Tektin-2

Overview
NameTektin-2
Smed IDSMED30013257
Length (bp)3025
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tektin-2 (SMED30013257) t-SNE clustered cells

Violin plots show distribution of expression levels for Tektin-2 (SMED30013257) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tektin-2 (SMED30013257) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tektin-2 (SMED30013257) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013257

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 SmedASXL_016035SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 dd_Smed_v4_2694_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 dd_Smed_v4_2694_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 dd_Smed_v4_2694_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 dd_Smed_v4_2694_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 dd_Smed_v4_2694_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30013257SMESG000026445.1 SMESG000026429.1 dd_Smed_v6_571_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 dd_Smed_v6_2694_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 dd_Smed_v6_2694_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 Contig44306newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 Contig44306uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30013257SMESG000026446.1 SMESG000026445.1 SMESG000026429.1 dd_Smed_v4_2694_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 282.722 bits (722), Expect = 4.610e-85
Identity = 170/404 (42.08%), Postives = 252/404 (62.38%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTR 2737
            MAT S +P + +   +W +++Y LS N++ +RD S + RQ  R  R ET+ +T  D+ D+ TRL +RID + RW+E+LDK  T+LD EI AL++ KE  E  L+ KN+  D+  EC+  R+ RR I+ V D  + EL  E  +I   KK LQ K+  AFEQLC +QE +++   D + K   LEID    ++N +S +IS K +PTR P  ST  Q+W+DFSR++ +RA+ EM      RE    T  + ++ L+ Q   TE+A RKR+ E+E+  +EL++Q+K T +E  EL +DI+ LEE  R K+ S KL+ TRLE R  RP +E CRD AQ GL DEV QL  +   L+++LA A++ALD + K LA +  ++  K +++L+D   +D R +L +VP  R
Sbjct:    1 MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKL-TVPAER 403          
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 127.102 bits (318), Expect = 4.041e-30
Identity = 101/379 (26.65%), Postives = 187/379 (49.34%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETD--LKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK 2689
            Y P +W+       + S   R  SEK R     +R+  D   +T+  Q D+   L +R++ I  W+  +      +  E  AL++ K+ +E  L +      +  EC+ +R+ R GI+ V+D+ + +L  E + I  C++ ++  +D A  QL   + ++ E   DL DK TA  ID   +++   S  + Y     R     + P+ W  F+  +I R+++E     + R+D+        + + +Q  +   +   RI E   A N+++     T +E  +    I+++++A + K    K+ QTRL+ R  RP +E CRD AQ  LV+EV ++ D+ +TL++RL +A + L  +    A +  +L  K ++L +D+
Sbjct:   94 YTPDDWYRSNLTNYQESNTSRHNSEKLR--VDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQ 470          
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 127.102 bits (318), Expect = 4.041e-30
Identity = 101/379 (26.65%), Postives = 187/379 (49.34%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETD--LKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK 2689
            Y P +W+       + S   R  SEK R     +R+  D   +T+  Q D+   L +R++ I  W+  +      +  E  AL++ K+ +E  L +      +  EC+ +R+ R GI+ V+D+ + +L  E + I  C++ ++  +D A  QL   + ++ E   DL DK TA  ID   +++   S  + Y     R     + P+ W  F+  +I R+++E     + R+D+        + + +Q  +   +   RI E   A N+++     T +E  +    I+++++A + K    K+ QTRL+ R  RP +E CRD AQ  LV+EV ++ D+ +TL++RL +A + L  +    A +  +L  K ++L +D+
Sbjct:   94 YTPDDWYRSNLTNYQESNTSRHNSEKLR--VDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQ 470          
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT1 (tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534])

HSP 1 Score: 117.857 bits (294), Expect = 1.885e-27
Identity = 117/416 (28.12%), Postives = 195/416 (46.88%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDI--SEKARQLGRATRI--ETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTE-----MVKG------QRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPM 2731
            MA   +P  ++ P EW    +  +KN   + D   S   R +  + R+  E +  T+  Q D N +L  R++ ++ W++ LD     L      L   K  +E  LE       I   C+  R+ R GI+ V+D  + EL  E  +I     LL   +++A EQ+   + A+     DL+DK  AL ID   +++N  S +I Y  N  R    S   ++W DFS  ++ +A  +     M+K        +T  DL      VD    +  + T+ A  K    L + + E+  Q+K           +I ALE+A   +   AK+  TRLE R  RP +E CRD AQ  L+ EV ++  +   L+E LA A+  L G+ ++   + + +  K++ + +D++ L  ++R KS+P+
Sbjct:    1 MAKLLQPPPKFLPSEW----HIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWKKELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKEAEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIASQEK-----------NITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEV-LCMQMR-KSIPL 399          
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT4 (tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012])

HSP 1 Score: 105.531 bits (262), Expect = 3.511e-23
Identity = 104/400 (26.00%), Postives = 174/400 (43.50%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKM-SLDYRLRLKSV 2725
            +AT S    +Y   EWF + Y     +   RD SE+ R   +    ET    +  Q DS   + +R+     W+  L +    L  E   L   K+ +E  L+   +   I  + +  R+ R     V D  + EL  E  LI   ++LL+  I  A  Q+   +E +E    D  DK  A  ID T    + +S+ +   P  T   + ++ P+    F++ ++ RA+ E +     R  +        + L  Q      A  +R  ELE A  +L +    T +E  +   ++ AL++A + K     + QTRL  R  RP ME CRDAAQ  L+ EV +L  S   L E+L  A  +L  ++     +  ++    ++L +D+   + +R R  ++
Sbjct:   29 LATASFRTSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYPTI 428          
BLAST of Tektin-2 vs. Ensembl Fly
Match: CG3085 (gene:FBgn0034816 transcript:FBtr0310344)

HSP 1 Score: 187.578 bits (475), Expect = 2.866e-51
Identity = 121/401 (30.17%), Postives = 221/401 (55.11%), Query Frame = 2
Query: 1520 YLRMATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKS 2722
            +  + T  +P++  +  +W++   ++   ++ +R  +   R   R+ R ET ++      ++N  L+DRI  + RWR+++ K+   +++EI  L E K   E +LE       ++ EC+  RD R G E   D+   E++NE  ++   ++LL  +   A+E+L R++E R +   +++ K  A+++D +Q  ++  S++ISYKP+PTR PK S   + W +  +     A+ E+      RE L     K  +ML  Q +R E+ +RKRI E ++A NELE+Q+   ++E E+ + +I+  E A R K  + KL +TRLENR +R  ME C D A + L  EV +L + +  L+ ++  ++     +++    I+ +L  K+H+L+ D  +LD R+RL+ 
Sbjct:    3 FRSVVTMEKPLQHISLTDWYARVNQMRNVADARRSDAFAIRHSSRSLRNETRIEGDWANYETNEALTDRISELNRWRDIISKSFEKIEREIFMLQEEKNATERELEALAGPISVIAECLTIRDGRLGSEITYDEADTEIKNELVVLENNQRLLADRCQKAWEKLNRLEEVRFKIGLEIEFKVEAVQLDNSQLALDRNSANISYKPDPTRNPKNSCSYESWLENVKNIKLLAENELADTYAIREALFVCREKARNMLQSQQERAEHTIRKRIFETQRARNELEWQQLKMKEEMEKAMCEIRTSENALRDKTDALKLAETRLENRAQRSGMELCMDQAHDMLCLEVEKLREIRRRLQVKIDESKTNFSLLEEHGKRIDVDLENKQHSLMTDIRALDLRMRLRG 403          
BLAST of Tektin-2 vs. Ensembl Fly
Match: CG3085 (gene:FBgn0034816 transcript:FBtr0071963)

HSP 1 Score: 187.578 bits (475), Expect = 2.866e-51
Identity = 121/401 (30.17%), Postives = 221/401 (55.11%), Query Frame = 2
Query: 1520 YLRMATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKS 2722
            +  + T  +P++  +  +W++   ++   ++ +R  +   R   R+ R ET ++      ++N  L+DRI  + RWR+++ K+   +++EI  L E K   E +LE       ++ EC+  RD R G E   D+   E++NE  ++   ++LL  +   A+E+L R++E R +   +++ K  A+++D +Q  ++  S++ISYKP+PTR PK S   + W +  +     A+ E+      RE L     K  +ML  Q +R E+ +RKRI E ++A NELE+Q+   ++E E+ + +I+  E A R K  + KL +TRLENR +R  ME C D A + L  EV +L + +  L+ ++  ++     +++    I+ +L  K+H+L+ D  +LD R+RL+ 
Sbjct:    3 FRSVVTMEKPLQHISLTDWYARVNQMRNVADARRSDAFAIRHSSRSLRNETRIEGDWANYETNEALTDRISELNRWRDIISKSFEKIEREIFMLQEEKNATERELEALAGPISVIAECLTIRDGRLGSEITYDEADTEIKNELVVLENNQRLLADRCQKAWEKLNRLEEVRFKIGLEIEFKVEAVQLDNSQLALDRNSANISYKPDPTRNPKNSCSYESWLENVKNIKLLAENELADTYAIREALFVCREKARNMLQSQQERAEHTIRKRIFETQRARNELEWQQLKMKEEMEKAMCEIRTSENALRDKTDALKLAETRLENRAQRSGMELCMDQAHDMLCLEVEKLREIRRRLQVKIDESKTNFSLLEEHGKRIDVDLENKQHSLMTDIRALDLRMRLRG 403          
BLAST of Tektin-2 vs. Ensembl Fly
Match: Tektin-A (gene:FBgn0028902 transcript:FBtr0080788)

HSP 1 Score: 115.546 bits (288), Expect = 2.760e-26
Identity = 101/391 (25.83%), Postives = 169/391 (43.22%), Query Frame = 2
Query: 1535 TESRPVKE------YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK 2689
            T +RPV +      Y+P EW +  +E  +        ++K R       +         Q ++  +L  R  +I +W+  L+     +  EI  +   + ++   +    + E I  ECI  R  R   E V D  + EL NE  LIAE ++LL   +DD   Q    + AR+    D  DK  + EID     +N  S  I ++P   R+P      + WE FS  +++  +   +K    R  L+ T       +  Q+   E AL  RI+  ++AV   E   K   +   ++ + I+ ++    +   S K+ QTR++NR  RP +E CRD AQ+ L+D V  +  S   L   L  A      +    A +   +  K+ +L +D+
Sbjct:  173 TGTRPVVDRYSITRYSPNEWRTRNHETVQVVNASLGRADKNRFSSTTEFLRLSALVDKSQKETTDKLRIRSQLIGKWKNTLENAIKAMADEISTMEVERIKLRKSMVVLGVPESIAKECIEKRATRPDTELVRDQVEEELVNELALIAEIRRLLMKTLDDFNSQQVENRTARQRLEYDWSDKKESYEIDTINTGLNNCSRTIMFRPGAVRQPPEQASEKYWEHFSMETLDECEKCRLKSVALRNTLNSTLMNAARDIRTQADVVEKALTSRINCTQEAVQRFENDLKNILQGTADVENRIEQMKRRINSFDSSMKVAQTRMDNRSYRPNVENCRDLAQQELIDGVHTIQSSVSALLHELEEAERVKTDLVNSRARLEREIMLKRRSLFIDR 563          
BLAST of Tektin-2 vs. Ensembl Fly
Match: Tektin-A (gene:FBgn0028902 transcript:FBtr0331277)

HSP 1 Score: 115.546 bits (288), Expect = 2.760e-26
Identity = 101/391 (25.83%), Postives = 169/391 (43.22%), Query Frame = 2
Query: 1535 TESRPVKE------YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK 2689
            T +RPV +      Y+P EW +  +E  +        ++K R       +         Q ++  +L  R  +I +W+  L+     +  EI  +   + ++   +    + E I  ECI  R  R   E V D  + EL NE  LIAE ++LL   +DD   Q    + AR+    D  DK  + EID     +N  S  I ++P   R+P      + WE FS  +++  +   +K    R  L+ T       +  Q+   E AL  RI+  ++AV   E   K   +   ++ + I+ ++    +   S K+ QTR++NR  RP +E CRD AQ+ L+D V  +  S   L   L  A      +    A +   +  K+ +L +D+
Sbjct:  173 TGTRPVVDRYSITRYSPNEWRTRNHETVQVVNASLGRADKNRFSSTTEFLRLSALVDKSQKETTDKLRIRSQLIGKWKNTLENAIKAMADEISTMEVERIKLRKSMVVLGVPESIAKECIEKRATRPDTELVRDQVEEELVNELALIAEIRRLLMKTLDDFNSQQVENRTARQRLEYDWSDKKESYEIDTINTGLNNCSRTIMFRPGAVRQPPEQASEKYWEHFSMETLDECEKCRLKSVALRNTLNSTLMNAARDIRTQADVVEKALTSRINCTQEAVQRFENDLKNILQGTADVENRIEQMKRRINSFDSSMKVAQTRMDNRSYRPNVENCRDLAQQELIDGVHTIQSSVSALLHELEEAERVKTDLVNSRARLEREIMLKRRSLFIDR 563          
BLAST of Tektin-2 vs. Ensembl Fly
Match: CG32819 (gene:FBgn0052819 transcript:FBtr0070051)

HSP 1 Score: 107.457 bits (267), Expect = 7.692e-24
Identity = 104/384 (27.08%), Postives = 174/384 (45.31%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTR-KPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK---MSL 2698
            Y   EW+++       S   R++SE+ R        ETD K  + Q D+  RL +RI  +  WR  L+     L  E+  ++E + +    L D  I   I  EC+ +R+ R+G E V+D  +  L  E N +   +  L    +   +Q    + A+     D+  K ++L ID   + +N  S  I+Y     +  P +ST  + W   S   + R++ E  K  + R D     + V   +      T  A  +R  E+ +A N ++   +  ++E  ++   +  L++A + K    K+ QTRLE R  R  +E C+D AQ+ LV EV  +  + ETL  +L  A     G+ K    +  +L  K +AL +D+   MSL
Sbjct:  126 YTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQ-ESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSL 508          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt2 (tektin 2 (testicular) [Source:ZFIN;Acc:ZDB-GENE-040113-1])

HSP 1 Score: 287.345 bits (734), Expect = 4.735e-87
Identity = 172/414 (41.55%), Postives = 255/414 (61.59%), Query Frame = 2
Query: 1529 MAT-ESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRT-PCNMIPFG 2764
            MAT  S+P   Y+  +W ++  ++S  +E KR++S + RQ GRA R ET  KT  ++ DS  +L DRI+ I RW+E L      +D+E+ AL+ +KEEME  L    +  ++  EC+N R+ RRG E V+D  + EL+ E  +I   +++LQ  ID AFEQLCR+QEAR++   DLQDK  AL++D++  ++  +S  IS KPNPTR P  ST+PQ+WE FSRY+I+RA+ EM    + RE+   T  +V + L+ Q    E+ALRKR H  EQA +++++Q K T+ E  EL  DI  LEE  +AK    KL  TRLENR++RP M+ CRD  Q GLVDE   L  +   L+++LA A+++L  + +  A++ + L+ K+ AL +++ S   R RL     T   P  ++P  
Sbjct:    1 MATLSSKPASRYSVSDWATNNKQMSDTAEHKRNVSHEIRQEGRALRNETTNKTSWNEYDSTRKLRDRINDITRWKENLKACAQEVDEEMDALTLSKEEMERALAATVLPLEVTAECLNLREGRRGKELVSDPVEAELKKEVEVIDGAQRVLQQCIDQAFEQLCRLQEARQQLTIDLQDKIEALDVDMSCLSLTIQSPEISLKPNPTRVPPGSTNPQQWEQFSRYNISRAREEMQVSVQIRENNSITRAQVQNELEAQRMSVEFALRKRTHHEEQAHHDMQWQLKTTQDEIAELEKDIIGLEEDLQAKTAPLKLVHTRLENRIKRPGMDLCRDEVQFGLVDEAKHLEATILALKQKLAQAQHSLQSLKQHEAQMMEELSRKQDALSLEQRSNQTRQRLTLGGTTEGLPSAVVPLA 414          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt2 (tektin 2 (testicular) [Source:ZFIN;Acc:ZDB-GENE-040113-1])

HSP 1 Score: 287.345 bits (734), Expect = 4.735e-87
Identity = 172/414 (41.55%), Postives = 255/414 (61.59%), Query Frame = 2
Query: 1529 MAT-ESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRT-PCNMIPFG 2764
            MAT  S+P   Y+  +W ++  ++S  +E KR++S + RQ GRA R ET  KT  ++ DS  +L DRI+ I RW+E L      +D+E+ AL+ +KEEME  L    +  ++  EC+N R+ RRG E V+D  + EL+ E  +I   +++LQ  ID AFEQLCR+QEAR++   DLQDK  AL++D++  ++  +S  IS KPNPTR P  ST+PQ+WE FSRY+I+RA+ EM    + RE+   T  +V + L+ Q    E+ALRKR H  EQA +++++Q K T+ E  EL  DI  LEE  +AK    KL  TRLENR++RP M+ CRD  Q GLVDE   L  +   L+++LA A+++L  + +  A++ + L+ K+ AL +++ S   R RL     T   P  ++P  
Sbjct:    1 MATLSSKPASRYSVSDWATNNKQMSDTAEHKRNVSHEIRQEGRALRNETTNKTSWNEYDSTRKLRDRINDITRWKENLKACAQEVDEEMDALTLSKEEMERALAATVLPLEVTAECLNLREGRRGKELVSDPVEAELKKEVEVIDGAQRVLQQCIDQAFEQLCRLQEARQQLTIDLQDKIEALDVDMSCLSLTIQSPEISLKPNPTRVPPGSTNPQQWEQFSRYNISRAREEMQVSVQIRENNSITRAQVQNELEAQRMSVEFALRKRTHHEEQAHHDMQWQLKTTQDEIAELEKDIIGLEEDLQAKTAPLKLVHTRLENRIKRPGMDLCRDEVQFGLVDEAKHLEATILALKQKLAQAQHSLQSLKQHEAQMMEELSRKQDALSLEQRSNQTRQRLTLGGTTEGLPSAVVPLA 414          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 127.872 bits (320), Expect = 1.305e-30
Identity = 107/395 (27.09%), Postives = 188/395 (47.59%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK---MSLDYRLRLKSVPMT 2734
            Y P +W+       + SE  R+ +E+ R+       + +  T+  Q  ++  + +R++ I  WR  ++    N+  EI ALS+ K  +E  L +      +  EC+ +R+ R  I+ V+DD +++L  E ++I  C++ ++  ++ A  QL   + A+ E   DL DK TA  ID   +++   S  ISY     R     + P  W  F+  +I  +++E     + R+++    +   + + +Q      +   RI E     N L+     T +E  +    I+AL++A R K    K+ QTRLE R  RP +E CRD     L+ EV ++ D+   L +RL  A N L  + K    +  +L+ K ++L +D+   MS+      KS P T
Sbjct:   77 YMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMR-----KSFPST 466          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 127.487 bits (319), Expect = 2.068e-30
Identity = 107/395 (27.09%), Postives = 188/395 (47.59%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK---MSLDYRLRLKSVPMT 2734
            Y P +W+       + SE  R+ +E+ R+       + +  T+  Q  ++  + +R++ I  WR  ++    N+  EI ALS+ K  +E  L +      +  EC+ +R+ R  I+ V+DD +++L  E ++I  C++ ++  ++ A  QL   + A+ E   DL DK TA  ID   +++   S  ISY     R     + P  W  F+  +I  +++E     + R+++    +   + + +Q      +   RI E     N L+     T +E  +    I+AL++A R K    K+ QTRLE R  RP +E CRD     L+ EV ++ D+   L +RL  A N L  + K    +  +L+ K ++L +D+   MS+      KS P T
Sbjct:   92 YMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMR-----KSFPST 481          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 127.487 bits (319), Expect = 2.068e-30
Identity = 107/395 (27.09%), Postives = 188/395 (47.59%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK---MSLDYRLRLKSVPMT 2734
            Y P +W+       + SE  R+ +E+ R+       + +  T+  Q  ++  + +R++ I  WR  ++    N+  EI ALS+ K  +E  L +      +  EC+ +R+ R  I+ V+DD +++L  E ++I  C++ ++  ++ A  QL   + A+ E   DL DK TA  ID   +++   S  ISY     R     + P  W  F+  +I  +++E     + R+++    +   + + +Q      +   RI E     N L+     T +E  +    I+AL++A R K    K+ QTRLE R  RP +E CRD     L+ EV ++ D+   L +RL  A N L  + K    +  +L+ K ++L +D+   MS+      KS P T
Sbjct:   92 YMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMR-----KSFPST 481          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: tekt2 (tektin 2 (testicular) [Source:NCBI gene;Acc:493269])

HSP 1 Score: 268.47 bits (685), Expect = 6.206e-80
Identity = 166/401 (41.40%), Postives = 243/401 (60.60%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            MAT S +P   ++  +W ++A  +S N+E +R  S + RQ  RA R ET  +TK D+ D++TR       + +WR++LDK  + +D EI AL++ K+E E  L+ KNI  D+  EC  +R+ RR I+ V D  + EL  E  +I   ++ LQ KI +AFEQLC +QEAR +   D + KT  +EID T  ++ + S +IS K +P R    +T PQEWE FSRYS  RA+ E+    R RE +  T  + ++  + Q    E+A RKRIHE E+A+ EL +Q+K T++E EE+  DI+ L+E  R K  S KL  TRLE RL RP +E CRD  Q GL DEV Q+  +   L+E+L+ ++NALD + K LA I ++   K+++L++D   LD R +L   P
Sbjct:    1 MATLSLKPGSRFSVTDWQTNAALISTNAERQRISSHQIRQEARALRNETSNQTKWDEQDNSTRE------VEKWRQVLDKCLSEVDAEINALTQIKDEAEQALQAKNIPLDVAIECFTHRESRREIDLVKDPVEDELHKEVEVIEGVRRALQQKISEAFEQLCLLQEARHQLNFDQRSKTDTVEIDQTCLSLTKNSPNISLKVDPARVLNGTTTPQEWEQFSRYSKERAEAEVRTSGRLRESIALTIAQTNNECEAQRVAVEFAFRKRIHEFERALAELNWQEKNTKEEIEEMEGDIRHLDEDLREKKGSLKLAHTRLETRLHRPNVELCRDQVQYGLTDEVRQIEGTIAALKEKLSQSQNALDALYKHLARIEEDTKWKQNSLILDNKCLDTRRKLTLPP 395          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: plcd1 (phospholipase C delta 1 [Source:Xenbase;Acc:XB-GENE-1013054])

HSP 1 Score: 136.732 bits (343), Expect = 1.611e-33
Identity = 107/387 (27.65%), Postives = 185/387 (47.80%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK 2689
            +AT      +Y   EW          +   RD SE  R   +    ET+ + +  Q D    L +R+  I  W+  L +   +++ E Q L + K  +E  L+  +I   I  + +  RD RRG E V D+ ++EL  E +LI   ++LL+  +D   +Q+ + ++A+E    D  DK  A E D      N +S+ I +  N ++    ++ P+ W  ++  +I +A+ E +     R  +      + + L+ QS        KR  E+E A  +LE   K T +E      +I AL++A   K P  K+ QTRL +R  RP +E CRD  Q  LV EVG+L DS + L+ +L ++  +L  ++     +  ++  K +++ +D+
Sbjct:   54 LATAGFRTAKYLHEEWQQGNLATFYRAFSDRDQSETGRHEAKQLVTETEARAQRSQADCTKSLGERLLDIHFWKSELAREIRDVEAETQLLVQQKGRLERALDATDIPFSIATDNLKCRDRRRGSELVRDEVELELLKEVDLIRNVQELLKRTLDQTVQQIRQNRDAKENLEMDYSDKVEAYEFDDKCGRYNNQSTDIQFHRNSSKYEDNTSTPESWAQYTHENIYKAERERMASINLRSLIDSILQDISEDLEAQSAAIAVDFEKRCREVEDAKQKLEMHLKKTLEEIGGQEKNIAALKQAINDKSPPLKVAQTRLHDRSYRPNVELCRDHVQIRLVSEVGELTDSLDALKLKLEDSEQSLRNLEDTRMSLEKDIANKANSIFIDR 440          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:549229])

HSP 1 Score: 125.561 bits (314), Expect = 1.541e-29
Identity = 108/391 (27.62%), Postives = 181/391 (46.29%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK-MSLDYRLRLKSVP 2728
            Y P +W+       ++SE  R  +E+ R        E D KT+  Q D+N  L +R++ I  W+  +      +  E  ALSE K  ME  L +      +  EC+ +R+ R  I+ V+DD + +L  E + I  C++ ++  +     QL   + A+ E   D+ DK TAL ID    N+   S  I Y     R     + P+ W  +S  +I R++++ V   + RED         + +  Q          RI E   A N+L+     T +E  +    I+A+++A + K    K+ QTRL+ R  RP +E CRD+ Q  L+ EV  + ++ + L+ RL  A +AL  +    + +  +L  K ++L +D+   +  R    S P
Sbjct:   94 YTPDDWYKSNQVNYRDSESSRRSAERLRVDTSRLIQEKDQKTRKVQSDTNKDLGERVNDISFWKSEIIHEIDQMIGETNALSEMKRRMERALMETEGPLQVSQECLYHREKRMSIDLVHDDVEKQLIQEVDCIKSCQEKMRRHLQKISAQLASNRAAQHELERDISDKQTALRIDDKCQNLRNSSDGIGYFRGVERMDATVSIPETWAKYSDDNILRSQSDRVASTKLREDAETILASTSNDMWGQFNAVNVNFTSRISETADAKNKLQNHLAKTLQEIFQTEMTIEAIKKAIKDKSAPLKVAQTRLDERTRRPNVELCRDSVQMRLIQEVQDIDNTIQALQLRLREAEDALQMLIHTKSILEHDLAIKANSLFIDQEKCMGMRKSFPSTP 484          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: gdf10 (growth differentiation factor 10 [Source:Xenbase;Acc:XB-GENE-5998698])

HSP 1 Score: 123.635 bits (309), Expect = 1.860e-29
Identity = 108/387 (27.91%), Postives = 179/387 (46.25%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRI--ETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDH-------QSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKM 2692
            + P EW          +E +R  SE  R +  + R+  E +  T+  Q D N +L  R++ I+ W++ LD    +   +I  L   K  +E  LE       I  +C+  R+ R GI+ V+D+ + EL  E  +I     LL+  I+   EQ+   + A+     DL+DK  AL+ID     +   S  I Y  N  R    S  P EWE+++        T ++K ++ R +       +D +L         Q     YAL+ RI E + A N+LE        E      +I+ L++A   K    K+ QTRL+ R  RP +E CRD  Q  L++EV ++  + E L E LA A   L  +++    + + +  K++++ +D++
Sbjct:   11 FLPKEWNIANKTCYARAESQRSRSE--RLVAESQRLVDEIEKTTQNSQKDVNKKLDQRLEEIQFWKKELDSKLEDTVNDIAQLLAYKIRLEKALESCKEPLSIAQQCLIEREKRVGIDLVHDEAERELIKEVEVIQGVMTLLERTIEQITEQIRMSRSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIDYSANTVRIEANSVTPIEWENYT-------NTNILKAEKQRNNAIALRSLIDGILSETASDICKQCDTATYALKNRIQETKDAKNKLEEHLAKVMDEISSQEKNIEILKKALADKEGPMKMAQTRLDTRTLRPNVELCRDPVQYRLINEVQEITTNVERLRETLAQAEAELKALNRNQLSLEEEIQVKENSIYIDEV 388          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 71.2478 bits (173), Expect = 1.233e-12
Identity = 74/276 (26.81%), Postives = 122/276 (44.20%), Query Frame = 2
Query: 1682 TKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRME 2509
            T+  Q D N +L  R++ I+ W+EL  K +  ++ +I  L   K  +E  LE       +  +C+  ++ R GI+ V+D+ + EL    ++I     LL+  +            A+     DL+DK  AL+ID     +   S  I Y  N  R    S  P EWEDF+        T +VK ++ R +       +D +L   +    YA  K    L + ++E+  Q+K           +I+ L++A   K    K+ Q RL+ R  RP +E
Sbjct:    1 TQKSQKDFNKKLDQRLEEIQFWKELDSKLEDTVN-DIAQLLACKFRLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGVMTLLEMSLS-----------AKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSVTPIEWEDFTN-------TNIVKAEKRRNNAVALRSLIDGILSETASDI-YAKNKLEEHLAKVISEISSQEK-----------NIEILKKALADKEGPMKMEQIRLDTRTLRPNVE 245          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt2 (tektin 2 [Source:MGI Symbol;Acc:MGI:1346335])

HSP 1 Score: 271.937 bits (694), Expect = 3.043e-81
Identity = 169/401 (42.14%), Postives = 246/401 (61.35%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            MAT S +P + Y   +W +++Y LS N+E +RD S + RQ  R  R ET+ +   D+ D+ TRL++RID + RW+E LDK  T+LD EI +L++ KE  E  L+ KN+  D+  EC+  R+ RR I+ V D  + EL  E  +I   KK+LQ KI  AF+ LC +QE R++   D +DK   LEID    ++N  S +IS K NPTR PK ST  Q+W++F+R++ NRA+ EM      RE +     + ++ LD Q   TE+  RKR+ E+E   +EL++Q+K T +E  EL  DI+ LEE  R K+ + KL  TRLE+R  R  +E CRD  Q GL+DEV QL  +  T++++LA  +NALD + K LA I  ++  K + LL+D   +D R +L +VP
Sbjct:    1 MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKL-TVP 400          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt2 (tektin 2 [Source:MGI Symbol;Acc:MGI:1346335])

HSP 1 Score: 271.937 bits (694), Expect = 3.043e-81
Identity = 169/401 (42.14%), Postives = 246/401 (61.35%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            MAT S +P + Y   +W +++Y LS N+E +RD S + RQ  R  R ET+ +   D+ D+ TRL++RID + RW+E LDK  T+LD EI +L++ KE  E  L+ KN+  D+  EC+  R+ RR I+ V D  + EL  E  +I   KK+LQ KI  AF+ LC +QE R++   D +DK   LEID    ++N  S +IS K NPTR PK ST  Q+W++F+R++ NRA+ EM      RE +     + ++ LD Q   TE+  RKR+ E+E   +EL++Q+K T +E  EL  DI+ LEE  R K+ + KL  TRLE+R  R  +E CRD  Q GL+DEV QL  +  T++++LA  +NALD + K LA I  ++  K + LL+D   +D R +L +VP
Sbjct:    1 MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKL-TVP 400          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 119.013 bits (297), Expect = 6.524e-28
Identity = 104/392 (26.53%), Postives = 187/392 (47.70%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRI--ETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            + P EW+         +E +R  SE  R +  + R+  E +  T+  Q D N +L  R++ +R W++ LD     L  +   L   K  +E  LE       I  +C+  R+ R GI+ V+D  + EL+ E ++I     LL   ++++ EQ+   + A+     DL+DK TA+ ID   +++N  S +I++     R    S   ++W DFS  ++ +A  ++      +  +     +  + L  Q +  + A    + E + A N+L        +E      +I ALE A   +   AK+  TRLE R  RP +E CRD AQ  L+ E+ ++  +   L+E LA A+  L  + ++   + + +  K++ + +D++ L   +R KS+P
Sbjct:   11 FLPEEWYIANKSQYHRAEAQRSQSE--RLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQV-LCMEMR-KSIP 398          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 119.013 bits (297), Expect = 6.524e-28
Identity = 104/392 (26.53%), Postives = 187/392 (47.70%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRI--ETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            + P EW+         +E +R  SE  R +  + R+  E +  T+  Q D N +L  R++ +R W++ LD     L  +   L   K  +E  LE       I  +C+  R+ R GI+ V+D  + EL+ E ++I     LL   ++++ EQ+   + A+     DL+DK TA+ ID   +++N  S +I++     R    S   ++W DFS  ++ +A  ++      +  +     +  + L  Q +  + A    + E + A N+L        +E      +I ALE A   +   AK+  TRLE R  RP +E CRD AQ  L+ E+ ++  +   L+E LA A+  L  + ++   + + +  K++ + +D++ L   +R KS+P
Sbjct:   11 FLPEEWYIANKSQYHRAEAQRSQSE--RLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQV-LCMEMR-KSIP 398          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 119.013 bits (297), Expect = 6.524e-28
Identity = 104/392 (26.53%), Postives = 187/392 (47.70%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRI--ETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            + P EW+         +E +R  SE  R +  + R+  E +  T+  Q D N +L  R++ +R W++ LD     L  +   L   K  +E  LE       I  +C+  R+ R GI+ V+D  + EL+ E ++I     LL   ++++ EQ+   + A+     DL+DK TA+ ID   +++N  S +I++     R    S   ++W DFS  ++ +A  ++      +  +     +  + L  Q +  + A    + E + A N+L        +E      +I ALE A   +   AK+  TRLE R  RP +E CRD AQ  L+ E+ ++  +   L+E LA A+  L  + ++   + + +  K++ + +D++ L   +R KS+P
Sbjct:   11 FLPEEWYIANKSQYHRAEAQRSQSE--RLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQV-LCMEMR-KSIP 398          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q6AYM2|TEKT2_RAT (Tektin-2 OS=Rattus norvegicus OX=10116 GN=Tekt2 PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 4.713e-85
Identity = 168/401 (41.90%), Postives = 249/401 (62.09%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            MAT S +P + Y   +W +++Y LS N+E +RD S + RQ  R  R ET+ +T  D+ D+ TRL++RID + RW+E+LDK  T+LD EI +L++ KE +E  L+ KN+  D+  EC+  R+ RR I+ V D  + EL  E  +I   KK+LQ KI  AF+ LC +QE R++   D +DK   LEID    ++N  + ++S K NPTR PK ST  QEW+DF+R++ NRA TEM      RE +     + ++ L+ Q   TE+  RKR+ E+E   +EL++Q+K T +E  EL  DI+ LEE  R K+ + KL  TRLE+R  RP +E CRD  Q GL+DEV QL  +   ++++LA  ++ALD + K LA I  ++  K + +L+D   +D R +L +VP
Sbjct:    1 MATLSLKPSQRYRLSDWLTNSYLLSTNAERQRDASHQIRQEARILRNETNNQTVWDEHDNRTRLAERIDTVNRWKEMLDKCLTDLDAEIDSLTQAKESVEQSLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEEELMKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTAPNLSLKVNPTRVPKDSTTLQEWDDFTRFNKNRADTEMKASIELRETIALAIAQTNNELEAQRVATEFTFRKRLREMESLYSELKWQEKNTLEEIAELQADIRRLEEDLRRKMMNLKLAHTRLESRTYRPNVELCRDQTQYGLIDEVHQLEATISIMKQKLAQTQDALDALFKHLARIQADIACKTNTMLLDTKCMDIRRKL-TVP 400          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q9UIF3|TEKT2_HUMAN (Tektin-2 OS=Homo sapiens OX=9606 GN=TEKT2 PE=1 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 2.214e-84
Identity = 170/404 (42.08%), Postives = 252/404 (62.38%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTR 2737
            MAT S +P + +   +W +++Y LS N++ +RD S + RQ  R  R ET+ +T  D+ D+ TRL +RID + RW+E+LDK  T+LD EI AL++ KE  E  L+ KN+  D+  EC+  R+ RR I+ V D  + EL  E  +I   KK LQ K+  AFEQLC +QE +++   D + K   LEID    ++N +S +IS K +PTR P  ST  Q+W+DFSR++ +RA+ EM      RE    T  + ++ L+ Q   TE+A RKR+ E+E+  +EL++Q+K T +E  EL +DI+ LEE  R K+ S KL+ TRLE R  RP +E CRD AQ GL DEV QL  +   L+++LA A++ALD + K LA +  ++  K +++L+D   +D R +L +VP  R
Sbjct:    1 MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKL-TVPAER 403          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q26648|TKB1_STRPU (Tektin-B1 OS=Strongylocentrotus purpuratus OX=7668 PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 7.780e-82
Identity = 166/368 (45.11%), Postives = 232/368 (63.04%), Query Frame = 2
Query: 1700 DSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVVR*ML 2803
            D+ TRLS+RID I  WRE L+KT  ++D+EI+ L E K+  E  LE K +  D+ +EC   RD RR  + V+D    E+  E ++I   K  LQ+K+  AFEQLC +QEAR++   DL+DKT A +ID   +++   S  I Y+PN TR PK ST PQ WEDFSRY+ +RA  EM   QR RE +H T  + D+ L+ Q Q TE+ALRKRIHE+++A +E E+QKK TE+E  +   +I+ LE+A + K    KL  TRLENR  RP +E CRD AQ GLV+EV ++ DS + LE++L +A NA D  +K+L  IN +L  K ++L +D   +  R +L + P+T+T  N+  F   RE     R +L
Sbjct:   32 DNTTRLSNRIDDIETWRETLEKTLADVDEEIRKLEEDKDLAERALEAKALPLDVASECKTLRDGRRDNDVVDDLANSEVGKEIDVIEGIKDALQAKVSSAFEQLCLLQEARQQLHADLRDKTEAKKIDTYCHDLTISSPDICYQPNSTRTPKGSTTPQTWEDFSRYNKDRADAEMRSSQRLREAIHSTVAQTDNDLEAQRQATEFALRKRIHEMKRAKDEDEWQKKNTEEEIAKQERNIRELEQAIKDKENPLKLAMTRLENRTYRPNVELCRDNAQYGLVNEVHEIQDSIKALEKKLQDAHNARDACEKQLYRINKDLELKNNSLDLDNKCMQVREKLTTGPVTQTMNNLSTFKTDRELYTAQRSLL 399          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q4R5V1|TEKT2_MACFA (Tektin-2 OS=Macaca fascicularis OX=9541 GN=TEKT2 PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.031e-81
Identity = 165/401 (41.15%), Postives = 248/401 (61.85%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            MAT S +P + +   +W +++Y LS N++ +RD S + RQ  R  R ET+ +T  D+ D+ TRL +RID + RW+E+LDK  T+LD EI AL++ K+     L+ KN+  D+  EC+  R+ RR I+ V D  + EL  E  +I   KK LQ K+  AFE LC +QE R++   D + K   LEID    ++N +S +IS K +PTR P  ST  Q+W+DFS+++ +R + EM      RE +  T  + ++ L+ Q   TE+A RKR+ E+E+  +EL++Q+K T +E  EL +DI+ LEE  R K  S KL+ TRLE R  RP +E CRD AQ GL DEV QL  +   L+++LA A++ALD + K LA +  ++  K +++L+D   +D R +L +VP
Sbjct:    1 MATLSVKPSQRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKDSAGQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKALQQKVSQAFEHLCLLQEVRQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSQFNKDRGEAEMKAATELREAIALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHLEEDLRTKFLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALYKHLARLQADIACKANSMLLDTKCMDTRRKL-TVP 400          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q2T9Q6|TEKT2_BOVIN (Tektin-2 OS=Bos taurus OX=9913 GN=TEKT2 PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.144e-80
Identity = 168/401 (41.90%), Postives = 247/401 (61.60%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            MAT S +P   +   +W +++Y LS N+E +RD S + RQ  R  R ET+ +T  D+ D+ TRL++RID + RW+E+LDK  T+LD EI AL++ KE  E  L+ KN+  D+  EC+  R+ RR I+ V D  + EL  E  +I   KK LQ KI  AFE+L  +QEAR+    D + K   L+ID    ++N  S +IS K NPTR P  ST  Q+W+D SR++ +  + EM K    RE +  T  + ++ L+ Q   TE+A RKR+ E+E+  +EL++Q+K T +E  EL +DI+ LEE  R K+ + KL  TRLE R  RP +E CRD AQ GL DEV QL  +   L+++LA A++ALD + K LA +  ++  K +++L+D   +D R +L +VP
Sbjct:    1 MATLSVKPSPRFRLPDWQTNSYLLSTNAERQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLAERIDTVSRWKEMLDKCLTDLDAEIDALAQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEEELHKEVEVIEATKKALQQKISQAFEKLFLLQEARQRLNSDHRGKMETLDIDRGCLSLNLTSPNISLKINPTRVPNGSTSLQQWDDLSRFNKDHGEAEMKKAIELREAIALTIAETNNELEAQRVATEFAFRKRLREMEKLYSELKWQEKNTLEEIAELHEDIRHLEEDLRRKLQNLKLCHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALYKHLARLQADIACKANSMLLDTKCMDTRRKL-TVP 400          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A267D9M0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030066g1 PE=4 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 1.435e-140
Identity = 226/423 (53.43%), Postives = 307/423 (72.58%), Query Frame = 2
Query: 1523 LRMATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVV 2791
            + MATE++P  +Y P +WF++AY +S N+E +R+ S++ RQ  R  R ETD KTK DQ D+NTRL+DR+D+IR+W+E+L++T  +LD EI  LSE+KE+ E  LE KN+  D VNEC+  RD RR I+NV D+ + +LR EQ +IA+ K+ LQ K+D+ FEQLC +QEAR++   DLQ+K  AL IDI QYN+NE+S +ISYKPNPTR PK ST PQ+WEDFSRY+++RAK E+    R RE  H T H  D+ L+ Q Q ++YALRKR+HE EQA +ELE+QK+ TE E  EL  DI+ALEEA +AKIP AKL +TRLENR  RP +E CRDA Q GL DEV Q+  SK+ L ++L  AR+ LDG+ K+L  IN +L  K +++++D+ + D R RL + P+T+T  NM+  GI RE+S V+
Sbjct:    5 IAMATETKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEISKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEQQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEQEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITRERSKVL 427          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A267DEM6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030066g3 PE=4 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 1.717e-140
Identity = 226/423 (53.43%), Postives = 307/423 (72.58%), Query Frame = 2
Query: 1523 LRMATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVV 2791
            + MATE++P  +Y P +WF++AY +S N+E +R+ S++ RQ  R  R ETD KTK DQ D+NTRL+DR+D+IR+W+E+L++T  +LD EI  LSE+KE+ E  LE KN+  D VNEC+  RD RR I+NV D+ + +LR EQ +IA+ K+ LQ K+D+ FEQLC +QEAR++   DLQ+K  AL IDI QYN+NE+S +ISYKPNPTR PK ST PQ+WEDFSRY+++RAK E+    R RE  H T H  D+ L+ Q Q ++YALRKR+HE EQA +ELE+QK+ TE E  EL  DI+ALEEA +AKIP AKL +TRLENR  RP +E CRDA Q GL DEV Q+  SK+ L ++L  AR+ LDG+ K+L  IN +L  K +++++D+ + D R RL + P+T+T  NM+  GI RE+S V+
Sbjct:    4 IAMATETKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEISKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEQQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEQEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITRERSKVL 426          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A267F8D0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027076g1 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 3.195e-140
Identity = 226/423 (53.43%), Postives = 307/423 (72.58%), Query Frame = 2
Query: 1523 LRMATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVV 2791
            + MATE++P  +Y P +WF++AY +S N+E +R+ S++ RQ  R  R ETD KTK DQ D+NTRL+DR+D+IR+W+E+L++T  +LD EI  LSE+KE+ E  LE KN+  D VNEC+  RD RR I+NV D+ + +LR EQ +IA+ K+ LQ K+D+ FEQLC +QEAR++   DLQ+K  AL IDI QYN+NE+S +ISYKPNPTR PK ST PQ+WEDFSRY+++RAK E+    R RE  H T H  D+ L+ Q Q ++YALRKR+HE EQA +ELE+QK+ TE E  EL  DI+ALEEA +AKIP AKL +TRLENR  RP +E CRDA Q GL DEV Q+  SK+ L ++L  AR+ LDG+ K+L  IN +L  K +++++D+ + D R RL + P+T+T  NM+  GI RE+S V+
Sbjct:    5 IAMATETKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEIAKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEHQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEEEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITRERSKVL 427          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A1I8H088 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030066g2 PE=4 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 4.166e-140
Identity = 226/421 (53.68%), Postives = 306/421 (72.68%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVV 2791
            MATE++P  +Y P +WF++AY +S N+E +R+ S++ RQ  R  R ETD KTK DQ D+NTRL+DR+D+IR+W+E+L++T  +LD EI  LSE+KE+ E  LE KN+  D VNEC+  RD RR I+NV D+ + +LR EQ +IA+ K+ LQ K+D+ FEQLC +QEAR++   DLQ+K  AL IDI QYN+NE+S +ISYKPNPTR PK ST PQ+WEDFSRY+++RAK E+    R RE  H T H  D+ L+ Q Q ++YALRKR+HE EQA +ELE+QK+ TE E  EL  DI+ALEEA +AKIP AKL +TRLENR  RP +E CRDA Q GL DEV Q+  SK+ L ++L  AR+ LDG+ K+L  IN +L  K +++++D+ + D R RL + P+T+T  NM+  GI RE+S V+
Sbjct:    1 MATETKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEISKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEHQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEEEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITRERSKVL 421          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A1I8IS05 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 419.853 bits (1078), Expect = 2.033e-125
Identity = 221/417 (53.00%), Postives = 301/417 (72.18%), Query Frame = 2
Query: 1541 SRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVV 2791
            ++P  +Y P +WF++AY +S N+E +R+ S++ RQ  R  R ETD KTK DQ D+NTRL+DR+D+IR+W+E+L++T  +LD EI  LSE+KE+ E  LE KN+  D VNEC+  RD RR I+NV D+ + +LR EQ +IA+ K+ LQ K+D+ FEQLC +QEAR++   DLQ+K  AL IDI QYN+NE+S +ISYKPNPTR PK ST PQ+WEDFSRY+++RAK E+    R RE  H T H  D+ L+ Q Q ++YALRKR+HE EQA +ELE+QK+ TE E  EL  DI+ALEEA +AKIP AKL +TRLENR  RP +E CRDA Q GL DEV Q+  SK+ L ++L  AR+ LDG+ K+L  IN +L  K +++++D+ + D R RL + P+T+T  NM+  GI   +SV+V
Sbjct:  288 TKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEISKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEQQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEQEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITPMESVLV 704          
BLAST of Tektin-2 vs. Ensembl Cavefish
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:103026688])

HSP 1 Score: 261.151 bits (666), Expect = 1.853e-77
Identity = 158/397 (39.80%), Postives = 241/397 (60.71%), Query Frame = 2
Query: 1529 MATES-RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRL 2716
            MAT S +P       +W +    +S  +E +R +S + RQ GRA R ET  KT  D+ DS+ RL+DRI  + RW++ L+    +++ EI AL+  KEE E  L    +  ++  EC   R+ RRG E V+D  + EL+ E ++I   +++LQ  ID +FEQLC +QEA  +   DLQ KT AL++D++  ++   S  IS KPNP R P  ST PQ+WE FS +++ RAK EM    + RE++  T  +V + L+ Q   TE+ALRKR H +EQA+ E+++Q K T+ E  E+  DI+ LE   +AK+   KL  TRLENR +RP ++ CRD  Q GLV+E  QL  + +TL+++LA A ++L  +    A++ ++L+ K+ AL +++ +   R RL
Sbjct:    1 MATMSMKPGLRCRVPDWENSNKLISDTAEHRRHVSHEIRQEGRALRNETANKTSWDEYDSSRRLNDRISDVTRWKKSLEACVQDVNAEIDALTLAKEETERALAATVLPLEVTAECQTLREGRRGSELVSDPVEAELKKEVDVIDGAQRVLQQLIDQSFEQLCLLQEAHHQLTLDLQHKTEALDVDMSCLSLTVTSPEISLKPNPIRVPPGSTTPQQWEQFSHHNVIRAKEEMQTSLQLRENISITRAQVQNELEAQRIATEFALRKRTHHMEQALQEVQWQLKTTQDEITEMERDIRGLERDMQAKMAPLKLVHTRLENRTKRPGVDLCRDEVQFGLVEEAKQLDSTIQTLKQKLAQALDSLQSLQHHEAQMLEDLSRKQEALALEQRTAQTRTRL 397          
BLAST of Tektin-2 vs. Ensembl Cavefish
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:103037718])

HSP 1 Score: 138.658 bits (348), Expect = 3.753e-34
Identity = 115/392 (29.34%), Postives = 185/392 (47.19%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTR-KPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK-MSLDYRLRLKSVP 2728
            Y P +WF   Y   + SE  R+ +E+ R+       + D  T+  Q  ++  L +R++ I  WR  L     N+  EI AL+E K  +E  L +         EC+ +R+ R  I+ V+D  + +L  E  +I  C++ ++  +D A  QL   + A+ E   DL DK TA  ID   + M   S  ISY     R  P +S  P  W  F+  +I  +++E     + R+++    +   + + +Q      +   RI E+ +A N L+     T +E  +    I+ L++A R K    K+ QTRLE R  RP +E CRD     LV EV ++ DS   L ERLA A N L  + K    +  +++ K ++L +D+   +  R    S P
Sbjct:   93 YMPDDWFKSNYNNYRESESSRNSAERLRRDTLRLIQDRDQITRWTQESTSKNLGERLNDITFWRSELHHEIDNMVSEIAALTEVKRRLERALAETEGPLQTSQECLFHREKRMSIDLVHDGVEKDLIKEVEVIKSCQERMRRSLDKAIAQLASNRAAQHELERDLNDKVTAQRIDDRCHQMRNTSDGISYYRGIDRLDPSLSL-PDSWSKFTDDNILLSQSERSTSHKLRDEIEVLLNTTANEMWNQFNSANVSFTNRISEMAEAKNSLQTHLAKTLQEIFQTEMLIETLKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLVGEVREIEDSIYKLRERLAEAENTLQNLVKTKVTLEHDISVKANSLFLDQEKCMSMRRSFPSTP 483          
BLAST of Tektin-2 vs. Ensembl Cavefish
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:103034475])

HSP 1 Score: 92.8189 bits (229), Expect = 2.219e-19
Identity = 98/400 (24.50%), Postives = 175/400 (43.75%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK-MSLDYRLRLKSV 2725
            +AT      +Y+P EW  +     + +      +++  +  RA   E    T+  Q      L  R+  +   R  L +    L  E + L + K  +E  L   ++   I  + +  R+ R G + V D  + EL  E  LI   + LL+  +  A +Q+   +EA++    D  DK  A  +D        +S+   + P+  R      D + W  F++ ++  A+ +       RE       +  + L  Q    + +  +R  EL QA N+LE Q +    E      +I  L++A   K    ++ Q+RL  R +RP ME CRD  Q  L  EV Q++ S   L+++L+ AR +L  +++    +  N++ K ++L +D+   L +R R  +V
Sbjct:   28 LATAGFRSAKYSPREWQENNSATLQRALTDHQHAQRVLRASRALSAEAAAGTQDAQSRGTLLLGARLQDVHSRRTELQRGAERLQAETELLQDHKRRLEKALLTTDLPLTISTDNLTCRENRFGPDLVQDPVEEELLKEVELIRNVQALLKKTLQQAVDQIRLNREAKQTLELDWSDKHEAYILDDQCGRYGNRSTDTQHHPSSARLHDQVCDERAWLKFTQVNLEEAERQYRCSVSLRELCDRVLQETAEDLRAQCAVVDQSFNQRCLELSQAKNQLELQLQRVLDEIGSQERNISTLQQAVYDKDTPLRVAQSRLHYRAQRPNMELCRDQPQISLESEVEQISGSVGVLQQQLSEARQSLAQLEESRLMLEKNISCKTNSLFIDRDKCLTHRTRYPTV 427          
BLAST of Tektin-2 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 159.844 bits (403), Expect = 8.598e-45
Identity = 84/209 (40.19%), Postives = 125/209 (59.81%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPK 2155
            +    +P + +  GEW      +S  ++ +RD+S   RQ  R  R +++ +TK DQ DSNTRL +R+  ++RW E L  T  + D EI AL++TK++ E  L+ K +   +  EC+  RD RRG++ V+D  + EL  E   I   K+ L   I+DAF Q+C++QEAR++  GD++DK  ALEID T   +N  S+ IS KPNP R PK
Sbjct:    2 LGVSVKPGRRFTVGEWHDSGERVSSGAQSRRDVSRSVRQEARHLRDQSNNQTKWDQHDSNTRLEERMSSVQRWVERLQHTLDDTDAEINALAKTKDDAERALQAKAVPLQVATECLFLRDARRGVDLVHDPVEDELHREVKAIERAKEALTRSINDAFLQVCQLQEARQQLQGDVRDKEEALEIDSTCRALNNASATISLKPNPMRVPK 210          
BLAST of Tektin-2 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 110.153 bits (274), Expect = 2.077e-27
Identity = 74/219 (33.79%), Postives = 116/219 (52.97%), Query Frame = 2
Query: 2159 STDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRL---------------KSVPMTRTPCNMI-PFGI 2767
            S+ P+ W++FSR ++ RA  EM      RE +  T  +  + L+ Q   T++A RKR HEL++   ELE+QKK  ++E   L  DI  LE   RAK+   K+  TRLE R  R  +E CRD  Q G+  EV Q+  +  TL+++L+++ NAL G+   L  +  +L  K  AL +++  +D R +L               +++   R P  ++ P GI
Sbjct:    1 SSSPRTWDEFSRRNVERAMAEMRASSALREAITATIAQTTNELEAQKNSTDFAFRKRSHELDKVKAELEWQKKNNKQEISVLEGDIAHLEADVRAKMLPLKVAHTRLETRTYRSGVELCRDEPQYGITTEVHQIEATIATLKKKLSDSYNALTGLRCSLERVERDLASKALALGLERRCVDVRRKLTVSAERAQPLGDSFTRAIANGRIPATLVSPRGI 219          
BLAST of Tektin-2 vs. Ensembl Nematostella
Match: EDO37357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG13])

HSP 1 Score: 263.848 bits (673), Expect = 4.261e-79
Identity = 158/390 (40.51%), Postives = 228/390 (58.46%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP 2728
            +A  +W +    +  N+E +R+ S + RQ  R  R ETD  T+  Q DSNT+L  RID I  W+  L++     D EI  L+  KE  E  LE K +  DI  EC+  R+ R+ I+ V D+ + +L  E  +I   K LLQ K+D++FEQLC +QEAR +   D+ DK T L+ID   Y MN  S++I Y+ NPTR  K S  P+ W+ FS Y+  RA+ EM   +  RE +  T  +  + L+ Q + +EY+ RKRIHE +QA +ELE+Q+K T KE   L DDIK L+EA  AK     + QTRLENR  RP +E CRD  Q  L  EV ++A S   L E+L  A+N+L+ +   L+ IN++L  K ++L +D   +  R +++ +P
Sbjct:   12 FAVSDWHTSNQIIRTNAERQREASHRVRQESRFLRNETDNHTRWTQHDSNTKLEKRIDDINDWKRSLERCLAETDNEIALLTREKERTERALEAKKVPLDITLECLMLRENRQSIDLVRDEVEAQLHKEVEVIEGTKALLQQKVDESFEQLCLLQEARHQLHLDITDKFTTLQIDGDCYAMNNMSTNIGYQVNPTRTVKGSVTPETWDSFSNYNKLRAEAEMKASKHLREAIFATLQQTANDLEAQRKASEYSFRKRIHETDQAKSELEWQQKNTMKEIATLEDDIKGLKEAIDAKNAPMMVAQTRLENRTYRPNVELCRDQPQYQLCHEVAEIAGSMRALTEKLREAQNSLEALRSNLSRINEDLAFKNNSLALDNRCMSVREKMREIP 401          
BLAST of Tektin-2 vs. Ensembl Nematostella
Match: EDO39292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAK1])

HSP 1 Score: 158.688 bits (400), Expect = 5.348e-42
Identity = 117/402 (29.10%), Postives = 208/402 (51.74%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDL-HYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK-MSLDYRLRLKSVP 2728
            MA   +P  +Y P EW +  +     +E++R  +E+ R      R+E +++T   Q D N +L  RI  I  W+  LD+ ++  ++EI  +   K  +E  L D  +   I  +C+ NR+ R  I+ V+D+ +M+L  E  +I   + LL+  I+ A EQ+  ++ AR     D +DK  A +ID T   +   S  + Y  +  +  K S  P EWEDFS  ++ +A+ E       R  +       ++D+++ Q +    A  KRI E  +A  +LE      ++E   + ++I  L+ A   KI   K+ QTR+ENR  RP +E CRD  Q  L+DEV +++ + E L+E+L  A ++L  + ++   + +++  K+++L +D+   ++ R ++  VP
Sbjct:    1 MARLVQPPPKYVPEEWHASNHLQYFTAEKERAAAERLRDESERLRVEIEVRTVETQEDVNKKLDQRITDINFWKSELDRNQSETEEEINMMLNFKARLERALADTELPLMIAQQCLMNREKRIKIDLVHDNVEMQLLKEVEVIEGVQALLKRTIEQATEQIRLLRSARYYLEKDRKDKFHANKIDNTCAALKNDSPGLVYARDAVKIEKNSVTPDEWEDFSNKNMLKAEREKNSSTSLRSIIDGLLVQTLNDLMN-QCRAVNLAFEKRIEETLKAKTKLEDHLMKVKEEIAAMEENIATLQRAIALKIAPMKVAQTRVENRTFRPNIELCRDRVQYRLIDEVVEISTNIERLQEKLYEAESSLKALIRRQLSLEEDIEVKENSLFIDRDQCMELRKQITHVP 401          
BLAST of Tektin-2 vs. Ensembl Nematostella
Match: EDO40681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M2])

HSP 1 Score: 127.102 bits (318), Expect = 2.048e-31
Identity = 103/362 (28.45%), Postives = 171/362 (47.24%), Query Frame = 2
Query: 1604 NSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK 2689
            + E++R  +E+ R      R ET L T   Q+D N +L  R+  I  W+  L+K  +    EI+AL      +E  L       +I  +C+  R+ R  I+ V+D+ +  L  E  +I   + LL+  +D A EQL  ++ A+ +   DL DK  AL ID     +N  S  I + P+     + S  P EWE +S  +I +A+ E       R +++    +    L +  +       KRI +   A   LE +      E   + ++I+ L +A   K    K+  TRL+ R  RP +E CRD  Q  LV EVG++  S + L  RLA A+ ++  + +    + D++  K ++L +D+
Sbjct:    6 SGEKERATAERLRDECSRLRTETSLLTHRTQMDVNKKLDHRLHDINYWKAELEKQHSETVAEIKALQAFIGRLEKALAATEKPLNISQQCLGYRERRVKIDLVHDNVETHLSKEVEMIENVQALLKKTMDQAHEQLWLLRSAKTQLEKDLGDKYGALGIDGKCSTLNNHSKDIHFAPHAVTIQQHSFTPDEWEAYSSENIAKAERERKASVALRSEINGILMQTYVDLRNIYETVNNEFHKRIEDTVGAKKSLEKELSRVMDELASMDNNIRTLTQAIADKEAPLKVAHTRLDKRSIRPNVELCRDPVQYRLVGEVGEINTSIDRLRMRLAEAQASMQALLRNKENLEDDIEVKTNSLFIDR 367          
BLAST of Tektin-2 vs. Ensembl Medaka
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:101164907])

HSP 1 Score: 236.498 bits (602), Expect = 1.443e-68
Identity = 145/393 (36.90%), Postives = 231/393 (58.78%), Query Frame = 2
Query: 1544 RPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKS 2722
            +P       EW ++  +L   ++++R +S + RQ  ++ R ET  KT  D+ +++ RL++R+  + RWR+LLD     +D+E+ AL+ +KE  E  L       ++  EC+  R+ RRG E V D  Q +L+ E  LI   ++ LQ  ID+AF+QLC +QEAR +  GDLQ+K  AL+ID +   +   S +IS K NPTR P  ++ PQEW   S +++ +A+  M   Q+ RED+  +  ++ + L+ + + TE+ALRKR H  EQA +EL++Q +  E E  E+  DI+ L+   +AK    KL  TRLENR  RP M+ CRD  Q  LV EV QL  +   L+ +L+ A+++L  +     ++  +L+ K+ AL +++ SL+ R RL S
Sbjct:    5 KPSLRCGVSEWNNNNLQLWAEAQQQRLVSSEIRQECKSLRNETHCKTVWDEKETSRRLTERVWDVSRWRDLLDSCAQKVDEEMDALTLSKELTEQALAATATPLEVSTECMMLREGRRGYELVTDPVQEQLQKEVELIERVQQTLQQHIDEAFQQLCVLQEARHQLTGDLQNKMEALDIDKSCLTLTITSPNISLKTNPTRIPSGASTPQEWVQLSNHNVVQAEEAMRVSQQMREDMSLSRAQLQNELEAERRATEFALRKRSHHEEQARDELQWQIRNMEAEIAEMESDIRELDADLQAKTAPLKLAHTRLENRTHRPGMDLCRDEVQYSLVAEVEQLEATVLALQLKLSKAQHSLQNMRLHHGQMLQDLSRKQEALSLEQRSLNTRTRLTS 397          
BLAST of Tektin-2 vs. Ensembl Medaka
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:101160513])

HSP 1 Score: 131.339 bits (329), Expect = 8.998e-32
Identity = 108/391 (27.62%), Postives = 188/391 (48.08%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDK-MSLDYRLRLKSVP 2728
            Y P +W+         SE  R  +E+ R+       + D  T+  Q +++  +S+R++ IR W+  L     N+  EI AL+E K  +E  L +      +  EC+ +R+ R  I+ V+D  + +L   + +I  C++ ++  +D A  QL   + A+ E   DL DK TA  ID   +++   S  I Y     R+    + P  W  F+  +I R+++E     + R+++    +   + + +Q      A   RI E   A + L+     T +E  +    I++L++A R K    K+ QTRLE R  RP +E CRD     LV EV ++ D+ + L ERL  A N L  + K   ++ ++L+ K ++L +D+   +  R    S+P
Sbjct:   91 YTPDDWYKSNQSHYWESESSRKSAERLRKDTMRLIQDKDQLTRRTQENTSKNISERLNDIRFWKSELSHEIDNMVTEIAALTEVKRRLERALAETQGPLQVAQECLYHREKRMSIDLVHDGVEKDLIKIE-VIKSCQERMRLHLDRATSQLASNRAAQHELEKDLSDKLTAQRIDDRCHHLRNTSDGIGYYRGIDRQDHAVSLPDSWSRFTDDNILRSQSERATSHKLRDEIEILLNTTSNEMWNQFNNVNVAFTNRISETTDAKSSLQAHLAKTMQEIFQTEMLIESLKKAIRDKENPLKVAQTRLEERTRRPNIELCRDNPYHRLVTEVREIEDTIQKLHERLMEAENTLQALVKTKVKLENDLSIKANSLFLDQEKCMSMRKTFPSMP 480          
BLAST of Tektin-2 vs. Ensembl Medaka
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:101173527])

HSP 1 Score: 108.612 bits (270), Expect = 1.725e-24
Identity = 94/376 (25.00%), Postives = 169/376 (44.95%), Query Frame = 2
Query: 1559 YAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMD 2686
            Y+P EWFS+   +   +      +E  +QL R    +++  T   Q +    L +R+  I  WR  L +    L  +++AL   +  +E  LE  +    I  + +N R  R G + V D  + EL  E  LI   + LL+  I     Q+ R  +A++    D  DK  A  +D      + +S      P+     +   +P  W  F++ ++ +A  E    +R R  +     +  + L +Q    + A  +R  EL +A  EL+ +     ++  E   +I  L++A   K    ++ Q+RL  R  RP ME CRD AQ  L  E  Q+  +  +L+++L  AR +L  +++   E+  +++ K  +L ++
Sbjct:   49 YSPAEWFSNYQTILVRAGADNLEAESIQQLSRTLNRDSEGVTLQTQAEGTRLLGERLQEIHHWRSELLRHIEQLQADMEALQAARTRLERALEATDTPYAIATDNLNCRAKRPGPDLVQDSVEEELLKEVGLIRNIQALLKRTIAQVASQIRRNMDAKQVLEMDWSDKQEAYNLDERGGGHSNRSPDTQLHPSSAANHEQVCNPTTWTKFTQDNLLQAAQEEEASRRLRALVEEMLRETTEDLINQRSTVDGAFSQRCQELLEAKTELQIKLTQVLQQIGEQEKNIVGLQKAIHLKEAPLRVVQSRLHLRSLRPNMELCRDPAQLSLEAEAAQIETTLNSLKQKLNEARISLSNLEESRMELQKDISCKSQSLFIE 424          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000026446.1 (SMESG000026446.1)

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 422/422 (100.00%), Postives = 422/422 (100.00%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVVR 2794
            MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQKKLTEKEREELLDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVVR
Sbjct:    1 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQKKLTEKEREELLDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMREKSVVVR 422          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000026445.1 (SMESG000026445.1)

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 416/427 (97.42%), Postives = 418/427 (97.89%), Query Frame = 1
Query:  130 MTNPYRDFQSSRSSNRLTISEQIDLLRYENNDLKNTIFQLXXXXXXXXXXXXXRLCYVEYTHNSAIEKSSTELESYKFRLKELDEELRKYKYMVNDQASXXXXXXXXXXXXXXRYRVTIQYINVLPTPQESDILTKDMSRLKTEIDRCRSKYDEAEAIIRRLENELGEKSAELANCNDKEIIMKSQMDLLTEKLSRVKCSSMIKEEKTVGDWDFSTDLFGDMHMTIRKYRDELSNCKQLIESEKTKHLNSAINNQKRMDELQMQLESEIDTVTTLRKEIEYKQSSISELEKSLKMVIHQKQDIMGNMIDLTSEVERMDVMGNDEMQTLYKRLVSEVEMSVKETEIISQCLYKLFNKEDVDISMLINCSEFDNLSIEDFDEKLLDKYYLLAQLESVKETRLKLSEIKNSLLQYCTNNMAADVKFCLTQ 1410
            MTNPYRDFQ+SRSSNRLTISEQIDLL YENNDLKNTIFQLKKEKDEIIK YEDRLCYVEYTHNSAIEKSSTELESYK RLKELDEELRKYKYMVNDQASENKNLKEEFKKLEERYRV  QYINVLPTPQESD LTKDMSRLKTE DR RSKY EAEA+IRRLENELGEKSAELANCNDKEIIMKSQMDLLTEKLSRVKCSSMIKEEKTVGDWDFSTDLFGDMHMTIRKYRDELSNCKQLIESEKTKHLNSAINNQKRMDELQMQLESEIDTVTTLRKEIEYKQSSISELEKSLKMVIHQKQDIMGNMIDLTSEVERMDVMGNDEMQTLYKRLVSEVEMSVKETEIISQCLYKLFNKEDVDISMLINCSEFDNLSIEDFDEKLLDKYYLLAQLESVKETRLKLSEIKNSLLQYCTNNMAADVKFCLTQ
Sbjct:    1 MTNPYRDFQNSRSSNRLTISEQIDLLYYENNDLKNTIFQLKKEKDEIIKNYEDRLCYVEYTHNSAIEKSSTELESYKSRLKELDEELRKYKYMVNDQASENKNLKEEFKKLEERYRVANQYINVLPTPQESDKLTKDMSRLKTENDRYRSKYHEAEAVIRRLENELGEKSAELANCNDKEIIMKSQMDLLTEKLSRVKCSSMIKEEKTVGDWDFSTDLFGDMHMTIRKYRDELSNCKQLIESEKTKHLNSAINNQKRMDELQMQLESEIDTVTTLRKEIEYKQSSISELEKSLKMVIHQKQDIMGNMIDLTSEVERMDVMGNDEMQTLYKRLVSEVEMSVKETEIISQCLYKLFNKEDVDISMLINCSEFDNLSIEDFDEKLLDKYYLLAQLESVKETRLKLSEIKNSLLQYCTNNMAADVKFCLTQ 427          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000065255.1 (SMESG000065255.1)

HSP 1 Score: 341.658 bits (875), Expect = 2.277e-108
Identity = 180/359 (50.14%), Postives = 244/359 (67.97%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANAR 2605
            MA+ ++P  +Y P +W ++++ +S NSE  +  S   RQ  R  R ETD+KTK DQ D+ TRL+DRID IR W+E+L++ K  LDKEI+ L+  K+E+E +LE  N+  D+VNEC+  RD R  I+NV D+ +  L  EQ LI++CK  LQ KID+AFEQ+  + EAR +   DLQDK  A+ IDI QYN+NE S +IS+KP+ TR  K ST PQ+WED+SRY+  RA  E+   QR RE +H+T H VD+ L  Q   T+YA+RKRIH+ E+A++EL +QKK  E E   +  D++ +E++ RAKIP+AKL QTRLENR  RP +E CRDA Q GL DEV QL  +K  L E+   AR
Sbjct:    1 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWKEILEEDKEKLDKEIENLNNAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQAR 359          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000050057.1 (SMESG000050057.1)

HSP 1 Score: 341.658 bits (875), Expect = 2.277e-108
Identity = 180/359 (50.14%), Postives = 244/359 (67.97%), Query Frame = 2
Query: 1529 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQXXXXXXXXXXXXDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANAR 2605
            MA+ ++P  +Y P +W ++++ +S NSE  +  S   RQ  R  R ETD+KTK DQ D+ TRL+DRID IR W+E+L++ K  LDKEI+ L+  K+E+E +LE  N+  D+VNEC+  RD R  I+NV D+ +  L  EQ LI++CK  LQ KID+AFEQ+  + EAR +   DLQDK  A+ IDI QYN+NE S +IS+KP+ TR  K ST PQ+WED+SRY+  RA  E+   QR RE +H+T H VD+ L  Q   T+YA+RKRIH+ E+A++EL +QKK  E E   +  D++ +E++ RAKIP+AKL QTRLENR  RP +E CRDA Q GL DEV QL  +K  L E+   AR
Sbjct:    1 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWKEILEEDKEKLDKEIENLNNAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQAR 359          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000026429.1 (SMESG000026429.1)

HSP 1 Score: 323.939 bits (829), Expect = 2.182e-103
Identity = 191/193 (98.96%), Postives = 192/193 (99.48%), Query Frame = 1
Query:  130 MTNPYRDFQSSRSSNRLTISEQIDLLRYENNDLKNTIFQLXXXXXXXXXXXXXRLCYVEYTHNSAIEKSSTELESYKFRLKELDEELRKYKYMVNDQASXXXXXXXXXXXXXXRYRVTIQYINVLPTPQESDILTKDMSRLKTEIDRCRSKYDEAEAIIRRLENELGEKSAELANCNDKEIIMKSQMDLLTEK 708
            MTNPYRDFQSSRSSNRLTISEQIDLL YENNDLKNTIFQLKKEKDEIIKIYEDRLCYVEYTHNSAIEKSSTELESYKFRLKE+DEELRKYKYMVNDQASENKNLKEEFKKLEERYRVTIQYINVLPTPQESDILTKDMSRLKTEIDRCRSKYDEAEAIIRRLENELGEKSAELANCNDKEIIMKSQMDLLTEK
Sbjct:    1 MTNPYRDFQSSRSSNRLTISEQIDLLHYENNDLKNTIFQLKKEKDEIIKIYEDRLCYVEYTHNSAIEKSSTELESYKFRLKEMDEELRKYKYMVNDQASENKNLKEEFKKLEERYRVTIQYINVLPTPQESDILTKDMSRLKTEIDRCRSKYDEAEAIIRRLENELGEKSAELANCNDKEIIMKSQMDLLTEK 193          
The following BLAST results are available for this feature:
BLAST of Tektin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEKT24.610e-8542.08tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
TEKT34.041e-3026.65tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT34.041e-3026.65tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT11.885e-2728.13tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534][more]
TEKT43.511e-2326.00tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012][more]
back to top
BLAST of Tektin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tektin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG30852.866e-5130.17gene:FBgn0034816 transcript:FBtr0310344[more]
CG30852.866e-5130.17gene:FBgn0034816 transcript:FBtr0071963[more]
Tektin-A2.760e-2625.83gene:FBgn0028902 transcript:FBtr0080788[more]
Tektin-A2.760e-2625.83gene:FBgn0028902 transcript:FBtr0331277[more]
CG328197.692e-2427.08gene:FBgn0052819 transcript:FBtr0070051[more]
back to top
BLAST of Tektin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt24.735e-8741.55tektin 2 (testicular) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tekt24.735e-8741.55tektin 2 (testicular) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tekt31.305e-3027.09tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt32.068e-3027.09tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt32.068e-3027.09tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
back to top
BLAST of Tektin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt26.206e-8041.40tektin 2 (testicular) [Source:NCBI gene;Acc:493269... [more]
plcd11.611e-3327.65phospholipase C delta 1 [Source:Xenbase;Acc:XB-GEN... [more]
tekt31.541e-2927.62tektin 3 [Source:NCBI gene;Acc:549229][more]
gdf101.860e-2927.91growth differentiation factor 10 [Source:Xenbase;A... [more]
fam168a1.233e-1226.81family with sequence similarity 168 member A [Sour... [more]
back to top
BLAST of Tektin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tekt23.043e-8142.14tektin 2 [Source:MGI Symbol;Acc:MGI:1346335][more]
Tekt23.043e-8142.14tektin 2 [Source:MGI Symbol;Acc:MGI:1346335][more]
Tekt16.524e-2826.53tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
Tekt16.524e-2826.53tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
Tekt16.524e-2826.53tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
back to top
BLAST of Tektin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYM2|TEKT2_RAT4.713e-8541.90Tektin-2 OS=Rattus norvegicus OX=10116 GN=Tekt2 PE... [more]
sp|Q9UIF3|TEKT2_HUMAN2.214e-8442.08Tektin-2 OS=Homo sapiens OX=9606 GN=TEKT2 PE=1 SV=... [more]
sp|Q26648|TKB1_STRPU7.780e-8245.11Tektin-B1 OS=Strongylocentrotus purpuratus OX=7668... [more]
sp|Q4R5V1|TEKT2_MACFA1.031e-8141.15Tektin-2 OS=Macaca fascicularis OX=9541 GN=TEKT2 P... [more]
sp|Q2T9Q6|TEKT2_BOVIN1.144e-8041.90Tektin-2 OS=Bos taurus OX=9913 GN=TEKT2 PE=2 SV=1[more]
back to top
BLAST of Tektin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267D9M01.435e-14053.43Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DEM61.717e-14053.43Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267F8D03.195e-14053.43Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8H0884.166e-14053.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IS052.033e-12553.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Tektin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tekt21.853e-7739.80tektin 2 [Source:NCBI gene;Acc:103026688][more]
tekt33.753e-3429.34tektin 3 [Source:NCBI gene;Acc:103037718][more]
tekt42.219e-1924.50tektin 4 [Source:NCBI gene;Acc:103034475][more]
back to top
BLAST of Tektin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TEKT28.598e-4540.19tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
TEKT22.077e-2733.79tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
back to top
BLAST of Tektin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tektin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO373574.261e-7940.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392925.348e-4229.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406812.048e-3128.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tektin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tekt21.443e-6836.90tektin 2 [Source:NCBI gene;Acc:101164907][more]
tekt38.998e-3227.62tektin 3 [Source:NCBI gene;Acc:101160513][more]
tekt41.725e-2425.00tektin 4 [Source:NCBI gene;Acc:101173527][more]
back to top
BLAST of Tektin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026446.10.000e+0100.00SMESG000026446.1[more]
SMESG000026445.10.000e+097.42SMESG000026445.1[more]
SMESG000065255.12.277e-10850.14SMESG000065255.1[more]
SMESG000050057.12.277e-10850.14SMESG000050057.1[more]
SMESG000026429.12.182e-10398.96SMESG000026429.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013257 ID=SMED30013257|Name=Tektin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=3025bp
ATTTAAAATACATATATTTTAACATATTTTTATAAGTTAACTTCAGAATT
AATTAAGATAAAATTTTTCTAATATAAAGTTTATAAAACTACTGAATTAA
ATATATACAAATTATTATAGCGTATTGTAATGACTAATCCATACAGAGAT
TTCCAAAGTTCCAGATCTTCAAACAGACTCACTATTTCCGAGCAAATAGA
CTTGCTTCGTTATGAGAATAATGATTTAAAAAACACTATTTTTCAATTAA
AAAAGGAAAAAGATGAAATAATTAAGATTTATGAAGATAGATTATGTTAT
GTCGAGTATACACATAATTCTGCGATAGAAAAGAGTTCAACTGAGTTGGA
ATCATATAAATTTCGGTTAAAAGAATTGGATGAAGAATTGAGAAAGTATA
AATACATGGTCAATGATCAAGCTTCTGAAAATAAGAATTTGAAGGAAGAA
TTTAAAAAACTAGAAGAACGTTATCGAGTAACTATTCAATATATAAATGT
TCTTCCAACTCCGCAGGAATCAGATATACTAACTAAAGATATGAGTCGAT
TGAAAACAGAAATTGATCGATGTAGATCAAAATATGACGAAGCAGAAGCT
ATTATTAGACGATTGGAAAATGAACTTGGTGAGAAATCCGCAGAATTGGC
TAATTGCAATGACAAGGAAATCATTATGAAATCTCAGATGGATTTATTAA
CCGAAAAATTATCACGGGTAAAGTGTTCATCAATGATAAAAGAAGAGAAA
ACAGTTGGTGATTGGGATTTTTCTACGGATTTATTCGGTGATATGCATAT
GACAATCCGGAAGTATCGAGACGAATTGAGCAATTGTAAACAGTTAATCG
AATCCGAGAAGACCAAACATCTTAACAGTGCAATTAATAATCAAAAAAGA
ATGGATGAACTACAAATGCAATTGGAATCGGAAATTGACACTGTAACAAC
TTTGAGAAAGGAAATTGAATATAAACAATCTTCGATTTCAGAATTGGAAA
AATCATTAAAAATGGTCATCCACCAAAAACAGGACATAATGGGAAATATG
ATAGATTTAACGAGTGAAGTTGAAAGAATGGATGTAATGGGAAATGATGA
AATGCAAACGTTGTATAAAAGACTGGTTAGTGAAGTTGAAATGTCCGTGA
AAGAAACAGAAATAATATCTCAGTGCCTTTATAAATTATTTAACAAGGAA
GATGTTGACATATCAATGCTAATAAACTGTTCAGAATTCGATAATTTATC
AATCGAAGATTTTGATGAAAAATTGCTTGATAAGTATTATTTATTAGCTC
AATTAGAATCAGTCAAAGAAACTCGTTTAAAACTTTCAGAAATAAAAAAT
TCATTATTACAATATTGTACAAATAATATGGCTGCTGATGTTAAGTTTTG
TTTAACACAATAAAAATTACTGGCAATTGATAGTCATTTAATATCTTTGT
TTTATTTTAGTGTTTCTATAGTTACATTTAAGGTCACATTTTATTAGTCT
GTCTGCATTTTTAATTTGATATTTGAGAATGGCTACTGAAAGTAGACCTG
TTAAAGAATATGCACCCGGTGAATGGTTTTCTGATGCTTATGAGTTGAGT
AAAAATAGTGAGGAGAAACGAGATATATCTGAGAAAGCTAGGCAGTTGGG
TCGTGCAACGAGAATTGAAACTGATTTAAAAACTAAAACCGATCAGCTTG
ATAGTAATACTAGGCTTTCAGATCGGATTGATATCATTCGTCGATGGCGT
GAATTACTTGACAAAACAAAGACAAATCTTGACAAAGAAATCCAAGCATT
AAGTGAAACTAAAGAAGAAATGGAGCATCAATTAGAAGATAAAAATATAA
ACGAAGATATTGTCAATGAATGCATTAATAATCGAGACTGTCGTAGAGGG
ATTGAAAACGTTAATGACGATGGTCAAATGGAACTAAGAAATGAACAAAA
TCTTATTGCTGAATGCAAGAAATTACTGCAGAGTAAGATCGACGATGCTT
TTGAACAGCTTTGTCGTATGCAAGAAGCACGTGAAGAATTTTTTGGAGAT
TTACAGGATAAAACTACAGCTTTAGAAATAGATATTACTCAATATAATAT
GAACGAAAAGTCATCTCATATTTCATATAAACCAAATCCTACCAGAAAAC
CCAAAATGAGTACTGATCCTCAGGAATGGGAAGATTTCAGTCGATATAGC
ATCAACAGAGCGAAAACCGAAATGGTTAAAGGTCAAAGAACTCGAGAGGA
TTTGCATTACACAGCTCACAAAGTTGATGATATGCTGGATCATCAAAGTC
AAAGAACAGAATATGCATTGCGAAAGAGAATTCATGAATTAGAACAAGCA
GTTAACGAATTGGAATATCAAAAGAAATTGACGGAAAAAGAACGAGAAGA
ACTATTGGATGACATTAAAGCCTTAGAAGAAGCTGCTAGGGCTAAAATCC
CAAGTGCAAAATTGACACAAACCCGTCTGGAGAACCGTTTAGAAAGACCT
AGAATGGAGCAGTGTCGAGATGCCGCACAAGAAGGCTTAGTTGATGAAGT
TGGTCAATTGGCTGACAGCAAAGAAACTTTAGAGGAAAGATTAGCCAATG
CTAGAAATGCACTGGATGGGGTGGACAAGAAATTAGCTGAAATCAATGAT
AATCTCAATGGAAAGAAGCATGCGTTGTTAATGGACAAAATGAGCCTTGA
TTATCGATTGCGGCTGAAGTCAGTCCCAATGACTCGCACACCGTGTAACA
TGATTCCGTTTGGAATTATGCGCGAGAAAAGTGTTGTAGTTCGATAAATG
CTTAAAGCAAAACGCGTATGCTGTGTAAATTTTTATCATTTAGGCTGTTA
TTTGGATTTTATTACTTTAGTTGATTCATTTATTTCATTTTTGTAAGAGA
GAATAACGAACTACCCGTTGTTTTGTGACTGGATGTGATAGGTTTGAGGT
GTCACGCTTACTGTGTCTTACAGATGCTGATAATGTATCGAATATTGGTT
AAATACATATTTGAGAGATCGGAAG
back to top

protein sequence of SMED30013257-orf-1

>SMED30013257-orf-1 ID=SMED30013257-orf-1|Name=SMED30013257-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MTNPYRDFQSSRSSNRLTISEQIDLLRYENNDLKNTIFQLKKEKDEIIKI
YEDRLCYVEYTHNSAIEKSSTELESYKFRLKELDEELRKYKYMVNDQASE
NKNLKEEFKKLEERYRVTIQYINVLPTPQESDILTKDMSRLKTEIDRCRS
KYDEAEAIIRRLENELGEKSAELANCNDKEIIMKSQMDLLTEKLSRVKCS
SMIKEEKTVGDWDFSTDLFGDMHMTIRKYRDELSNCKQLIESEKTKHLNS
AINNQKRMDELQMQLESEIDTVTTLRKEIEYKQSSISELEKSLKMVIHQK
QDIMGNMIDLTSEVERMDVMGNDEMQTLYKRLVSEVEMSVKETEIISQCL
YKLFNKEDVDISMLINCSEFDNLSIEDFDEKLLDKYYLLAQLESVKETRL
KLSEIKNSLLQYCTNNMAADVKFCLTQ*
back to top

protein sequence of SMED30013257-orf-2

>SMED30013257-orf-2 ID=SMED30013257-orf-2|Name=SMED30013257-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=423bp
MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDL
KTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEH
QLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLL
QSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISY
KPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVD
DMLDHQSQRTEYALRKRIHELEQAVNELEYQKKLTEKEREELLDDIKALE
EAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKET
LEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVP
MTRTPCNMIPFGIMREKSVVVR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005815microtubule organizing center
GO:0031514motile cilium
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0036126sperm flagellum
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR040210Cep85/Cep85L
IPR000435Tektin
Vocabulary: biological process
TermDefinition
GO:0030317flagellated sperm motility
GO:0036159inner dynein arm assembly
GO:0060271cilium morphogenesis
GO:0060294cilium movement involved in cell motility
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 66..121
NoneNo IPR availableCOILSCoilCoilcoord: 258..278
NoneNo IPR availableCOILSCoilCoilcoord: 226..246
NoneNo IPR availableCOILSCoilCoilcoord: 138..179
NoneNo IPR availablePANTHERPTHR31075:SF4coord: 26..403
IPR040210Cep85/Cep85LPANTHERPTHR31075FAMILY NOT NAMEDcoord: 26..403