ LA +L+IP ++SLLRRHL   F+EL+G  ++  K+ A     + P++IT+K+K   K++ F++ +RK+S   S+
Sbjct:  320 ALEQAEPEFRRGGA-RATAGGRI----------EWSAQTPLFGEN-----------EKHWTTWGAQEVCNWLAYMGLGCYEDNCRKWLNANPSVSFFTASPVDIERELNLKMPLHRKKIL-----LAIDDLTGKEFDDLTLKASSLDVTWVLR-WLDDIGLPQYKDYFMQAKIDGRMLHRLTLEDLSQLHVSSCLHIASLRAGILCMRRLSWNAEGLIRRSIKVVSEDEAAATPDRDNVEL-----------WTAHRIMGWLQTIDLSEYTPNLRGAGVHGALMLYEPRFNADLLADLLSIPPSKSLLRRHLAMHFKELVGRPVILSKRDAESAPGYQPLSITAKLK-PVKRTQFSLKRRKSSKSQSD 647          
BLAST of SAM domain-containing protein vs. Ensembl Fly
Match: Liprin-beta (gene:FBgn0036376 transcript:FBtr0075813)

HSP 1 Score: 192.971 bits (489), Expect = 9.120e-51
Identity = 131/368 (35.60%), Postives = 196/368 (53.26%), Query Frame = 1
Query: 1159 AAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTN--GLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSE-TGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSE 2253
            A E +  +F R    R TAG R+          E + Q  L   N           +  +  W    VC +L  +GLG Y +NCRKWL     + F  AS  +IE+ELN+   LH KK+L     L    +T   +  LT     +   +  R WLDDIGL  Y   F    IDG ML ++TLEDL  L +++ LH+ SL+ GI  +R + ++   LIRR  +     ++  T    N+E+           WT H++M WL+ I+L EY  N+RG+G+HGAL++ E RFNA+ LA +L+IP ++SLLRRHL   F+EL+G  ++  K+ A     + P++IT+K+K   K++ F++ +RK+S   S+
Sbjct:  320 ALEQAEPEFRRGGA-RATAGGRI----------EWSAQTPLFGEN-----------EKHWTTWGAQEVCNWLAYMGLGCYEDNCRKWLNANPSVSFFTASPVDIERELNLKMPLHRKKIL-----LAIDDLTGKEFDDLTLKASSLDVTWVLR-WLDDIGLPQYKDYFMQAKIDGRMLHRLTLEDLSQLHVSSCLHIASLRAGILCMRRLSWNAEGLIRRSIKVVSEDEAAATPDRDNVEL-----------WTAHRIMGWLQTIDLSEYTPNLRGAGVHGALMLYEPRFNADLLADLLSIPPSKSLLRRHLAMHFKELVGRPVILSKRDAESAPGYQPLSITAKLK-PVKRTQFSLKRRKSSKSQSD 647          
BLAST of SAM domain-containing protein vs. Ensembl Fly
Match: Liprin-beta (gene:FBgn0036376 transcript:FBtr0330342)

HSP 1 Score: 192.971 bits (489), Expect = 9.120e-51
Identity = 131/368 (35.60%), Postives = 196/368 (53.26%), Query Frame = 1
Query: 1159 AAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTN--GLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSE-TGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSE 2253
            A E +  +F R    R TAG R+          E + Q  L   N           +  +  W    VC +L  +GLG Y +NCRKWL     + F  AS  +IE+ELN+   LH KK+L     L    +T   +  LT     +   +  R WLDDIGL  Y   F    IDG ML ++TLEDL  L +++ LH+ SL+ GI  +R + ++   LIRR  +     ++  T    N+E+           WT H++M WL+ I+L EY  N+RG+G+HGAL++ E RFNA+ LA +L+IP ++SLLRRHL   F+EL+G  ++  K+ A     + P++IT+K+K   K++ F++ +RK+S   S+
Sbjct:  320 ALEQAEPEFRRGGA-RATAGGRI----------EWSAQTPLFGEN-----------EKHWTTWGAQEVCNWLAYMGLGCYEDNCRKWLNANPSVSFFTASPVDIERELNLKMPLHRKKIL-----LAIDDLTGKEFDDLTLKASSLDVTWVLR-WLDDIGLPQYKDYFMQAKIDGRMLHRLTLEDLSQLHVSSCLHIASLRAGILCMRRLSWNAEGLIRRSIKVVSEDEAAATPDRDNVEL-----------WTAHRIMGWLQTIDLSEYTPNLRGAGVHGALMLYEPRFNADLLADLLSIPPSKSLLRRHLAMHFKELVGRPVILSKRDAESAPGYQPLSITAKLK-PVKRTQFSLKRRKSSKSQSD 647          
BLAST of SAM domain-containing protein vs. Ensembl Fly
Match: Liprin-gamma (gene:FBgn0034720 transcript:FBtr0342990)

HSP 1 Score: 116.701 bits (291), Expect = 9.561e-26
Identity = 60/166 (36.14%), Postives = 93/166 (56.02%), Query Frame = 1
Query: 1615 WLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQH-LKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2109
            WL DIGL  Y   F  + +D  MLD ++ ++L+  L +T + H  S+  GI +LR + YD   L  R        QSET          +  P     WT  + + W+R I+L EYA N++ SG+HG L++LE  F+ +++A+ L IP +++++RRHL T+F  LI
Sbjct:  736 WLPDIGLPQYAEPFVQSLVDARMLDTLSKKELEKFLGVTRKFHQASIVHGIHVLRIVKYDRQTLAMR------RVQSET---------VDTDP---IVWTNQRFIRWVRSIDLGEYADNLKDSGVHGGLVVLEPSFSGDTMATALGIPPSKNIIRRHLNTEFDALI 883          
BLAST of SAM domain-containing protein vs. Ensembl Fly
Match: Liprin-gamma (gene:FBgn0034720 transcript:FBtr0113106)

HSP 1 Score: 116.316 bits (290), Expect = 1.175e-25
Identity = 60/166 (36.14%), Postives = 93/166 (56.02%), Query Frame = 1
Query: 1615 WLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQH-LKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2109
            WL DIGL  Y   F  + +D  MLD ++ ++L+  L +T + H  S+  GI +LR + YD   L  R        QSET          +  P     WT  + + W+R I+L EYA N++ SG+HG L++LE  F+ +++A+ L IP +++++RRHL T+F  LI
Sbjct:  806 WLPDIGLPQYAEPFVQSLVDARMLDTLSKKELEKFLGVTRKFHQASIVHGIHVLRIVKYDRQTLAMR------RVQSET---------VDTDP---IVWTNQRFIRWVRSIDLGEYADNLKDSGVHGGLVVLEPSFSGDTMATALGIPPSKNIIRRHLNTEFDALI 953          
BLAST of SAM domain-containing protein vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 232.261 bits (591), Expect = 1.074e-62
Identity = 150/370 (40.54%), Postives = 209/370 (56.49%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKI 2283
            +F R   +R TAGPRL               R L  SN N          S F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P   ++
Sbjct:  459 EFQRGG-VRATAGPRL------------GWSRDLQRSNNN-------ELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVKP-RRLSFGSFGTLRRK-RQEDMEEYVCPMDVQM 778          
BLAST of SAM domain-containing protein vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 232.646 bits (592), Expect = 1.397e-62
Identity = 150/365 (41.10%), Postives = 207/365 (56.71%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVP 2268
            +F R   +R TAGPRL               R L  SN N          S F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P
Sbjct:  494 EFQRGG-VRATAGPRL------------GWSRDLQRSNNN-------ELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVK-PRRLSFGSFGTLRRK-RQEDMEEYVCP 808          
BLAST of SAM domain-containing protein vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 231.876 bits (590), Expect = 1.451e-62
Identity = 150/365 (41.10%), Postives = 207/365 (56.71%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVP 2268
            +F R   +R TAGPRL               R L  SN N          S F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P
Sbjct:  459 EFQRGG-VRATAGPRL------------GWSRDLQRSNNN-------ELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVK-PRRLSFGSFGTLRRK-RQEDMEEYVCP 773          
BLAST of SAM domain-containing protein vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 232.646 bits (592), Expect = 1.543e-62
Identity = 150/370 (40.54%), Postives = 209/370 (56.49%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKI 2283
            +F R   +R TAGPRL               R L  SN N          S F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P   ++
Sbjct:  494 EFQRGG-VRATAGPRL------------GWSRDLQRSNNN-------ELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVK-PRRLSFGSFGTLRRK-RQEDMEEYVCPMDVQM 813          
BLAST of SAM domain-containing protein vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 228.409 bits (581), Expect = 9.632e-62
Identity = 146/358 (40.78%), Postives = 202/358 (56.42%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSE 2253
            +F R   +R TAGPRL               R L  SN N          S F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  +K     VI++    ET E
Sbjct:  459 EFQRGG-VRATAGPRL------------GWSRDLQRSNNN-------ELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVKAPKK----TVIRKFWDTETKE 764          
BLAST of SAM domain-containing protein vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 212.231 bits (539), Expect = 2.003e-55
Identity = 131/337 (38.87%), Postives = 190/337 (56.38%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2190
            +F R    R TAGPRL               R L   N  L +         F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S     + Y        K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  617 EFKRGG-TRSTAGPRL------------GWSRDLGQVNSELDT--------PFAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSED--ESNYG-------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 905          
BLAST of SAM domain-containing protein vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 211.46 bits (537), Expect = 2.040e-55
Identity = 131/337 (38.87%), Postives = 190/337 (56.38%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2190
            +F R    R TAGPRL               R L   N  L +         F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S     + Y        K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  532 EFKRGG-TRSTAGPRL------------GWSRDLGQVNSELDT--------PFAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSED--ESNYG-------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 820          
BLAST of SAM domain-containing protein vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 211.46 bits (537), Expect = 2.415e-55
Identity = 131/337 (38.87%), Postives = 190/337 (56.38%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2190
            +F R    R TAGPRL               R L   N  L +         F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S     + Y        K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  554 EFKRGG-TRSTAGPRL------------GWSRDLGQVNSELDT--------PFAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSED--ESNYG-------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 842          
BLAST of SAM domain-containing protein vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 211.846 bits (538), Expect = 2.644e-55
Identity = 131/337 (38.87%), Postives = 190/337 (56.38%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2190
            +F R    R TAGPRL               R L   N  L +         F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S     + Y        K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  620 EFKRGG-TRSTAGPRL------------GWSRDLGQVNSELDT--------PFAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSED--ESNYG-------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 908          
BLAST of SAM domain-containing protein vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 210.69 bits (535), Expect = 2.972e-55
Identity = 130/337 (38.58%), Postives = 189/337 (56.08%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2190
            +F R    R TAGPRL               R L   N  L +         F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S   +            K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  522 EFKRGG-TRSTAGPRL------------GWSRDLGQVNSELDT--------PFAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSEDESNYG---------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 810          
BLAST of SAM domain-containing protein vs. Ensembl Mouse
Match: Ppfibp1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:MGI Symbol;Acc:MGI:1914783])

HSP 1 Score: 219.935 bits (559), Expect = 5.214e-58
Identity = 143/367 (38.96%), Postives = 210/367 (57.22%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC++L + GLG+Y ++ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP++                   ++ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK  +E  EE + P
Sbjct:  569 SEPEFKRGGT-RATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDEN-----------------SITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLTFSNFGNLRKKKHEDGEEYVCP 886          
BLAST of SAM domain-containing protein vs. Ensembl Mouse
Match: Ppfibp1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:MGI Symbol;Acc:MGI:1914783])

HSP 1 Score: 219.935 bits (559), Expect = 5.440e-58
Identity = 143/367 (38.96%), Postives = 210/367 (57.22%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC++L + GLG+Y ++ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP++                   ++ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK  +E  EE + P
Sbjct:  580 SEPEFKRGGT-RATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDEN-----------------SITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLTFSNFGNLRKKKHEDGEEYVCP 897          
BLAST of SAM domain-containing protein vs. Ensembl Mouse
Match: Ppfibp2 (PTPRF interacting protein, binding protein 2 (liprin beta 2) [Source:MGI Symbol;Acc:MGI:894649])

HSP 1 Score: 198.749 bits (504), Expect = 1.793e-51
Identity = 127/364 (34.89%), Postives = 200/364 (54.95%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAAT---YFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSE 2253
            ++F R   LR TAGPRL       +  +   Q+                + + F  WS + VC ++   GLG Y    R+W+T+G   + A+ +++EKEL I + LH KKL++ ++ + +     +    +  +TR             WLDDIGL  Y   F  + +DG ML  +T+ DL  LK+T++LH LS+K  I +L    ++ + L RRPA+ +                 N+ P EV +W+ H+VMEWLR ++L EYA N+RGSG+HG LIILE RF  ++LA +LNIP  ++LLRRHL TKF  LIG +   +K+  + +  ++P+T T+K++  RK  F  F  +++K  +E+++
Sbjct:  518 AEFRRGG-LRATAGPRLS------RTRDTKGQKC--------------DANAPFAQWSTERVCTWMEDFGLGQYVIFARQWVTSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINAKQEETSALLDHIWVTR-------------WLDDIGLPQYKDQFHESRVDGRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADES-----------------NLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKRDKMASPAYTPLTTTAKVRP-RKLGFSHFGNMRKKKFDESTD 829          
BLAST of SAM domain-containing protein vs. Ensembl Mouse
Match: Ppfibp2 (PTPRF interacting protein, binding protein 2 (liprin beta 2) [Source:MGI Symbol;Acc:MGI:894649])

HSP 1 Score: 198.364 bits (503), Expect = 2.173e-51
Identity = 127/364 (34.89%), Postives = 200/364 (54.95%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAAT---YFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSE 2253
            ++F R   LR TAGPRL       +  +   Q+                + + F  WS + VC ++   GLG Y    R+W+T+G   + A+ +++EKEL I + LH KKL++ ++ + +     +    +  +TR             WLDDIGL  Y   F  + +DG ML  +T+ DL  LK+T++LH LS+K  I +L    ++ + L RRPA+ +                 N+ P EV +W+ H+VMEWLR ++L EYA N+RGSG+HG LIILE RF  ++LA +LNIP  ++LLRRHL TKF  LIG +   +K+  + +  ++P+T T+K++  RK  F  F  +++K  +E+++
Sbjct:  529 AEFRRGG-LRATAGPRLS------RTRDTKGQKC--------------DANAPFAQWSTERVCTWMEDFGLGQYVIFARQWVTSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINAKQEETSALLDHIWVTR-------------WLDDIGLPQYKDQFHESRVDGRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADES-----------------NLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKRDKMASPAYTPLTTTAKVRP-RKLGFSHFGNMRKKKFDESTD 840          
BLAST of SAM domain-containing protein vs. Ensembl Mouse
Match: Kazn (kazrin, periplakin interacting protein [Source:MGI Symbol;Acc:MGI:1918779])

HSP 1 Score: 112.849 bits (281), Expect = 1.107e-24
Identity = 56/164 (34.15%), Postives = 92/164 (56.10%), Query Frame = 1
Query: 1597 NFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHL 2085
            ++  + WL+DIGL  Y   F ++ +DG ML+ +   DL+ HL ++ + H +S+  GI+LL ++++    L  R A                   C     +   WT  +V++W+R I+L EYA N+  SG+HGA+++LE  FNA ++A+ L IP  + +LRRHL
Sbjct:  450 HWVAKAWLNDIGLSQYSQAFQNHLVDGRMLNSLMKRDLEKHLNVSKKFHQVSILLGIELLYQVNFSREALQERRAR------------------CETQNTDPVVWTNQRVLKWVRDIDLKEYADNLTNSGVHGAVLVLEPTFNAEAMATALGIPSGKHILRRHL 595          
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86W92|LIPB1_HUMAN (Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 4.639e-58
Identity = 147/368 (39.95%), Postives = 209/368 (56.79%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  610 SEPEFKRGG-TRATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 927          
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C8U0|LIPB1_MOUSE (Liprin-beta-1 OS=Mus musculus OX=10090 GN=Ppfibp1 PE=1 SV=3)

HSP 1 Score: 219.935 bits (559), Expect = 3.647e-57
Identity = 143/367 (38.96%), Postives = 210/367 (57.22%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC++L + GLG+Y ++ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP++                   ++ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK  +E  EE + P
Sbjct:  569 SEPEFKRGGT-RATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDEN-----------------SITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLTFSNFGNLRKKKHEDGEEYVCP 886          
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Match: sp|O35711|LIPB2_MOUSE (Liprin-beta-2 OS=Mus musculus OX=10090 GN=Ppfibp2 PE=1 SV=3)

HSP 1 Score: 198.364 bits (503), Expect = 1.493e-50
Identity = 127/364 (34.89%), Postives = 200/364 (54.95%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAAT---YFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSE 2253
            ++F R   LR TAGPRL       +  +   Q+                + + F  WS + VC ++   GLG Y    R+W+T+G   + A+ +++EKEL I + LH KKL++ ++ + +     +    +  +TR             WLDDIGL  Y   F  + +DG ML  +T+ DL  LK+T++LH LS+K  I +L    ++ + L RRPA+ +                 N+ P EV +W+ H+VMEWLR ++L EYA N+RGSG+HG LIILE RF  ++LA +LNIP  ++LLRRHL TKF  LIG +   +K+  + +  ++P+T T+K++  RK  F  F  +++K  +E+++
Sbjct:  529 AEFRRGG-LRATAGPRLS------RTRDTKGQKC--------------DANAPFAQWSTERVCTWMEDFGLGQYVIFARQWVTSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINAKQEETSALLDHIWVTR-------------WLDDIGLPQYKDQFHESRVDGRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADES-----------------NLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKRDKMASPAYTPLTTTAKVRP-RKLGFSHFGNMRKKKFDESTD 840          
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8ND30|LIPB2_HUMAN (Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 PE=1 SV=3)

HSP 1 Score: 195.282 bits (495), Expect = 1.443e-49
Identity = 130/368 (35.33%), Postives = 199/368 (54.08%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLL----AGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAAT---YFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSE 2253
            ++F R   LR TAGPRL     + G K              S+ N          + F  WS + VCA+L   GL  Y    R+W+++G   + A+ +++EKEL I + LH KKL++ ++ + +     +    +  +TR             WLDDIGL  Y   F  + +D  ML  +T+ DL  LK+T++LH LS+K  I +L    ++   L RRPA+ +                 N+ P EV +W+ H+VMEWLR ++L EYA N+RGSG+HG LIILE RF  ++LA +LNIP  ++LLRRHL TKF  LIG +   +K+  + +  ++P+T T+K++  RK  F  F  I++K  +E+++
Sbjct:  523 AEFRRGG-LRATAGPRLSRTRDSKGQK--------------SDAN----------APFAQWSTERVCAWLEDFGLAQYVIFARQWVSSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINTKQEEKSALLDHIWVTR-------------WLDDIGLPQYKDQFHESRVDRRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPHCLHRRPADES-----------------NLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTAKVR-PRKLGFSHFGNIRKKKFDESTD 834          
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q94071|LIPB_CAEEL (Liprin-beta homolog OS=Caenorhabditis elegans OX=6239 GN=hlb-1 PE=2 SV=5)

HSP 1 Score: 156.377 bits (394), Expect = 3.978e-37
Identity = 112/354 (31.64%), Postives = 179/354 (50.56%), Query Frame = 1
Query: 1297 NLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETS---EELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2349
            +L +++  P  S F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  682 HLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 1002          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: A0A2I4AZL7 (liprin-beta-1 OS=Austrofundulus limnaeus OX=52670 GN=ppfibp1 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 3.524e-61
Identity = 148/370 (40.00%), Postives = 209/370 (56.49%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVPYTYKI 2283
             +F R   +R TAGPRL               R L   N  + +         F  WSKD VC +L + GLG YAN  R W+++G   ++AS++++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +YD + L RRP++                   N+ P E+ +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K  RK SF N    RK   E +EE + P   ++
Sbjct:   85 GEFKRGG-VRATAGPRL------------GWSRDLQRVNNEVDA--------PFARWSKDQVCGWLQEQGLGLYANLARVWISSGQTLLQASQQDLEKELGIKHPLHRKKLQLALQALGSEE---------DDNKGKLDYNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYDPNCLRRRPSDEN-----------------NISPAEISQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGSEAQQLKQECLENPDYTLLTATTKVK-PRKLSFGNFGNLRKKKQEENEEYVCPMDVEM 405          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: A0A1A7YVJ3 (PTPRF interacting protein, binding protein 1 (Liprin beta 1) OS=Iconisemion striatum OX=60296 GN=PPFIBP1 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 3.238e-60
Identity = 145/370 (39.19%), Postives = 207/370 (55.95%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVPYTYKI 2283
             +F R   +R TAGPRL               R L   N  + +         F  WSKD VC +L + GLG Y N  R W+++G   ++AS++++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +YD + L RRP++                   N+ P E+ +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K  RK  F N    RK   + +EE + P   ++
Sbjct:   51 GEFKRGG-VRATAGPRL------------GWSRDLQRVNNEVDA--------PFARWSKDQVCDWLQEQGLGLYMNMARVWISSGQTLLQASQQDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYDPNCLRRRPSDEN-----------------NISPAEISQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFGLLIGSEAQQLKQECLENPDYTLLTATTKVK-PRKLPFGNFGSLRKKKQDENEEYVCPMDVEM 371          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: A0A3Q4GXP0 (PPFIA binding protein 1a OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 5.983e-60
Identity = 146/362 (40.33%), Postives = 206/362 (56.91%), Query Frame = 1
Query: 1189 RNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVP 2268
            R   +R TAGPRL   G      ++AV                LP    F  WSK+ VCA+LH+ GLG Y    + W+ +G   ++AS+ ++EKEL + + LH KKL + ++ + S              K K+  N+ TR WLDDIGL  Y S F    IDG  L  +T+EDL  LK+ + LH LS+KR IQ+LR   YD + L RRP++ +                 NV P E+ +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  +LA +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K  R+ SF  F  +++K  ++  EE + P
Sbjct:    5 RRGGVRATAGPRL---GWSRDTKQIAVD---------------LP----FSRWSKEEVCAWLHEQGLGFYVAQGQSWIKSGQTLLQASQHDLEKELGVKHPLHRKKLQLALQAVGSEEEDL---------KGKLDHNWVTR-WLDDIGLPQYKSHFDEARIDGRTLHYMTVEDLLSLKVGSVLHHLSIKRAIQVLRLNYYDPNCLRRRPSDES-----------------NVTPAEISQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVEALALLLNIPPNKTLLRRHLATHFHLLIGSEAQRLKQDCLENPDYTVLTATAKVK-PRRLSFGGFGTLRKKRQDD-GEEYVCP 315          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: G3W5N5 (Uncharacterized protein OS=Sarcophilus harrisii OX=9305 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.741e-59
Identity = 145/367 (39.51%), Postives = 207/367 (56.40%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2268
            S  +F R    R TAGPRL               R L  SN +L     +P    F  W+K+ VC +L   GLG+Y N+ + W+T+G   ++AS++++EKEL I   LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+  +E+ D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  138 SEPEFKRGG-TRATAGPRL------------GWSRDLGQSNSDLD----MP----FAKWTKEQVCNWLLDQGLGSYTNSGKHWITSGQTLLQASQQDLEKELGIKYSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLTLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDEN-----------------NITPSEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGVEAQHQKRETMESPDYVLLTATAKVK-PKKLTFSNFGNLRKKKQEEMEEYICP 455          
BLAST of SAM domain-containing protein vs. TrEMBL
Match: H0WFE9 (PPFIA-binding protein 1a OS=Danio rerio OX=7955 GN=ppfibp1a PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.402e-59
Identity = 150/370 (40.54%), Postives = 209/370 (56.49%), Query Frame = 1
Query: 1180 QFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKI 2283
            +F R   +R TAGPRL               R L  SN N          S F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P   ++
Sbjct:  459 EFQRGG-VRATAGPRL------------GWSRDLQRSNNN-------ELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVKP-RRLSFGSFGTLRRK-RQEDMEEYVCPMDVQM 778          
BLAST of SAM domain-containing protein vs. Ensembl Cavefish
Match: ppfibp1b (liprin-beta-1 [Source:NCBI gene;Acc:103045253])

HSP 1 Score: 228.024 bits (580), Expect = 1.184e-60
Identity = 144/371 (38.81%), Postives = 209/371 (56.33%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2283
            S S+F R   +R TAGPRL               R L  SN  + +         F  WS++ VC ++ + GLG Y N  R+W+++G   ++AS++++EKEL I   LH KKL + ++ L S              K K+  ++ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +Y+ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K   +K  F    RK   E SEE + P   ++
Sbjct:  601 SESEFKRGG-VRATAGPRL------------GWSRDLHNSNSEVDA--------PFARWSREQVCEWMQEQGLGLYVNLARQWISSGHTLLQASQQDLEKELGIKLPLHRKKLQLALQALGSEE---------DDNKGKLDYHWVTR-WLDDIGLPQYKTHFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFNLLIGSEAQQLKQDWLENPDYAVLTATAKVKP--RKLGFGTFGRKKKQEDSEEYVCPMDVEM 921          
BLAST of SAM domain-containing protein vs. Ensembl Cavefish
Match: ppfibp1b (liprin-beta-1 [Source:NCBI gene;Acc:103045253])

HSP 1 Score: 227.639 bits (579), Expect = 1.273e-60
Identity = 144/371 (38.81%), Postives = 209/371 (56.33%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2283
            S S+F R   +R TAGPRL               R L  SN  + +         F  WS++ VC ++ + GLG Y N  R+W+++G   ++AS++++EKEL I   LH KKL + ++ L S              K K+  ++ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +Y+ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K   +K  F    RK   E SEE + P   ++
Sbjct:  585 SESEFKRGG-VRATAGPRL------------GWSRDLHNSNSEVDA--------PFARWSREQVCEWMQEQGLGLYVNLARQWISSGHTLLQASQQDLEKELGIKLPLHRKKLQLALQALGSEE---------DDNKGKLDYHWVTR-WLDDIGLPQYKTHFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFNLLIGSEAQQLKQDWLENPDYAVLTATAKVKP--RKLGFGTFGRKKKQEDSEEYVCPMDVEM 905          
BLAST of SAM domain-containing protein vs. Ensembl Cavefish
Match: ppfibp1b (liprin-beta-1 [Source:NCBI gene;Acc:103045253])

HSP 1 Score: 227.639 bits (579), Expect = 1.607e-60
Identity = 144/371 (38.81%), Postives = 209/371 (56.33%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2283
            S S+F R   +R TAGPRL               R L  SN  + +         F  WS++ VC ++ + GLG Y N  R+W+++G   ++AS++++EKEL I   LH KKL + ++ L S              K K+  ++ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +Y+ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K   +K  F    RK   E SEE + P   ++
Sbjct:  616 SESEFKRGG-VRATAGPRL------------GWSRDLHNSNSEVDA--------PFARWSREQVCEWMQEQGLGLYVNLARQWISSGHTLLQASQQDLEKELGIKLPLHRKKLQLALQALGSEE---------DDNKGKLDYHWVTR-WLDDIGLPQYKTHFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFNLLIGSEAQQLKQDWLENPDYAVLTATAKVKP--RKLGFGTFGRKKKQEDSEEYVCPMDVEM 936          
BLAST of SAM domain-containing protein vs. Ensembl Cavefish
Match: ppfibp1b (liprin-beta-1 [Source:NCBI gene;Acc:103045253])

HSP 1 Score: 227.639 bits (579), Expect = 1.653e-60
Identity = 144/371 (38.81%), Postives = 209/371 (56.33%), Query Frame = 1
Query: 1171 SNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2283
            S S+F R   +R TAGPRL               R L  SN  + +         F  WS++ VC ++ + GLG Y N  R+W+++G   ++AS++++EKEL I   LH KKL + ++ L S              K K+  ++ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +Y+ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K   +K  F    RK   E SEE + P   ++
Sbjct:  596 SESEFKRGG-VRATAGPRL------------GWSRDLHNSNSEVDA--------PFARWSREQVCEWMQEQGLGLYVNLARQWISSGHTLLQASQQDLEKELGIKLPLHRKKLQLALQALGSEE---------DDNKGKLDYHWVTR-WLDDIGLPQYKTHFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFNLLIGSEAQQLKQDWLENPDYAVLTATAKVKP--RKLGFGTFGRKKKQEDSEEYVCPMDVEM 916          
BLAST of SAM domain-containing protein vs. Ensembl Cavefish
Match: ppfibp1a (liprin-beta-1-like [Source:NCBI gene;Acc:103022099])

HSP 1 Score: 223.402 bits (568), Expect = 1.282e-59
Identity = 152/376 (40.43%), Postives = 209/376 (55.59%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRL-----LAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKI 2283
            S+F R   +R TAGPRL     L  GN  +           L  P             F  WSK+ VC +L   GLG Y N+ ++W+ +G   + AS+ ++EKEL I + LH KKL + ++ L S    +           K+  N+ TR WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   Y+ + L RRP            SN N     N+ P EVC WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  S+A +LNIP +++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  R+ SF  F  ++RK   E SEE + P   ++
Sbjct:  494 SEFKRGG-VRATAGPRLGWSHDLQRGNNNE-----------LDTP-------------FARWSKEQVCMWLQDQGLGLYLNHAQQWIRSGQTLLNASQHDLEKELGIRHPLHRKKLQLALQALGSEEDDSMG---------KLDFNWVTR-WLDDIGLPQYKSQFDEGRVDGRMLHFMTVDDLLGLKVGSVLHHLSIKRAIQVLRINHYEPNCLRRRP------------SNEN-----NITPAEVCEWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVESMALLLNIPPSKTLLRRHLATHFHLLIGGEAQRLKQECLENPDYTLLTATAKVK-PRRLSFGGFGTLRRK-RQEDSEEYVCPMDVQM 815          
BLAST of SAM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004720.1 (pep scaffold:Pmarinus_7.0:GL477448:184654:242858:-1 gene:ENSPMAG00000004269.1 transcript:ENSPMAT00000004720.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 5.473e-54
Identity = 125/314 (39.81%), Postives = 180/314 (57.32%), Query Frame = 1
Query: 1336 FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHR---KKSFFNVIKRKTSNETSEELLVP 2268
            F  WS D VC +LH+ GLG Y    R+W+T+G   + A+  +++KEL I + LH KKL + ++ + S    +         K ++  N+ TR WLDDIGL  Y   F    +DG ML  +T++DL  LK+T+ LH LS KR IQ+LR   +  + L RRP++                   NV P EV +WT H+VMEWLR  +L EYA N+RGSG+HG L++LE RF   +LA +LNIP N++LLRRHL T F  L+G      K+ ALE  +  P+T ++K+K  +     S F  ++R+   E +E+ + P
Sbjct:  550 FAKWSTDQVCNWLHEQGLGMYVGMARQWVTSGQTMLRATAHDLDKELGIKHSLHKKKLQLALQAMGSEEENS---------KGELDYNWVTR-WLDDIGLPQYKDQFNEGRVDGRMLHYLTVDDLLSLKVTSLLHHLSYKRAIQVLRMNKFHPNCLRRRPSDEG-----------------NVTPAEVTQWTNHRVMEWLRSADLAEYAPNLRGSGVHGGLLVLEPRFTVETLALLLNIPPNKTLLRRHLATHFDLLVGPDSRRHKQEALEVPNHIPLTASAKVKPKKLPLGISGFGSLRRR-KQEDAEDYVCP 835          
BLAST of SAM domain-containing protein vs. Ensembl Sea Lamprey
Match: kazna (kazrin, periplakin interacting protein a [Source:NCBI gene;Acc:100003663])

HSP 1 Score: 124.405 bits (311), Expect = 2.190e-29
Identity = 78/274 (28.47%), Postives = 139/274 (50.73%), Query Frame = 1
Query: 1303 QSITLLPSKSDFKLWSKDHVCAFLH-QIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXX---XXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHL-KLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2109
            Q   ++P  +    W  D + A+L   + +  Y  +CR+ + +G   +  S +E+EK L +    +K  L+  +   RQ   V +   +  CL+R   ++  ++  + WL D+GL  Y  +F S  +DG +L  +  ++L+ L  +T++ H  S+   I+LLR + +D   L RR                     C V   +   WT  +VM+W+R ++L E++ ++  SG+HGAL++LE  F A  LA++L IP N + LRRHL ++   ++
Sbjct:  334 QHWCVVPQVTAMSRWKSDTILAWLELNMSMPMYGKHCRENIKSGKVLLGLSDEELEKALGVANPLHKRKLRLAIEDYRQAEQV-LVGPSRCCLSRAS-ELDHHWVAKTWLRDVGLPQYAQVFHSQLVDGRVLGSLGRKELEKLLGVTSKFHQTSILHAIELLRSVAFDREELSRR------------------RQLCEVRDVDTVVWTNQRVMQWVRNVDLKEFSEHLVSSGVHGALLVLEGSFTAEGLAAMLKIPHNNAFLRRHLASELAVIV 587          
BLAST of SAM domain-containing protein vs. Ensembl Sea Lamprey
Match: kazna (kazrin, periplakin interacting protein a [Source:NCBI gene;Acc:100003663])

HSP 1 Score: 122.094 bits (305), Expect = 8.891e-29
Identity = 76/260 (29.23%), Postives = 134/260 (51.54%), Query Frame = 1
Query: 1345 WSKDHVCAFLH-QIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXX---XXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHL-KLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2109
            W  D + A+L   + +  Y  +CR+ + +G   +  S +E+EK L +    +K  L+  +   RQ   V +   +  CL+R   ++  ++  + WL D+GL  Y  +F S  +DG +L  +  ++L+ L  +T++ H  S+   I+LLR + +D   L RR                     C V   +   WT  +VM+W+R ++L E++ ++  SG+HGAL++LE  F A  LA++L IP N + LRRHL ++   ++
Sbjct:  339 WKSDTILAWLELNMSMPMYGKHCRENIKSGKVLLGLSDEELEKALGVANPLHKRKLRLAIEDYRQAEQV-LVGPSRCCLSRAS-ELDHHWVAKTWLRDVGLPQYAQVFHSQLVDGRVLGSLGRKELEKLLGVTSKFHQTSILHAIELLRSVAFDREELSRR------------------RQLCEVRDVDTVVWTNQRVMQWVRNVDLKEFSEHLVSSGVHGALLVLEGSFTAEGLAAMLKIPHNNAFLRRHLASELAVIV 578          
BLAST of SAM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009262.1 (pep scaffold:Pmarinus_7.0:GL476523:12704:40186:1 gene:ENSPMAG00000008374.1 transcript:ENSPMAT00000009262.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 7.234e-21
Identity = 79/269 (29.37%), Postives = 131/269 (48.70%), Query Frame = 1
Query: 1336 FKLWSKDHVCAFLH-QIGLGA-YANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLK-------IAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIG 2112
            F  W    V A+L   +G+ A Y   CR  + +G      S  EI++E+ I+N LH  KL + I+++ S+   +A     T P  +       +   +    WL  +GL  Y S F    +D  MLD +T +DL+  LK+ +  H  SL+ GI  L+ ++YD   L R+  ++    Q                  +V  W+  +V+ W++ + L EYA+++  SGIHGAL+ L++ F+  SLA  L IP   +  R+ L+ ++  L+ 
Sbjct:  114 FAQWDGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTVPTFRQTLAYSDMNHEWVGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGIMCLKRLNYDRQELERKREDSQHEIQ------------------DVVVWSNERVVRWVQAVGLREYANSLIESGIHGALLALDESFDHTSLALALQIPTQNTQARQVLEREYNNLLA 364          
BLAST of SAM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009263.1 (pep scaffold:Pmarinus_7.0:GL476523:13919:40246:1 gene:ENSPMAG00000008374.1 transcript:ENSPMAT00000009263.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 1.657e-19
Identity = 81/284 (28.52%), Postives = 133/284 (46.83%), Query Frame = 1
Query: 1336 FKLWSKDHVCAFLH-QIGLGA-YANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTR-----------------PKLKIAAN-----FTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIG 2112
            F  W    V A+L   +G+ A Y   CR  + +G      S  EI++E+ I+N LH  KL + I+++ S+   +A     T                  PK  +A +     +    WL  +GL  Y S F    +D  MLD +T +DL+  LK+ +  H  SL+ GI  L+ ++YD   L R+  ++    Q                  +V  W+  +V+ W++ + L EYA+++  SGIHGAL+ L++ F+  SLA  L IP   +  R+ L+ ++  L+ 
Sbjct:   37 FAQWDGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTSTGNVWVTHEEMENMAAAPKTTLAYSDMNHEWVGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGIMCLKRLNYDRQELERKREDSQHEIQ------------------DVVVWSNERVVRWVQAVGLREYANSLIESGIHGALLALDESFDHTSLALALQIPTQNTQARQVLEREYNNLLA 302          
BLAST of SAM domain-containing protein vs. Ensembl Nematostella
Match: EDO49639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFP8])

HSP 1 Score: 188.734 bits (478), Expect = 2.589e-53
Identity = 110/316 (34.81%), Postives = 167/316 (52.85%), Query Frame = 1
Query: 1336 FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2283
            F  W    +  +L  +GLG Y + C++ +  G   + AS  E++++L I + LH KKL + ++  TS                   +N     WL+DIGL HY   F+  C+DG ML+ +TL+DLQHLK+TN LH +S++R IQ LR  ++  + L R P +                        +V  WT  +VMEWLR ++L EYA N+RGSG+HGAL+ILE RF   +LA++L+IP  ++LLRRHL + FQ L+GT     K  A  +  F+P+    K K  +K      +++K+ +   +  + P    I
Sbjct:    5 FARWPPQMIMNWLDDLGLGCYTDGCQRNIKCGEDLLRASGVELDRQLGIRHPLHRKKLQLALQAFTSDSPDVMGRL----------SNHWVLGWLEDIGLPHYKDAFSDACVDGRMLNHLTLDDLQHLKVTNALHHVSIQRAIQCLRFYNFHPNCLKRYPIDEG---------------------ADVLLWTNGRVMEWLRLVDLAEYAPNLRGSGVHGALMILEPRFTPETLAALLSIPSTKTLLRRHLASHFQSLVGTACSRTKDEAAADPGFTPLMPGVKHKVMKKSKSLGALRKKSKDSDMDNYVCPMDLDI 289          
BLAST of SAM domain-containing protein vs. Ensembl Nematostella
Match: EDO42405 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1P9])

HSP 1 Score: 106.301 bits (264), Expect = 1.981e-25
Identity = 58/176 (32.95%), Postives = 96/176 (54.55%), Query Frame = 1
Query: 1585 KIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2109
            KI   +  R W+ D+GL  Y   F S  IDG +L+ +T +D++ HL ++ + H  S+  G+ LLR I +D   LI R                   ++C+    +   WT  +VM W R I+L EYA N+R SG+HGA++++ + F  + +A+ L I  +++++RRHL ++   LI
Sbjct:   79 KIDHFWVARTWIRDLGLSQYGPAFESQMIDGRLLNVLTRKDMEKHLHISKKFHQTSILNGVDLLRLIAFDKQCLIDR------------------RLSCDETDIDPVVWTNDKVMRWCRSIDLQEYADNLRDSGVHGAMMVINETFGPDEMANCLAIHPSKNIIRRHLTSEMTALI 236          
BLAST of SAM domain-containing protein vs. Ensembl Nematostella
Match: EDO29626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T341])

HSP 1 Score: 56.9954 bits (136), Expect = 2.903e-8
Identity = 26/71 (36.62%), Postives = 46/71 (64.79%), Query Frame = 1
Query: 1954 EYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSP 2166
            EYA N+R SG+HGA++++ + F  + +A+ L I  +++++RRHL ++   LI +  V  K R   + +FSP
Sbjct:   29 EYADNLRDSGVHGAMMVINETFGPDEMANCLAIHPSKNIIRRHLTSEMTALITSARVLLKYRWF-DPEFSP 98          
BLAST of SAM domain-containing protein vs. Ensembl Medaka
Match: ppfibp1b (PPFIA binding protein 1 [Source:NCBI gene;Acc:101174664])

HSP 1 Score: 223.402 bits (568), Expect = 1.861e-59
Identity = 143/370 (38.65%), Postives = 207/370 (55.95%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKK-SFFNVIKRKTSNETSEELLVPYTYKI 2283
             +F R   +R TAGPRL               R L   N ++ +         F  WSKD VC +L + GLG Y N  R W+++G   ++AS+ ++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   ++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  +   S F  +++K  +E SEE + P   ++
Sbjct:  545 GEFKRGG-VRATAGPRL------------GWSRDLQRGNNDVDA--------PFARWSKDQVCNWLQEQGLGLYVNMARVWISSGQTLLQASQLDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEARVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNKFEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGAEAQQLKQECLENPDYTVLTATTKVKPKKLPFSNFGSLRKKKQDE-SEEYVCPMDVEM 865          
BLAST of SAM domain-containing protein vs. Ensembl Medaka
Match: ppfibp1b (PPFIA binding protein 1 [Source:NCBI gene;Acc:101174664])

HSP 1 Score: 222.631 bits (566), Expect = 3.349e-59
Identity = 143/370 (38.65%), Postives = 207/370 (55.95%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKK-SFFNVIKRKTSNETSEELLVPYTYKI 2283
             +F R   +R TAGPRL               R L   N ++ +         F  WSKD VC +L + GLG Y N  R W+++G   ++AS+ ++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   ++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  +   S F  +++K  +E SEE + P   ++
Sbjct:  556 GEFKRGG-VRATAGPRL------------GWSRDLQRGNNDVDAP--------FARWSKDQVCNWLQEQGLGLYVNMARVWISSGQTLLQASQLDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEARVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNKFEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGAEAQQLKQECLENPDYTVLTATTKVKPKKLPFSNFGSLRKKKQDE-SEEYVCPMDVEM 876          
BLAST of SAM domain-containing protein vs. Ensembl Medaka
Match: ppfibp1b (PPFIA binding protein 1 [Source:NCBI gene;Acc:101174664])

HSP 1 Score: 221.861 bits (564), Expect = 7.014e-59
Identity = 143/370 (38.65%), Postives = 207/370 (55.95%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKK-SFFNVIKRKTSNETSEELLVPYTYKI 2283
             +F R   +R TAGPRL               R L   N ++ +         F  WSKD VC +L + GLG Y N  R W+++G   ++AS+ ++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   ++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  +   S F  +++K  +E SEE + P   ++
Sbjct:  556 GEFKRGG-VRATAGPRL------------GWSRDLQRGNNDVDAP--------FARWSKDQVCNWLQEQGLGLYVNMARVWISSGQTLLQASQLDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEARVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNKFEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGAEAQQLKQECLENPDYTVLTATTKVKPKKLPFSNFGSLRKKKQDE-SEEYVCPMDVEM 876          
BLAST of SAM domain-containing protein vs. Ensembl Medaka
Match: ppfibp1b (PPFIA binding protein 1 [Source:NCBI gene;Acc:101174664])

HSP 1 Score: 221.861 bits (564), Expect = 8.123e-59
Identity = 143/370 (38.65%), Postives = 207/370 (55.95%), Query Frame = 1
Query: 1177 SQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKK-SFFNVIKRKTSNETSEELLVPYTYKI 2283
             +F R   +R TAGPRL               R L   N ++ +         F  WSKD VC +L + GLG Y N  R W+++G   ++AS+ ++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   ++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  +   S F  +++K  +E SEE + P   ++
Sbjct:  571 GEFKRGG-VRATAGPRL------------GWSRDLQRGNNDVDAP--------FARWSKDQVCNWLQEQGLGLYVNMARVWISSGQTLLQASQLDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEARVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNKFEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGAEAQQLKQECLENPDYTVLTATTKVKPKKLPFSNFGSLRKKKQDE-SEEYVCPMDVEM 891          
BLAST of SAM domain-containing protein vs. Ensembl Medaka
Match: ppfibp1a (liprin-beta-1 [Source:NCBI gene;Acc:101162257])

HSP 1 Score: 219.55 bits (558), Expect = 2.067e-58
Identity = 142/376 (37.77%), Postives = 204/376 (54.26%), Query Frame = 1
Query: 1162 AENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKI 2283
            ++  +    R   +R TAGPRL   G   +P   + +                   + F  WSK+ VCA+L + GLG Y    + W+ +G   ++AS+ E+EK+L +   LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y S F    +DG ML  +T+EDL  LK+ + LH LS+KR IQ+LR   YD   L RRP++ +                 NV P E+ +WT H+VMEWLR ++L EYA N+RGSG+HG L++LE RFN  +LA +LNIP  ++LLRRHL T F  L+G +    K+  LEN D+  +T T+K+K  R+ SF  F  + RK  ++  EE + P   ++
Sbjct:  486 SDEGDGGLFRRGGVRATAGPRL---GWSREPKHNSAE-------------------APFSRWSKEEVCAWLQEQGLGLYVAQGQNWIKSGQTLLQASQHELEKDLGVKQPLHRKKLQLALQALVSGEEDL---------KGKLDHNWVTR-WLDDIGLPQYKSGFEEARVDGRMLHFMTVEDLLSLKVGSVLHHLSIKRAIQVLRLNLYDPGCLRRRPSDES-----------------NVTPAEISQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVEALALLLNIPPGKTLLRRHLATHFHLLVGAEAQRLKQECLENPDYQVLTATAKVKP-RRLSFGGFGTL-RKKRHDDGEEYVCPMNVEM 810          
BLAST of SAM domain-containing protein vs. Planmine SMEST
Match: SMESG000054431.1 (SMESG000054431.1)

HSP 1 Score: 1521.52 bits (3938), Expect = 0.000e+0
Identity = 757/757 (100.00%), Postives = 757/757 (100.00%), Query Frame = 1
Query:  109 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 2379
            MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL
Sbjct:    1 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 757          
BLAST of SAM domain-containing protein vs. Planmine SMEST
Match: SMESG000054431.1 (SMESG000054431.1)

HSP 1 Score: 1474.14 bits (3815), Expect = 0.000e+0
Identity = 740/757 (97.75%), Postives = 740/757 (97.75%), Query Frame = 1
Query:  109 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 2379
            MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNK                 CSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL
Sbjct:    1 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKR----------------CSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 741          
BLAST of SAM domain-containing protein vs. Planmine SMEST
Match: SMESG000054431.1 (SMESG000054431.1)

HSP 1 Score: 1460.66 bits (3780), Expect = 0.000e+0
Identity = 732/757 (96.70%), Postives = 733/757 (96.83%), Query Frame = 1
Query:  109 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 2379
            MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPT+                        DFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL
Sbjct:    1 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTD------------------------DFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 733          
BLAST of SAM domain-containing protein vs. Planmine SMEST
Match: SMESG000010456.1 (SMESG000010456.1)

HSP 1 Score: 1085.48 bits (2806), Expect = 0.000e+0
Identity = 559/563 (99.29%), Postives = 559/563 (99.29%), Query Frame = 3
Query: 2724 ADTINRYIGSLFKDLNQKRKSRNAEFPPHPLQSEDSAQRVIGPINSESDVVHVRIPSNIYDDLDTRLRRISTPHIDELVSEKHYVRRLSLCMPSPNSEEQGLSQGPSNLHSSLEKKSNNSNCIVLPVENKPLLRKKSDYKPNKISAVIERLSFRASRDLSTDLLKSGSPVVALKEQLESFDRYGDKSAACPIKDVRNSNFNSITNFQPRKRFPLANDATNNLKTSALSRKNSAPIPLEQVASSDVNIDEEQPPVPPVRINSLRNPVLTRPTVLMDESPLVRYRGDSSAPCNNLIMVNDQDDHLSSITTPSSCGDNNNQIDFPVEDPRPPVSIDMLNKTGKSVRGQXXXXXXXXXXXGKIXXXXXXXXXXXXQYRPPSNQYDNFSTKSQINQYFRNITKDETDEYLIKRELGSFILRNSASHHDCFALSVKTSDVNVSHYIIQSSSLGFQIKGLDKIWPSLYSLITHLSVIPEMLPCTLSMHQIGPERKPSNPAALPDAHTDHSQSQAGPNPLKKQSLPQSKSANEEYQLRMRQFLNDSSSMPAQEQYQQLSDFSSMIASFDVN 4412
            ADTINRYIGSLFKDLNQKRKSRNAEFPPHPL SEDSAQRVIGPINSESDVVHVRIPSNIYDDLDTRLRRISTPHIDELVSEKHYVRRLSLCMPSPNSEEQGLSQGPSNLHSSLEKKSNNSNCIVLPVENKPLLRKKSDYKPNKISAVIERLSFRASRDLSTDLLKSGSPVVALKEQLESFDRYGDKSAACPIKDVRNSNFNSITNFQPRKRFPLANDATNNLKTSALSRKNSAPIPLEQVASSDVNIDEEQPPVPPVRINSLRNPVLTRPTVLMDESPLVRYRGDSS PCNNLIM NDQDDHLSSITTPSSCGDNNNQIDFPVED RPPVSIDMLNKTGKSVRGQTAAAAVTAASTGKINNASTSFSNNNNQYRPPSNQYDNFSTKSQINQYFRNITKDETDEYLIKRELGSFILRNSASHHDCFALSVKTSDVNVSHYIIQSSSLGFQIKGLDKIWPSLYSLITHLSVIPEMLPCTLSMHQIGPERKPSNPAALPDAHTDHSQSQAGPNPLKKQSLPQSKSANEEYQLRMRQFLNDSSSMPAQEQYQQLSDFSSMIASFDVN
Sbjct:  118 ADTINRYIGSLFKDLNQKRKSRNAEFPPHPLPSEDSAQRVIGPINSESDVVHVRIPSNIYDDLDTRLRRISTPHIDELVSEKHYVRRLSLCMPSPNSEEQGLSQGPSNLHSSLEKKSNNSNCIVLPVENKPLLRKKSDYKPNKISAVIERLSFRASRDLSTDLLKSGSPVVALKEQLESFDRYGDKSAACPIKDVRNSNFNSITNFQPRKRFPLANDATNNLKTSALSRKNSAPIPLEQVASSDVNIDEEQPPVPPVRINSLRNPVLTRPTVLMDESPLVRYRGDSSVPCNNLIMANDQDDHLSSITTPSSCGDNNNQIDFPVEDLRPPVSIDMLNKTGKSVRGQTAAAAVTAASTGKINNASTSFSNNNNQYRPPSNQYDNFSTKSQINQYFRNITKDETDEYLIKRELGSFILRNSASHHDCFALSVKTSDVNVSHYIIQSSSLGFQIKGLDKIWPSLYSLITHLSVIPEMLPCTLSMHQIGPERKPSNPAALPDAHTDHSQSQAGPNPLKKQSLPQSKSANEEYQLRMRQFLNDSSSMPAQEQYQQLSDFSSMIASFDVN 680          
BLAST of SAM domain-containing protein vs. Planmine SMEST
Match: SMESG000001529.1 (SMESG000001529.1)

HSP 1 Score: 101.679 bits (252), Expect = 1.411e-21
Identity = 64/164 (39.02%), Postives = 91/164 (55.49%), Query Frame = 3
Query: 3930 EYLIKRELGSFILRNSASHHDCFALSVKTSD----VNVSHYIIQSSSLGFQIKGLDKIWPSLYSLITHLSVIPEMLPCTLSMH-QIGPERKPSNPAALP-DAHTDHSQSQAGPNPLKKQSLPQSKSANEEYQLRMRQFLNDSSSMPAQEQYQQLSDFSSMIASF 4403
            + L + E+GSF++R+S+SH  C+ALSVK         V H++IQ +S GF++KGL+K WP++ SL+THL+V+PEMLPCTL +  Q       SNPA  P DA      S  G N    Q+       ++E  +                 YQ+LSDFSS++A  
Sbjct:  459 DLLTQGEIGSFVVRDSSSHSGCYALSVKVCKSDNPTGVIHFLIQRTSTGFKLKGLEKEWPTMKSLVTHLTVMPEMLPCTLVLFTQKRHTTTTSNPAFCPIDA---PKLSSLGSNICDTQN-------DDEEDI----------------DYQRLSDFSSIMADL 596          
The following BLAST results are available for this feature:
BLAST of SAM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPFIBP11.923e-5939.95PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
PPFIBP13.180e-5939.95PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
PPFIBP18.472e-5939.95PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
PPFIBP19.659e-5939.95PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
PPFIBP12.152e-5840.29PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hlb-13.747e-3931.64Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-15.625e-3931.64Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-19.896e-3931.64Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-19.896e-3931.64Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-11.180e-3831.64Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Liprin-beta9.120e-5135.60gene:FBgn0036376 transcript:FBtr0075814[more]
Liprin-beta9.120e-5135.60gene:FBgn0036376 transcript:FBtr0075813[more]
Liprin-beta9.120e-5135.60gene:FBgn0036376 transcript:FBtr0330342[more]
Liprin-gamma9.561e-2636.14gene:FBgn0034720 transcript:FBtr0342990[more]
Liprin-gamma1.175e-2536.14gene:FBgn0034720 transcript:FBtr0113106[more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppfibp1a1.074e-6240.54PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
ppfibp1a1.397e-6241.10PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
ppfibp1a1.451e-6241.10PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
ppfibp1a1.543e-6240.54PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
ppfibp1a9.632e-6240.78PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPFIBP12.003e-5538.87PTPRF interacting protein, binding protein 1 (lipr... [more]
PPFIBP12.040e-5538.87PTPRF interacting protein, binding protein 1 (lipr... [more]
PPFIBP12.415e-5538.87PTPRF interacting protein, binding protein 1 (lipr... [more]
PPFIBP12.644e-5538.87PTPRF interacting protein, binding protein 1 (lipr... [more]
PPFIBP12.972e-5538.58PTPRF interacting protein, binding protein 1 (lipr... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppfibp15.214e-5838.96PTPRF interacting protein, binding protein 1 (lipr... [more]
Ppfibp15.440e-5838.96PTPRF interacting protein, binding protein 1 (lipr... [more]
Ppfibp21.793e-5134.89PTPRF interacting protein, binding protein 2 (lipr... [more]
Ppfibp22.173e-5134.89PTPRF interacting protein, binding protein 2 (lipr... [more]
Kazn1.107e-2434.15kazrin, periplakin interacting protein [Source:MGI... [more]
back to top
BLAST of SAM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86W92|LIPB1_HUMAN4.639e-5839.95Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 P... [more]
sp|Q8C8U0|LIPB1_MOUSE3.647e-5738.96Liprin-beta-1 OS=Mus musculus OX=10090 GN=Ppfibp1 ... [more]
sp|O35711|LIPB2_MOUSE1.493e-5034.89Liprin-beta-2 OS=Mus musculus OX=10090 GN=Ppfibp2 ... [more]
sp|Q8ND30|LIPB2_HUMAN1.443e-4935.33Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 P... [more]
sp|Q94071|LIPB_CAEEL3.978e-3731.64Liprin-beta homolog OS=Caenorhabditis elegans OX=6... [more]
back to top
BLAST of SAM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I4AZL73.524e-6140.00liprin-beta-1 OS=Austrofundulus limnaeus OX=52670 ... [more]
A0A1A7YVJ33.238e-6039.19PTPRF interacting protein, binding protein 1 (Lipr... [more]
A0A3Q4GXP05.983e-6040.33PPFIA binding protein 1a OS=Neolamprologus brichar... [more]
G3W5N51.741e-5939.51Uncharacterized protein OS=Sarcophilus harrisii OX... [more]
H0WFE92.402e-5940.54PPFIA-binding protein 1a OS=Danio rerio OX=7955 GN... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppfibp1b1.184e-6038.81liprin-beta-1 [Source:NCBI gene;Acc:103045253][more]
ppfibp1b1.273e-6038.81liprin-beta-1 [Source:NCBI gene;Acc:103045253][more]
ppfibp1b1.607e-6038.81liprin-beta-1 [Source:NCBI gene;Acc:103045253][more]
ppfibp1b1.653e-6038.81liprin-beta-1 [Source:NCBI gene;Acc:103045253][more]
ppfibp1a1.282e-5940.43liprin-beta-1-like [Source:NCBI gene;Acc:103022099... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004720.15.473e-5439.81pep scaffold:Pmarinus_7.0:GL477448:184654:242858:-... [more]
kazna2.190e-2928.47kazrin, periplakin interacting protein a [Source:N... [more]
kazna8.891e-2929.23kazrin, periplakin interacting protein a [Source:N... [more]
ENSPMAT00000009262.17.234e-2129.37pep scaffold:Pmarinus_7.0:GL476523:12704:40186:1 g... [more]
ENSPMAT00000009263.11.657e-1928.52pep scaffold:Pmarinus_7.0:GL476523:13919:40246:1 g... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO496392.589e-5334.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424051.981e-2532.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296262.903e-836.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SAM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppfibp1b1.861e-5938.65PPFIA binding protein 1 [Source:NCBI gene;Acc:1011... [more]
ppfibp1b3.349e-5938.65PPFIA binding protein 1 [Source:NCBI gene;Acc:1011... [more]
ppfibp1b7.014e-5938.65PPFIA binding protein 1 [Source:NCBI gene;Acc:1011... [more]
ppfibp1b8.123e-5938.65PPFIA binding protein 1 [Source:NCBI gene;Acc:1011... [more]
ppfibp1a2.067e-5837.77liprin-beta-1 [Source:NCBI gene;Acc:101162257][more]
back to top
BLAST of SAM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054431.10.000e+0100.00SMESG000054431.1[more]
SMESG000054431.10.000e+097.75SMESG000054431.1[more]
SMESG000054431.10.000e+096.70SMESG000054431.1[more]
SMESG000010456.10.000e+099.29SMESG000010456.1[more]
SMESG000001529.11.411e-2139.02SMESG000001529.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013260 ID=SMED30013260|Name=SAM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4478bp
AATCGCCATAATTTAATCTATATATTAATTCTAAAATTAATTTCCTTAAA
ATTTGCTAAATTTTGTAATTTTATGAATGATATATTTTGAAAATTAGAAT
TTTCAGAAATGAGTGTTAATTATAATGGTTATAATAATAATTCTGCTAGC
AAACTTTTGGAATCAGTTTTAGAGGACATGAATAATATTATTAAAGCAAA
TGATCATTCTGGTAATTCGGAAAATATCTGTCCATTGACTACTAAATACG
TAGATTATACTGATTTTAGTAATGGTAATAATAATTGCTCGGAAATTTCC
CATGATCAAAAGTTTGAGTTGATGGTATCTGAATTACAAAACTGCTTACA
AGAAGCAGTAGACGTTCGTAGTATGATGAGAAATTTATCTAGTGATAAAA
AAGAATTTTTAAAAGCTCTTTTAAAAACTGATCTTGAAAACAACATTAAT
ATATCACATAAAGTTGATTTAATGGATGAAATATCTAAACTAAAGTTGGA
TATTGCCTATTTACAACGAGACAAACAAGGCTTATTGAATCAAATTAATG
ACTTAAATTCTAAAGTACAGCTTTTGAATGATGAAAATGTCAGATTGCGA
AAAGAAATGAATTTAATGAAAGTTGATGAAATGGATTATTGTTTTCCTCC
AAACGAATTAGGTGATAATTGTTCAATTGGAGAAAGTCACCAATCAAAAG
ATTCAGCGTTGTCTGGTGCATTGAGAAATGAGAGCCCATTAGCAACAAGT
ACACCAGAAAAACCAAAATCAGCCACCAAAGTCCCAGTGGTTCCACCTCA
CAGAATTCAAATAAATCAACGCCAGTTACCGCATGATTTTCTTAATAAAA
TCAGCCCACCTGGTCACATTAGAGAGTCTACTGGTAAATCTAACAGTTGG
AGTGAATTGCGGACTAATCAGGTTATTCACGATGATCAAGTACCGATGAT
GACACCTCCATCTCAAAGAAAAAGTTCTATGAATTTCATTACGAACAGAA
TATCCAGTGATAGCAAGAAAAAGACAAAACTTTTCAGCAATAAAAGTTTG
GGCCTATTACCTTGTGAATATGATGCCAATTTTGATTTATCAATATGCTC
CCAACCCGTGAGTTCAAATATCAATGCTCTTGCCCTGCTAGCTGTGACAG
ATAAATTGGCCGCTGAAAATTCTAATAGTCAATTTAACAGAAACAATCCA
TTGCGAATGACAGCTGGGCCAAGATTGCTAGCTGGTGGTAATAAACTTAA
ACCTACAGAAGTTGCAGTTCAAAGAGTTCTATCATTGTCTAATCCAAATC
TTCAGTCAATCACTTTGCTACCGTCAAAGAGTGATTTCAAGCTATGGTCA
AAAGATCACGTTTGTGCATTTTTACATCAAATTGGACTAGGTGCGTACGC
AAATAATTGTCGAAAATGGCTCACAAATGGATTGCAATTTATTGAAGCAT
CAAAAAAAGAAATTGAGAAGGAACTCAACATCACCAATAAATTACATTTG
AAAAAGCTGTTGATACATATTCGACAACTGACATCTGTACACGTTACAGC
TGCCACTTATTTTTGTTTGACTCGGCCCAAATTGAAAATTGCAGCAAATT
TCACTACTCGTTTGTGGCTAGATGATATTGGGTTGCTTCATTACATGAGT
TTGTTTGCTTCTAACTGTATCGATGGCTACATGCTAGACCAGATTACATT
GGAAGATTTGCAGCATTTAAAATTAACCAACGAACTTCATGTTCTCAGTT
TAAAAAGAGGAATTCAATTATTAAGAGAAATCGATTACGATTTGTCACTT
CTAATCAGACGACCAGCAGAAAACACATTCAATACTCAATCGGAAACTGG
TAGCAACACTAACTTAGAAGTAACGTGCAATGTGCACCCTGGTGAGGTGT
GTAGATGGACTCAACACCAAGTTATGGAATGGCTAAGGCGGATTGAACTT
CCAGAATATGCTTCTAATATCCGTGGAAGTGGTATTCACGGTGCTCTTAT
TATCCTTGAAGATAGATTTAATGCCAATTCATTAGCATCGGTTTTAAATA
TTCCCCAGAATCGTTCACTCTTACGTCGACATCTTCAAACAAAATTCCAA
GAGTTAATCGGAACGAAAATCGTCGCACAAAAGAAAAGAGCATTAGAAAA
TTCCGATTTCAGTCCCGTAACAATCACATCTAAAATGAAGTATCACAGAA
AAAAAAGCTTTTTCAATGTTATCAAACGTAAAACCAGCAATGAAACGTCT
GAAGAACTTCTAGTCCCGTATACATATAAAATTGAAGATTTAGATCTTAA
ATTGAATCAGGAAACATCTTCAGTTGATAATAATAATGCTGAATCTTCAT
CAACAAGTAATCTGCCTCAAACAAATTTATAATTTCTATTTGAATTTCTT
GCTCATTGTTTGTGATTGTACTGGTGTTCGTCATCTTATTTATATACCAT
TGTGTTTATTTTATTCATATTAATAGCTCAACTTTTCTATGTTGGATTTA
TTTATTTTCTGTGCATATATATATATATATATATATACACATGGACTTGC
ACTGTCACCATAGCTTGCCAATATAGAATGCCGTGTGATCCAAATGCCAT
GCATATTATTTCTGTATTACCGTCCTGATTGGAGCTATTAAAGACCCCCA
CAACCAGTGATGCCCGATTGAACCGACATTTAAACAATTTAAAACCCATC
AGTATTAAGCCAGTAATTGATAGGCTGACACCATCAATCGCTACATTGGA
TCGCTGTTTAAAGATTTGAATCAAAAGCGCAAAAGTAGGAATGCAGAATT
CCCACCTCATCCATTACAAAGTGAAGATTCAGCTCAGAGAGTAATTGGTC
CAATAAATTCTGAATCCGATGTTGTCCATGTACGGATTCCTAGTAATATC
TATGATGATCTGGATACTAGATTAAGGCGGATTTCCACACCACATATTGA
CGAGCTGGTCTCGGAAAAGCATTATGTGCGCCGGCTCTCCTTGTGCATGC
CAAGTCCCAATAGTGAAGAACAAGGACTATCTCAAGGTCCATCGAATCTC
CATTCTTCACTGGAAAAGAAATCCAACAACTCAAATTGTATAGTTCTCCC
CGTGGAAAATAAACCTCTGCTCCGCAAGAAGTCCGATTATAAGCCAAACA
AGATATCTGCCGTTATAGAACGGTTATCATTTCGGGCCAGCAGAGATCTT
TCAACCGACTTGCTCAAATCCGGATCTCCTGTCGTTGCGTTGAAGGAGCA
ATTGGAATCATTCGACCGATACGGAGACAAAAGTGCTGCATGTCCCATAA
AGGATGTCCGCAATTCAAATTTCAACTCCATCACAAATTTCCAACCGAGG
AAGCGATTTCCCCTGGCAAATGATGCAACAAACAACCTGAAAACGAGCGC
TTTATCCCGGAAAAACAGCGCGCCAATACCTCTTGAACAGGTTGCCAGTA
GTGATGTTAATATTGACGAGGAACAGCCGCCAGTTCCGCCAGTGAGGATC
AATTCGTTGCGCAATCCCGTTCTCACAAGGCCAACTGTGCTCATGGACGA
GAGCCCCTTGGTGCGCTATCGGGGCGATAGCTCAGCTCCTTGCAACAATC
TCATAATGGTCAATGATCAAGATGATCACCTCTCATCTATCACAACTCCC
TCATCTTGCGGTGACAACAACAATCAGATCGATTTCCCTGTAGAGGACCC
GAGGCCGCCTGTCAGCATTGATATGCTCAATAAAACCGGAAAGTCAGTAC
GAGGGCAGACGGCAGCAGCAGCGGTGACAGCCGCCAGCACTGGCAAGATA
AATAATGCCAGCACATCATTCAGCAACAACAATAATCAATACCGCCCACC
ATCCAATCAATACGACAATTTCAGCACCAAATCACAGATAAATCAATACT
TCAGAAACATCACCAAAGACGAAACCGATGAATATTTGATCAAGCGAGAA
CTTGGCAGTTTTATCCTCCGCAACAGCGCCTCCCACCATGATTGCTTTGC
TCTCTCGGTGAAAACGTCAGATGTCAATGTCAGCCATTATATTATCCAGT
CTTCCTCCCTAGGATTCCAGATCAAAGGGCTGGACAAAATTTGGCCCAGT
CTATATTCCCTCATCACGCATTTGTCTGTCATTCCAGAAATGCTACCTTG
CACGCTCTCCATGCACCAAATCGGCCCAGAGAGGAAACCCTCGAACCCTG
CAGCGCTTCCAGATGCACATACCGACCATAGCCAATCACAAGCAGGCCCC
AATCCACTGAAGAAACAATCTCTGCCGCAATCAAAATCTGCCAACGAGGA
GTACCAGTTGCGCATGAGACAGTTCCTCAATGACTCCTCCTCGATGCCGG
CCCAGGAGCAATACCAGCAGTTATCAGATTTCTCATCGATGATTGCGAGT
TTCGATGTCAATTGATCTTGATTATTATTATTATAATTATTGATCGTTCG
CAACCTGTGATAGTGCTCATTGATTACA
back to top

protein sequence of SMED30013260-orf-1

>SMED30013260-orf-1 ID=SMED30013260-orf-1|Name=SMED30013260-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=758bp
MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDY
TDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEF
LKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLN
SKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSA
LSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISP
PGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISS
DSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKL
AAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQS
ITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKK
EIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTT
RLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKR
GIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRW
TQHQVMEWLRRIELPEYASNIRGSGIHGALIILEDRFNANSLASVLNIPQ
NRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKS
FFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTS
NLPQTNL*
back to top

protein sequence of SMED30013260-orf-2

>SMED30013260-orf-2 ID=SMED30013260-orf-2|Name=SMED30013260-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
VINEHYHRLRTINNYNNNNQDQLTSKLAIIDEKSDNCWYCSWAGIEEESL
RNCLMRNWYSSLADFDCGRDCFFSGLGPACDWLWSVCASGSAAGFEGFLS
GPIWCMESVQGSISGMTDKCVMREYRLGQILSSPLIWNPREEDWII*
back to top

protein sequence of SMED30013260-orf-3

>SMED30013260-orf-3 ID=SMED30013260-orf-3|Name=SMED30013260-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=473bp
MPSPNSEEQGLSQGPSNLHSSLEKKSNNSNCIVLPVENKPLLRKKSDYKP
NKISAVIERLSFRASRDLSTDLLKSGSPVVALKEQLESFDRYGDKSAACP
IKDVRNSNFNSITNFQPRKRFPLANDATNNLKTSALSRKNSAPIPLEQVA
SSDVNIDEEQPPVPPVRINSLRNPVLTRPTVLMDESPLVRYRGDSSAPCN
NLIMVNDQDDHLSSITTPSSCGDNNNQIDFPVEDPRPPVSIDMLNKTGKS
VRGQTAAAAVTAASTGKINNASTSFSNNNNQYRPPSNQYDNFSTKSQINQ
YFRNITKDETDEYLIKRELGSFILRNSASHHDCFALSVKTSDVNVSHYII
QSSSLGFQIKGLDKIWPSLYSLITHLSVIPEMLPCTLSMHQIGPERKPSN
PAALPDAHTDHSQSQAGPNPLKKQSLPQSKSANEEYQLRMRQFLNDSSSM
PAQEQYQQLSDFSSMIASFDVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007528neuromuscular junction development
GO:0007155cell adhesion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029515Liprin
IPR030444Liprin-beta
IPR001660SAM
IPR013761SAM/pointed_sf
IPR000980SH2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0045296cadherin binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005925focal adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 132..173
NoneNo IPR availableCOILSCoilCoilcoord: 442..462
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 736..757
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 192..220
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 192..227
IPR001660Sterile alpha motif domainSMARTSM00454SAM_4coord: 410..477
e-value: 1.0E-7
score: 41.6
coord: 492..558
e-value: 1.5E-7
score: 41.1
coord: 597..669
e-value: 4.7E-6
score: 36.1
IPR001660Sterile alpha motif domainPFAMPF00536SAM_1coord: 413..474
e-value: 1.3E-10
score: 41.5
coord: 499..555
e-value: 1.2E-9
score: 38.4
IPR001660Sterile alpha motif domainPFAMPF07647SAM_2coord: 600..667
e-value: 3.0E-12
score: 46.4
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 503..558
score: 11.782
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 413..477
score: 10.696
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 387..493
e-value: 1.9E-20
score: 75.2
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 496..570
e-value: 1.5E-18
score: 68.9
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 590..686
e-value: 5.7E-33
score: 114.8
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 408..478
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 502..562
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 592..638
IPR029515LAR-interacting protein, LiprinPANTHERPTHR12587LAR INTERACTING PROTEIN LIP -RELATED PROTEINcoord: 73..717
IPR030444Liprin-betaPANTHERPTHR12587:SF14AT31531Pcoord: 73..717