Sulfite oxidase

Overview
NameSulfite oxidase
Smed IDSMED30013244
Length (bp)1841
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sulfite oxidase (SMED30013244) t-SNE clustered cells

Violin plots show distribution of expression levels for Sulfite oxidase (SMED30013244) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sulfite oxidase (SMED30013244) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sulfite oxidase (SMED30013244) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013244

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30013244h1SMcG0006561 dd_Smed_v4_7113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sulfite oxidase vs. Ensembl Human
Match: SUOX (sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460])

HSP 1 Score: 463.381 bits (1191), Expect = 4.309e-157
Identity = 242/501 (48.30%), Postives = 340/501 (67.86%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G     +    + A  +T +YTKEE+  H + ETG+WVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L + +IGE+  +P +K    ++  DP+  DP RHPALKV +Q+PFNAE P ELL EN++TPNP+FF RNHLPVP +D + +RL V G     + ++L +D++ N      +  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H   L E  A H+ FEGLD DP G  YGASIP+  A+DP+++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D++ VD+ S P+I E  VQSAI+EP+DG+ + + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW LW+ + PV    +++ I+CKAVD   N QP++    WN+RG+L+NAWHR++V
Sbjct:   57 VMGTLLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVH-NQSHVRELLAQYKIGEL--NPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVG-APGGQSLSLSLDDLHNFPRYE-ITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGH--QLCETEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVES-GEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRP------RKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHV 541          
BLAST of Sulfite oxidase vs. Ensembl Human
Match: SUOX (sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460])

HSP 1 Score: 463.381 bits (1191), Expect = 4.309e-157
Identity = 242/501 (48.30%), Postives = 340/501 (67.86%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G     +    + A  +T +YTKEE+  H + ETG+WVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L + +IGE+  +P +K    ++  DP+  DP RHPALKV +Q+PFNAE P ELL EN++TPNP+FF RNHLPVP +D + +RL V G     + ++L +D++ N      +  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H   L E  A H+ FEGLD DP G  YGASIP+  A+DP+++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D++ VD+ S P+I E  VQSAI+EP+DG+ + + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW LW+ + PV    +++ I+CKAVD   N QP++    WN+RG+L+NAWHR++V
Sbjct:   57 VMGTLLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVH-NQSHVRELLAQYKIGEL--NPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVG-APGGQSLSLSLDDLHNFPRYE-ITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGH--QLCETEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVES-GEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRP------RKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHV 541          
BLAST of Sulfite oxidase vs. Ensembl Human
Match: SUOX (sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460])

HSP 1 Score: 463.381 bits (1191), Expect = 4.309e-157
Identity = 242/501 (48.30%), Postives = 340/501 (67.86%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G     +    + A  +T +YTKEE+  H + ETG+WVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L + +IGE+  +P +K    ++  DP+  DP RHPALKV +Q+PFNAE P ELL EN++TPNP+FF RNHLPVP +D + +RL V G     + ++L +D++ N      +  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H   L E  A H+ FEGLD DP G  YGASIP+  A+DP+++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D++ VD+ S P+I E  VQSAI+EP+DG+ + + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW LW+ + PV    +++ I+CKAVD   N QP++    WN+RG+L+NAWHR++V
Sbjct:   57 VMGTLLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVH-NQSHVRELLAQYKIGEL--NPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVG-APGGQSLSLSLDDLHNFPRYE-ITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGH--QLCETEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVES-GEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRP------RKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHV 541          
BLAST of Sulfite oxidase vs. Ensembl Human
Match: SUOX (sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460])

HSP 1 Score: 463.381 bits (1191), Expect = 4.309e-157
Identity = 242/501 (48.30%), Postives = 340/501 (67.86%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G     +    + A  +T +YTKEE+  H + ETG+WVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L + +IGE+  +P +K    ++  DP+  DP RHPALKV +Q+PFNAE P ELL EN++TPNP+FF RNHLPVP +D + +RL V G     + ++L +D++ N      +  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H   L E  A H+ FEGLD DP G  YGASIP+  A+DP+++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D++ VD+ S P+I E  VQSAI+EP+DG+ + + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW LW+ + PV    +++ I+CKAVD   N QP++    WN+RG+L+NAWHR++V
Sbjct:   57 VMGTLLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVH-NQSHVRELLAQYKIGEL--NPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVG-APGGQSLSLSLDDLHNFPRYE-ITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGH--QLCETEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVES-GEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRP------RKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHV 541          
BLAST of Sulfite oxidase vs. Ensembl Human
Match: SUOX (sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460])

HSP 1 Score: 463.381 bits (1191), Expect = 4.309e-157
Identity = 242/501 (48.30%), Postives = 340/501 (67.86%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G     +    + A  +T +YTKEE+  H + ETG+WVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L + +IGE+  +P +K    ++  DP+  DP RHPALKV +Q+PFNAE P ELL EN++TPNP+FF RNHLPVP +D + +RL V G     + ++L +D++ N      +  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H   L E  A H+ FEGLD DP G  YGASIP+  A+DP+++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D++ VD+ S P+I E  VQSAI+EP+DG+ + + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW LW+ + PV    +++ I+CKAVD   N QP++    WN+RG+L+NAWHR++V
Sbjct:   57 VMGTLLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVH-NQSHVRELLAQYKIGEL--NPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVG-APGGQSLSLSLDDLHNFPRYE-ITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGH--QLCETEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVES-GEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRP------RKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHV 541          
BLAST of Sulfite oxidase vs. Ensembl Celegans
Match: suox-1 (SUlfite OXidase [Source:UniProtKB/TrEMBL;Acc:Q9XTQ8])

HSP 1 Score: 447.973 bits (1151), Expect = 1.805e-151
Identity = 230/475 (48.42%), Postives = 315/475 (66.32%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI-VNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDF-DKVDYSSMPAIIEPNVQSAISEPQ-DGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            ++Y +EE+ KH      +WVTYK+ VYD+T+FI  HPGGDKI LAAG AV+P+W+LY+ HK  KEV++IL+   IG++ V D  +     + D F  DPERHPAL V N KPFNAETP  LL ++F TPN LFFVRNHLPVP +  E  RLTVE I  + K ++L ++E+K      ++ S I C+GNRR DM  +K V+GL W   AIS A+WTG++L D L    +   ++ +   +H+ FEG D DP G  YGASIPIE A     +V++A+ MN  ++P DHG PLRVI+PG VGARQVKWL KI++S+KESDS WQQ DY+ FSP ++  D++ ++++P+I E  VQ AI  P  + ++ R D  + + GYAWSG GRGIIR+EVS+DGG TW    +   +            +AW L+++E+ +    ++  I+ KAVD + NTQPE+  G WNVRGL+ NAWHR+ +
Sbjct:   80 QIYKQEEVKKHGKDADRIWVTYKDGVYDVTDFIAMHPGGDKILLAAGAAVDPFWALYSQHK-TKEVLEILEGYRIGKLDVKDVPKP----VADAFSNDPERHPALLVRNSKPFNAETPPSLLTDHFYTPNELFFVRNHLPVPDIKTENHRLTVETI--KGKTVDLSVEELKKKYKSYTIGSVIQCAGNRRADMNQYKKVQGLMWEGTAISNAEWTGVRLRDLLADAGI---DVFDDKIKHVHFEGADVDPTGTPYGASIPIEKARG--DEVIVAYHMNGVDIPRDHGAPLRVIVPGNVGARQVKWLRKIIVSEKESDSHWQQKDYRAFSPAVNIGDELKWNTVPSIQEYPVQCAICSPAPNTKVDRGDETVDISGYAWSGGGRGIIRIEVSVDGGETWNSVEMEQEE-----KQDQEHMYAWTLFKAEVKIPPGVKEFNIIAKAVDRAYNTQPETASGIWNVRGLIHNAWHRVPI 537          
BLAST of Sulfite oxidase vs. Ensembl Celegans
Match: suox-1 (SUlfite OXidase [Source:UniProtKB/TrEMBL;Acc:Q9XTQ8])

HSP 1 Score: 94.3597 bits (233), Expect = 4.199e-22
Identity = 42/78 (53.85%), Postives = 59/78 (75.64%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI 584
            ++Y +EE+ KH      +WVTYK+ VYD+T+FI  HPGGDKI LAAG AV+P+W+LY+ HK  KEV++IL+   IG++
Sbjct:   80 QIYKQEEVKKHGKDADRIWVTYKDGVYDVTDFIAMHPGGDKILLAAGAAVDPFWALYSQHK-TKEVLEILEGYRIGKL 156          
BLAST of Sulfite oxidase vs. Ensembl Fly
Match: shop (gene:FBgn0030966 transcript:FBtr0074655)

HSP 1 Score: 439.884 bits (1130), Expect = 9.076e-148
Identity = 226/486 (46.50%), Postives = 312/486 (64.20%), Query Frame = 3
Query:  327 HQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRND---GFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEK---MEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            H T       Y  EE+ +H + E  +WVTY   VYD+T+F+E+HPGGDKI +AAG A++P+W +Y  H +  EV+++L+   IG +        ++ +  P+  +P+RH  LK  +++PFNAE P  LLAE F TPN LF+VRNHLPVPV++ E + L +EG G ++K + L  D +K L   +SV + IMC GNRR +M   K VKGL W  GA+  AKW+G +L D L    +          +H+ FEG D DP    YGASIP+  ALDP+ DV+LA+EMN+E L  DHG+P+RVI+PG VGAR VKWLT+IV++DKESDS WQQNDYK FSP+ D+D VD+S   AI    V SAI  PQ G  ++ D   G + V+GYAWSG GR I+RV+++ D G +W  A +   +++P   H     + W LW + +PV +   +   +EI  KAVDS+ N QPE F+  WN+RG+LANA+H++ V
Sbjct:  101 HVTNRRELPTYRAEEVEQHNSVEKRIWVTYGLGVYDVTDFVENHPGGDKILMAAGSAIDPFWGIYQQH-NTLEVLELLEGFRIGNLEGLVVTNVDDELGSPWSQEPQRHALLKPASKRPFNAEPPIGLLAEQFYTPNELFYVRNHLPVPVINPEDYELEIEG-GAKDKTLTL--DGIKALPK-HSVTAAIMCGGNRRSEMTKVKAVKGLSWGAGAVGNAKWSGARLCDILREQGVQPDE-----TKHVIFEGADLDPTSHPYGASIPLAKALDPRGDVILAYEMNDEPLSRDHGFPIRVIVPGTVGARNVKWLTRIVVADKESDSHWQQNDYKGFSPSTDWDTVDFSKSDAIQAMPVTSAICTPQPGARVKVDDDEGHITVRGYAWSGGGRKIVRVDLTNDEGVSWHVAEL-EQEEMPDGRH-----YGWSLWTARLPVSEAQRRAGDVEIWAKAVDSAYNVQPEKFEHIWNLRGVLANAYHKVKV 570          
BLAST of Sulfite oxidase vs. Ensembl Fly
Match: Cyt-b5 (gene:FBgn0264294 transcript:FBtr0088905)

HSP 1 Score: 50.0618 bits (118), Expect = 4.399e-7
Identity = 26/82 (31.71%), Postives = 47/82 (57.32%), Query Frame = 3
Query:  348 TKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGG--AVEPYWSLYAVHKDNKEVMDILKELEIGEIV 587
            TK +T+ E+ KH T +   W+   N +YD+T F+  HPGG+++ +   G  A E +  +      + +  D++K+ +IGE+V
Sbjct:    6 TKTFTRAEVAKHNTNK-DTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDV----GHSNDARDMMKKYKIGELV 82          
BLAST of Sulfite oxidase vs. Ensembl Zebrafish
Match: suox (sulfite oxidase [Source:ZFIN;Acc:ZDB-GENE-070718-3])

HSP 1 Score: 477.633 bits (1228), Expect = 2.195e-162
Identity = 255/518 (49.23%), Postives = 351/518 (67.76%), Query Frame = 3
Query:  240 KFSFKVPIYSILMGSFLYFGIKKVSKSFHHQTAY----CATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMG--ARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLI-RNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            KF F +       G+ L + + +    +   +A      +  +YT EE+ KH++ + GVWVTYK  VYDIT F+  HPGGDKI LAAGGA+EPYW+LYAVHK+ + V++IL E +IG ++N  + K+ E  D  DP+  +P RHPAL++ + KPFNAE P+ +LA+N++TP+ +FF RNHLPVP VD E +RL +EG+      +++ + E+K+    +++ +T+ C+GNRR +M   K VKGL W   AIS A W+G  L + L    LHY    E+   A+HIQFEGLD D  G  YGASI +  AL  + DVLLA+EMN E+LP DHGYP+RV++PGVVGAR VKWL +IV+S +ES S WQQNDYK FSP  D+D VD+ S PAI E  +QSAI+ P +G  + R D  + +KGYAWSG GR ++RV+VS+DGG TW  A + HS D+  +    R  WAW LWE ++P+ D  +++EI+CKAVD+S NTQP++    WN+RG+L+NAWHR+ V
Sbjct:   60 KFRFALAGLLAGTGAVLAYKLHQSKVQWAASSAQLPVTSSPPVYTLEEVTKHRSLDNGVWVTYKGDVYDITEFVAMHPGGDKILLAAGGALEPYWALYAVHKE-EHVLEILSEYKIG-VLNPESIKRQESTDPLDPYSGEPSRHPALQINSLKPFNAEPPASVLADNYITPSAIFFKRNHLPVPKVDPETYRLEIEGL--PGGVVSVTLSELKSRFPKHTITATLQCAGNRRSEMNKVKQVKGLNWGIAAISNATWSGASLREVL----LHYGFTPEVAINAKHIQFEGLDKDVTGTAYGASINLNKALSEEGDVLLAYEMNGEDLPPDHGYPVRVVVPGVVGARNVKWLGRIVVSHEESKSHWQQNDYKGFSPGTDWDTVDFKSAPAIQELPIQSAITHPAEGSSVERGDEEVTIKGYAWSGGGREVVRVDVSVDGGNTWHVAKL-HSSDLGRNPAPGRA-WAWKLWEIDVPLPDGAQELEIVCKAVDNSYNTQPDTVGPIWNLRGVLSNAWHRVKV 567          
BLAST of Sulfite oxidase vs. Ensembl Zebrafish
Match: fads2 (fatty acid desaturase 2 [Source:NCBI gene;Acc:140615])

HSP 1 Score: 54.6842 bits (130), Expect = 2.381e-7
Identity = 39/114 (34.21%), Postives = 60/114 (52.63%), Query Frame = 3
Query:  357 YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI-VNDPNE--KKNECIDDPFRTDPERHPALKVVNQKP 683
            YT EE+ KH TK    WV  + KVY+++ +++ HPGG +I    A   A E +    A H + + V   LK L IGE+  ++P++  +KN  + + FR   ER  A      +P
Sbjct:   21 YTWEEVQKH-TKHGDQWVVVERKVYNVSQWVKRHPGGLRILGHYAGEDATEAF---TAFHPNLQLVRKYLKPLLIGELEASEPSQDRQKNAALVEDFRALRERLEAEGCFKTQP 130          
BLAST of Sulfite oxidase vs. Ensembl Zebrafish
Match: fads2 (fatty acid desaturase 2 [Source:NCBI gene;Acc:140615])

HSP 1 Score: 54.6842 bits (130), Expect = 2.381e-7
Identity = 39/114 (34.21%), Postives = 60/114 (52.63%), Query Frame = 3
Query:  357 YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI-VNDPNE--KKNECIDDPFRTDPERHPALKVVNQKP 683
            YT EE+ KH TK    WV  + KVY+++ +++ HPGG +I    A   A E +    A H + + V   LK L IGE+  ++P++  +KN  + + FR   ER  A      +P
Sbjct:   21 YTWEEVQKH-TKHGDQWVVVERKVYNVSQWVKRHPGGLRILGHYAGEDATEAF---TAFHPNLQLVRKYLKPLLIGELEASEPSQDRQKNAALVEDFRALRERLEAEGCFKTQP 130          
BLAST of Sulfite oxidase vs. Ensembl Zebrafish
Match: fads2 (fatty acid desaturase 2 [Source:NCBI gene;Acc:140615])

HSP 1 Score: 54.299 bits (129), Expect = 2.896e-7
Identity = 38/110 (34.55%), Postives = 60/110 (54.55%), Query Frame = 3
Query:  357 YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI-VNDPNE--KKNECIDDPFRTDPERHPALKVV 671
            YT EE+ KH TK    WV  + KVY+++ +++ HPGG +I    A   A E +    A H + + V   LK L IGE+  ++P++  +KN  + + FR   ER  A+  +
Sbjct:   21 YTWEEVQKH-TKHGDQWVVVERKVYNVSQWVKRHPGGLRILGHYAGEDATEAF---TAFHPNLQLVRKYLKPLLIGELEASEPSQDRQKNAALVEDFRALRERLEAIAFM 126          
BLAST of Sulfite oxidase vs. Ensembl Zebrafish
Match: fa2h (fatty acid 2-hydroxylase [Source:ZFIN;Acc:ZDB-GENE-031219-4])

HSP 1 Score: 46.595 bits (109), Expect = 4.303e-6
Identity = 24/90 (26.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query:  345 ATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNE 614
            + + ++++E+ KH TK++  WV    +VYD+T F+  HPGG+ + L   G           H+ ++     +++  IGE+  D  ++  E
Sbjct:    6 SPRFFSEKEVAKHCTKDS-CWVLLGTRVYDVTAFLRMHPGGEALILRRSGKDISLEIEGPPHRHSENARRWMEQYYIGELDRDSTDEDTE 94          
BLAST of Sulfite oxidase vs. Ensembl Xenopus
Match: suox (sulfite oxidase [Source:NCBI gene;Acc:100145725])

HSP 1 Score: 489.574 bits (1259), Expect = 4.704e-167
Identity = 259/572 (45.28%), Postives = 365/572 (63.81%), Query Frame = 3
Query:   96 HRFLNFMANNFLKKICKNNILFHFKNIRFPFCYNENESKKTRNSEESDKFSFKVPIYSILMGSFLYFGI--KKVSKS--FHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIG--TENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRN--DGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINVSFYCE 1781
            HR    M N +L+  C    +F  K       ++     K  N +E+ K+   +    + +G+ L +G+  K+V+++    H  A     LY+K+++ KH + E+ VWVTY+ +V+DIT FIE HPGG +I LAAGGA+EP+W+LY VHK N+ V++ILKE ++GE+    + +K+E +D  DP+  +P RHP LKV + KPFNAE P  +L ENF+TP  LFF RNHLPVP ++   ++L +E     T++K +NL + ++K     + +  T+ C+GNRR +M   K VKGL W+ GAISTA W G +L D L   +  Y       A+H+ FEGLD D  G  YGASI  + A+  +++V+LA+EMN +ELP DHG+PLRVI+PGVVGAR VKWL KI++S +ES S WQQNDYK F+P +D+D VD++S P+I +  VQSAI+EP  GQ +    +G L VKGYAWSG GR I+RV+VS+DGG TW  A +T  K     +      WAW LW+  +P   +     I+CKAVDSS N QP++    WN+RG+L NAWHR++V+   E
Sbjct:   18 HRLQRHMLNLYLRS-CTVESVFDRK-------HSTEARLKAGNGKETTKWGIALTGALLGIGTVLIYGVPKKRVAQAELTTHTVATSTFPLYSKKDVSKHASMESRVWVTYEGEVFDITEFIELHPGGSRIMLAAGGALEPFWALYGVHK-NEHVLEILKEYKVGEL---NSAEKDEPVDESDPYSQEPSRHPVLKVNSMKPFNAEPPPYMLTENFITPTDLFFKRNHLPVPRINPNDYKLEIERPNGKTQDKPLNLTLSDLKTKFPKHEITVTLQCAGNRRSEMSAVKPVKGLDWNSGAISTAHWAGARLRDVL--LEAGYTEDCSQ-AQHVHFEGLDRDMTGTNYGASISFQQAMARENEVILAYEMNGQELPQDHGFPLRVIVPGVVGARNVKWLGKIIVSKEESGSHWQQNDYKGFNPCVDWDNVDFASSPSIQDLPVQSAITEPHPGQKVTPNFEGELTVKGYAWSGGGREIVRVDVSVDGGKTWKVAELTGEKQKTGQA------WAWKLWQLNVPFPSNISDFTIICKAVDSSYNVQPDTVAPIWNLRGVLNNAWHRVHVTVDTE 568          
BLAST of Sulfite oxidase vs. Ensembl Xenopus
Match: cyb5a (cytochrome b5 type A (microsomal) [Source:NCBI gene;Acc:548733])

HSP 1 Score: 50.8322 bits (120), Expect = 4.265e-7
Identity = 31/87 (35.63%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEK 605
            K YT EEI +H   ++  W+   NKVYD+T F+E HPGG+++  + A G A E +  +      + +  ++ KE  IGE+  D   K
Sbjct:    8 KYYTLEEIKQHNHSKS-TWILIHNKVYDVTKFLEEHPGGEEVLREQAGGDATETFEDI----GHSTDARNMSKEFIIGELHPDDRSK 89          
BLAST of Sulfite oxidase vs. Ensembl Xenopus
Match: cyb5a (cytochrome b5 type A (microsomal) [Source:NCBI gene;Acc:548733])

HSP 1 Score: 50.0618 bits (118), Expect = 7.340e-7
Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI 584
            K YT EEI +H   ++  W+   NKVYD+T F+E HPGG+++  + A G A E +  +      + +  ++ KE  IGE+
Sbjct:    8 KYYTLEEIKQHNHSKS-TWILIHNKVYDVTKFLEEHPGGEEVLREQAGGDATETFEDI----GHSTDARNMSKEFIIGEL 82          
BLAST of Sulfite oxidase vs. Ensembl Xenopus
Match: kiaa1671 (KIAA1671 [Source:Xenbase;Acc:XB-GENE-5870967])

HSP 1 Score: 51.9878 bits (123), Expect = 2.354e-6
Identity = 31/89 (34.83%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  357 YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIV-NDPNEKKNE 614
            Y+ EEI KH  K T  W+  + KVY+IT +++ HPGG ++    A   A + +   +A H D   V   LK L +GE+  N+P++ +++
Sbjct:   18 YSWEEIQKHNLK-TDKWLVIERKVYNITQWVKCHPGGMRVIGHYAGEDATDAF---HAFHPDKNFVRKFLKPLYVGELAENEPSQDRDK 102          
BLAST of Sulfite oxidase vs. Ensembl Xenopus
Match: kiaa1671 (KIAA1671 [Source:Xenbase;Acc:XB-GENE-5870967])

HSP 1 Score: 51.6026 bits (122), Expect = 2.756e-6
Identity = 31/89 (34.83%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  357 YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIV-NDPNEKKNE 614
            Y+ EEI KH  K T  W+  + KVY+IT +++ HPGG ++    A   A + +   +A H D   V   LK L +GE+  N+P++ +++
Sbjct:   23 YSWEEIQKHNLK-TDKWLVIERKVYNITQWVKCHPGGMRVIGHYAGEDATDAF---HAFHPDKNFVRKFLKPLYVGELAENEPSQDRDK 107          
BLAST of Sulfite oxidase vs. Ensembl Mouse
Match: Suox (sulfite oxidase [Source:MGI Symbol;Acc:MGI:2446117])

HSP 1 Score: 448.358 bits (1152), Expect = 2.699e-151
Identity = 231/499 (46.29%), Postives = 335/499 (67.13%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G+  V      + +  + ++Y+KE++  H   +TGVWVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L E +IGE+  + +   +    DP+  DP RHPAL++ +Q+PFNAE P ELL E ++TPNP+FF RNHLPVP +D   +RL V G     + ++L +D++      + V  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H   L +  A H+ FEGLD DP G  YGASIP+  A+DP+++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D+D V++   P+I E  +QSAI++PQDG ++ + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW +W+ +  V  + +++ I+CKAVD S N QP++    WN+RG+L+NAWHR++V
Sbjct:   58 VMGTLLGLGVVLVYHEHRCRASQESPRMYSKEDVRSHNNPKTGVWVTLGSEVFDVTKFVDLHPGGPSKLMLAAGGPLEPFWALYAVH-NQPHVRELLAEYKIGELNPEDSMSPSVEASDPYADDPIRHPALRINSQRPFNAEPPPELLTEGYITPNPIFFTRNHLPVPNLDPHTYRLHVVG-APGGQSLSLSLDDLHKFPK-HEVTVTLQCAGNRRSEMSKVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGH--RLCDSEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVESEESYSHWQRRDYKGFSPSVDWDTVNFDLAPSIQELPIQSAITQPQDGAIVES-GEVTIKGYAWSGGGRAVIRVDVSVDGGLTWQEAELEGEEQCP------RKAWAWRIWQLKAQVPAEQKELNIICKAVDDSYNVQPDTVAPIWNLRGVLSNAWHRVHV 542          
BLAST of Sulfite oxidase vs. Ensembl Mouse
Match: Cyb5a (cytochrome b5 type A (microsomal) [Source:MGI Symbol;Acc:MGI:1926952])

HSP 1 Score: 50.447 bits (119), Expect = 1.814e-7
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPY 509
            K YT EEI KHK  ++  WV   +KVYD+T F+E HPGG+++  + A G A E +
Sbjct:   10 KYYTLEEIQKHKDSKS-TWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENF 63          
BLAST of Sulfite oxidase vs. Ensembl Mouse
Match: Cyb5a (cytochrome b5 type A (microsomal) [Source:MGI Symbol;Acc:MGI:1926952])

HSP 1 Score: 50.447 bits (119), Expect = 4.542e-7
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPY 509
            K YT EEI KHK  ++  WV   +KVYD+T F+E HPGG+++  + A G A E +
Sbjct:   10 KYYTLEEIQKHKDSKS-TWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENF 63          
BLAST of Sulfite oxidase vs. Ensembl Mouse
Match: Fads1 (fatty acid desaturase 1 [Source:MGI Symbol;Acc:MGI:1923517])

HSP 1 Score: 51.9878 bits (123), Expect = 1.804e-6
Identity = 30/101 (29.70%), Postives = 49/101 (48.51%), Query Frame = 3
Query:  348 TKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDP---NEKKNECIDDPFR 635
            T+ +T EE+ +   +E   W+    KVY+I++F   HPGG ++    A   A +P+    A H +   V   +  L IGE+  +       KN+ + D FR
Sbjct:   19 TRYFTWEEVAQRSGREKERWLVIDRKVYNISDFSRRHPGGSRVISHYAGQDATDPF---VAFHINKGLVRKYMNSLLIGELAPEQPSFEPTKNKALTDEFR 116          
BLAST of Sulfite oxidase vs. UniProt/SwissProt
Match: sp|P07850|SUOX_CHICK (Sulfite oxidase OS=Gallus gallus OX=9031 GN=SUOX PE=1 SV=3)

HSP 1 Score: 461.07 bits (1185), Expect = 8.464e-157
Identity = 245/469 (52.24%), Postives = 320/469 (68.23%), Query Frame = 3
Query:  357 YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEM-GARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHR 1757
            YT+EE+ +H++ E  VWVT+   V+D+T+F+E HPGG DKI LAAGGA+EP+W+LYAVH +   V+++L++ ++GE+  D      +   DPF  DP RHP L+V +QKPFNAE P+ELLAE FLTPN LFF RNHLPVP V+   +RL V+G G   + ++L + E+++    + V +T+ C+GNRR +M   + VKGL W  GAISTA+W G  L D L    LH     E+ G  H+ FEGLD DP GA YGASIP   AL P +DVLLA+EMN  ELP DH +P+RV++PGVVGAR VKWL ++ +S  ES S WQQNDYK FSP +D+D VDY + PAI E  VQSA+++P+ G  +   G L VKGYAWSG GR ++RV+VS+DGG TW  A +   K  P       + WAW LWE  +PV    E +EI+CKAVDSS N QP+S    WN+RG+L+ AWHR
Sbjct:    7 YTREEVGRHRSPEERVWVTHGTDVFDVTDFVELHPGGPDKILLAAGGALEPFWALYAVHGE-PHVLELLQQYKVGELSPDEAPAAPDA-QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPG--GRTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGASLRDVL----LHAGFPEELQGGEHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHRFPVRVVVPGVVGARSVKWLRRVAVSPDESPSRWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAV-PPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPG------RAWAWALWELTVPVEAGTE-LEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHR 459          
BLAST of Sulfite oxidase vs. UniProt/SwissProt
Match: sp|P51687|SUOX_HUMAN (Sulfite oxidase, mitochondrial OS=Homo sapiens OX=9606 GN=SUOX PE=1 SV=2)

HSP 1 Score: 463.381 bits (1191), Expect = 2.069e-156
Identity = 242/501 (48.30%), Postives = 340/501 (67.86%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G     +    + A  +T +YTKEE+  H + ETG+WVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L + +IGE+  +P +K    ++  DP+  DP RHPALKV +Q+PFNAE P ELL EN++TPNP+FF RNHLPVP +D + +RL V G     + ++L +D++ N      +  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H   L E  A H+ FEGLD DP G  YGASIP+  A+DP+++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D++ VD+ S P+I E  VQSAI+EP+DG+ + + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW LW+ + PV    +++ I+CKAVD   N QP++    WN+RG+L+NAWHR++V
Sbjct:   57 VMGTLLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVH-NQSHVRELLAQYKIGEL--NPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVG-APGGQSLSLSLDDLHNFPRYE-ITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGH--QLCETEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVES-GEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRP------RKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHV 541          
BLAST of Sulfite oxidase vs. UniProt/SwissProt
Match: sp|Q60HD0|SUOX_MACFA (Sulfite oxidase, mitochondrial OS=Macaca fascicularis OX=9541 GN=SUOX PE=2 SV=3)

HSP 1 Score: 461.84 bits (1187), Expect = 9.536e-156
Identity = 238/501 (47.50%), Postives = 336/501 (67.07%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G     +    + A  +T++YTKEE+  H + ETG+WV   ++V+D+T F + HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L + ++GE+  +P +K    ++  DP+  DP RHPALKV +Q+PFNAE P ELL EN++TPNP+FF RNHLPVP +D + +RL + G     + ++L +D++ N      +  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L         L E  A H+ FEGLD DP G  YGASIP+  A+DP++ VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D+D VD+ S P+I E  VQSAI+EP+DG+ + + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW LW+ + PV    +++ I+CKAVD   N QP++    WN+RG+L+NAWHR++V
Sbjct:   57 VMGTLLGLGAVLAYQDHRCRAAQESTRIYTKEEVSSHTSPETGIWVALGSEVFDVTEFADLHPGGPSKLMLAAGGPLEPFWALYAVH-NQSHVRELLAQYKVGEL--NPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHIVG-APGGQSLSLSLDDLHNFPKYE-ITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAKAG---HQLCETEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAGVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWDTVDFDSAPSIQELPVQSAITEPRDGETVES-GEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRP------RKAWAWRLWQLQAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHV 541          
BLAST of Sulfite oxidase vs. UniProt/SwissProt
Match: sp|Q07116|SUOX_RAT (Sulfite oxidase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Suox PE=1 SV=2)

HSP 1 Score: 448.358 bits (1152), Expect = 1.676e-150
Identity = 232/501 (46.31%), Postives = 337/501 (67.27%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGD-KIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ +  G          + +  + ++Y+KE++  H   +TGVWVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L E +IGE+  +P ++ +  ++  DP+  DP RHPAL++ +Q+PFNAE P ELL E+++TPNP+FF RNHLPVP +D + +RL V G     + ++L +D++      + V  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H     E    H+ FEGLD DP G  YGASIP+  A+DPQ++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D+D VD+   P+I E  +QSAI++PQDG  + + G +I+KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW +W+ +  V  + +++ I+CKAVD S N QP++    WN+RG+L+NAWHR++V
Sbjct:   58 VMGTLIGLGAVLAYHDHRCRASQESPRIYSKEDVRSHNNLKTGVWVTLGSEVFDVTKFVDLHPGGQSKLMLAAGGPLEPFWALYAVH-NQPHVRELLAEYKIGEL--NPEDRMSPPLEASDPYSNDPMRHPALRINSQRPFNAEPPPELLTESYITPNPIFFTRNHLPVPNLDPDTYRLHVVG-APGGQSLSLSLDDLHKFPK-HEVTVTLQCAGNRRSEMNKVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGHRLRETEA---HVCFEGLDSDPTGTAYGASIPLARAMDPQAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVESEESYSHWQRRDYKGFSPSVDWDTVDFDLAPSIQELPIQSAITQPQDGTTVES-GEVIIKGYAWSGGGRAVIRVDVSMDGGLTWQEAELEGEEQHP------RKAWAWRIWQLKAHVPAEQKELNIICKAVDDSYNVQPDTVAPIWNLRGVLSNAWHRVHV 542          
BLAST of Sulfite oxidase vs. UniProt/SwissProt
Match: sp|Q8R086|SUOX_MOUSE (Sulfite oxidase, mitochondrial OS=Mus musculus OX=10090 GN=Suox PE=1 SV=2)

HSP 1 Score: 448.358 bits (1152), Expect = 1.888e-150
Identity = 231/499 (46.29%), Postives = 335/499 (67.13%), Query Frame = 3
Query:  273 LMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +MG+ L  G+  V      + +  + ++Y+KE++  H   +TGVWVT  ++V+D+T F++ HPGG  K+ LAAGG +EP+W+LYAVH +   V ++L E +IGE+  + +   +    DP+  DP RHPAL++ +Q+PFNAE P ELL E ++TPNP+FF RNHLPVP +D   +RL V G     + ++L +D++      + V  T+ C+GNRR +M   K VKGL W  GAISTA+W G +L D L A   H   L +  A H+ FEGLD DP G  YGASIP+  A+DP+++VLLA+EMN + LP DHG+P+RV++PGVVGAR VKWL ++ +  +ES S WQ+ DYK FSP++D+D V++   P+I E  +QSAI++PQDG ++ + G + +KGYAWSG GR +IRV+VS+DGG TW  A +   +  P      RK WAW +W+ +  V  + +++ I+CKAVD S N QP++    WN+RG+L+NAWHR++V
Sbjct:   58 VMGTLLGLGVVLVYHEHRCRASQESPRMYSKEDVRSHNNPKTGVWVTLGSEVFDVTKFVDLHPGGPSKLMLAAGGPLEPFWALYAVH-NQPHVRELLAEYKIGELNPEDSMSPSVEASDPYADDPIRHPALRINSQRPFNAEPPPELLTEGYITPNPIFFTRNHLPVPNLDPHTYRLHVVG-APGGQSLSLSLDDLHKFPK-HEVTVTLQCAGNRRSEMSKVKEVKGLEWRTGAISTARWAGARLCDVL-AQAGH--RLCDSEA-HVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVESEESYSHWQRRDYKGFSPSVDWDTVNFDLAPSIQELPIQSAITQPQDGAIVES-GEVTIKGYAWSGGGRAVIRVDVSVDGGLTWQEAELEGEEQCP------RKAWAWRIWQLKAQVPAEQKELNIICKAVDDSYNVQPDTVAPIWNLRGVLSNAWHRVHV 542          
BLAST of Sulfite oxidase vs. TrEMBL
Match: W5NNT2 (Sulfite oxidase OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 1.322e-173
Identity = 245/472 (51.91%), Postives = 328/472 (69.49%), Query Frame = 3
Query:  354 LYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLI-RNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            +YT++++ KH+T E GVWVTY   VYDIT+F+  HPGGDKI LAAGGA+EP+W+LYAVH + + V++IL E ++GE+     +++     DP+ +DP RHPAL+V +QKPFNAE PSE+L+ENF+TP+  FF RNHLPVP VD   +RL + G+      + L ++E+K     ++V +T+ C+GNRR DM   K VKGL W   AIS A W G +L D L    ++   L    ARH+QFEGLD DP G  YGASI +  A+  + DVLLA+EMN E+LP DHGYPLRV++PGVVGAR VKWL KIV+S++ES S WQQNDYK FSP  D+D VD+ + PAI E  VQSAI+ PQ+G ++    G + V+GYAWSG GR ++RV+VS+DGG TW  A + H ++   +     + WAW LWE   P+     ++EI+CKAVDSS N QP++    WN+RG+L+NAWHR+ V
Sbjct:    2 VYTQDDVTKHRTLEDGVWVTYNGSVYDITDFVAVHPGGDKIMLAAGGALEPFWALYAVH-NQEHVLEILAEYKVGELCPGDCKEEGATSADPYSSDPPRHPALRVNSQKPFNAEPPSEILSENFITPSAFFFKRNHLPVPRVDPHAYRLEIHGL--PRGPVCLSLEEIKTKFPKHTVTATLQCAGNRRSDMNRVKQVKGLNWGISAISNATWGGARLRDVL----VYAGYLPGSSARHVQFEGLDVDPTGTPYGASILLGKAVSEEGDVLLAYEMNGEDLPADHGYPLRVVVPGVVGARNVKWLGKIVVSEEESQSHWQQNDYKGFSPGTDWDTVDFKTAPAIQELPVQSAITVPQEGVVLGAGQGTVTVQGYAWSGGGREVVRVDVSLDGGRTWNVARLQHGEEGGAAPAPPNRSWAWTLWELRAPLPPGARELEIVCKAVDSSYNVQPDTVAPIWNLRGVLSNAWHRVRV 466          
BLAST of Sulfite oxidase vs. TrEMBL
Match: A0A1S3P559 (sulfite oxidase, mitochondrial isoform X2 OS=Salmo salar OX=8030 GN=suox PE=4 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 2.861e-171
Identity = 251/514 (48.83%), Postives = 345/514 (67.12%), Query Frame = 3
Query:  279 GSFLYFGIKKVSKSFHHQTAYCATKL------------YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI-VNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLI-RNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSK--DVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINVSF 1772
            G+ L +G+       H QT   AT +            YT++E+ KH++ E GVWVTYK  VYDIT F+  HPGGDKI LAAGGA+EP+W+LYAVH  +  V++IL E ++GE+   D   +++    DP+ TDPERHPAL++ + KPFNAE P+E+L++N++TP+ +FF RNHLPVP VD + +RL VEG+      ++L ++E+K     ++V +T+ C+GNRR +M   K VKGL W   AIS A W+G +L D L A    Y   +     H+QFEGLD D  G  YGASIP+  A+  + DVLLA++MN E+LP DHGYP+RV++PG VGAR VKWL KI++S++ES S WQQNDYK FSP  D+D VD+ S PAI E  +QSAI++P +G ++ R+   + VKGYAWSG GR ++RV+VS+DGG TW  A +  S+   VP  S    + WAW LWE   P+    +++EI+CKAVD+S N QP+S    WN+RG+L+NAWHR+ V+ 
Sbjct:   65 GAVLAYGL------HHSQTEQAATTIVQPIAPASSLPIYTQDEVTKHRSVEEGVWVTYKGSVYDITEFVSMHPGGDKILLAAGGALEPFWALYAVHSQD-HVLEILSEYKVGELSAEDRRMQQSVKSTDPYSTDPERHPALRINSLKPFNAEPPAEILSDNYITPSAIFFKRNHLPVPQVDPKSYRLQVEGV-PGGAPLSLSLEELKTCFPKHTVTATLQCAGNRRSEMNKVKQVKGLNWGIAAISNATWSGARLKDVLLAAG--YMPEVVRQTSHVQFEGLDSDVTGTTYGASIPLNKAVSEEGDVLLAYQMNGEDLPADHGYPVRVVVPGTVGARNVKWLGKIIVSEEESSSHWQQNDYKGFSPATDWDTVDFKSAPAIQELPIQSAITQPAEGAVVERSAEEVTVKGYAWSGGGREVVRVDVSLDGGRTWQVAQLQSSEKGQVPAPSPPPGRAWAWKLWELTAPLPPAAQELEIVCKAVDNSYNMQPDSVAPIWNLRGVLSNAWHRVKVTV 568          
BLAST of Sulfite oxidase vs. TrEMBL
Match: A0A1S3P579 (sulfite oxidase, mitochondrial isoform X1 OS=Salmo salar OX=8030 GN=suox PE=4 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 3.034e-171
Identity = 261/586 (44.54%), Postives = 369/586 (62.97%), Query Frame = 3
Query:   96 HRFLNFMANNFLKK--------ICKNNILFHFKNIRFPFCY-NENESKKTRNSEESDKFSFKVPIYSILMGS--FLYFGIKKVSKSFHHQTAYCATKL------------YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI-VNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLI-RNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSK--DVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINVSF 1772
            HR  N  A   L+         + K   +   + +  P    + +   K+   + S   +++  +  +L G+   L +G+       H QT   AT +            YT++E+ KH++ E GVWVTYK  VYDIT F+  HPGGDKI LAAGGA+EP+W+LYAVH  +  V++IL E ++GE+   D   +++    DP+ TDPERHPAL++ + KPFNAE P+E+L++N++TP+ +FF RNHLPVP VD + +RL VEG+      ++L ++E+K     ++V +T+ C+GNRR +M   K VKGL W   AIS A W+G +L D L A    Y   +     H+QFEGLD D  G  YGASIP+  A+  + DVLLA++MN E+LP DHGYP+RV++PG VGAR VKWL KI++S++ES S WQQNDYK FSP  D+D VD+ S PAI E  +QSAI++P +G ++ R+   + VKGYAWSG GR ++RV+VS+DGG TW  A +  S+   VP  S    + WAW LWE   P+    +++EI+CKAVD+S N QP+S    WN+RG+L+NAWHR+ V+ 
Sbjct:    2 HRTTNTNAMLLLRHCRCLTRVGLLKTQRVQLLQGVALPVAVCSSHRGHKSGQYQRSHGPNWRHALAGLLAGTGAVLAYGL------HHSQTEQAATTIVQPIAPASSLPIYTQDEVTKHRSVEEGVWVTYKGSVYDITEFVSMHPGGDKILLAAGGALEPFWALYAVHSQD-HVLEILSEYKVGELSAEDRRMQQSVKSTDPYSTDPERHPALRINSLKPFNAEPPAEILSDNYITPSAIFFKRNHLPVPQVDPKSYRLQVEGV-PGGAPLSLSLEELKTCFPKHTVTATLQCAGNRRSEMNKVKQVKGLNWGIAAISNATWSGARLKDVLLAAG--YMPEVVRQTSHVQFEGLDSDVTGTTYGASIPLNKAVSEEGDVLLAYQMNGEDLPADHGYPVRVVVPGTVGARNVKWLGKIIVSEEESSSHWQQNDYKGFSPATDWDTVDFKSAPAIQELPIQSAITQPAEGAVVERSAEEVTVKGYAWSGGGREVVRVDVSLDGGRTWQVAQLQSSEKGQVPAPSPPPGRAWAWKLWELTAPLPPAAQELEIVCKAVDNSYNMQPDSVAPIWNLRGVLSNAWHRVKVTV 577          
BLAST of Sulfite oxidase vs. TrEMBL
Match: A0A4W5P487 (Sulfite oxidase OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 4.112e-171
Identity = 250/514 (48.64%), Postives = 343/514 (66.73%), Query Frame = 3
Query:  279 GSFLYFGIKKVSKSFHHQTAYCATKL------------YTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID-DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLI-RNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSK--DVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINVSF 1772
            G+ L +G+       H QT   AT +            YT++E+ KH++ E GVWVTYK  VYDIT F+  HPGGDKI LAAGGA+EP+W+LYAVH  +  V++IL E ++GE+  +   K+      DP+ TDPERHPAL++ + KPFNAE P E+L++N++TP+ +FF RNHLPVP VD + +RL VEG+      + L ++E+K     +++ +T+ C+GNRR +M   K VKGL W   AIS A W+G +L D L A    Y+  +     H+QFEGLD D  G  YGASIP+  A+  + DVLLA++MN E+LP DHGYP+RV++PG VGAR VKWL KI++S++ES S WQQNDYK FSP  D+D VD+ S PAI E  +QSAI++P +G ++ R+   + VKGYAWSG GR ++RV+VS+DGG TW  A +  S+   VP  S    + WAW LWE   P+    +++EI+CKAVD+S N QP+S    WN+RG+L+NAWHR+ V+ 
Sbjct:   74 GAVLAYGL------HHSQTDLAATTIVQPIAPASSLPIYTQDEVTKHRSVEEGVWVTYKGSVYDITEFVSMHPGGDKILLAAGGALEPFWALYAVHSQD-HVLEILSEYKVGELSAEDRRKQQSVKSTDPYSTDPERHPALRINSLKPFNAEPPPEILSDNYITPSAIFFKRNHLPVPQVDPKSYRLQVEGL-PGGAPLRLSLEELKTRFPKHTITATLQCAGNRRSEMNKVKQVKGLNWGIAAISNATWSGARLKDVLLAAG--YRPEVARQTSHVQFEGLDSDVTGTTYGASIPLNKAVSEEGDVLLAYQMNGEDLPADHGYPVRVVVPGTVGARNVKWLGKIIVSEEESSSHWQQNDYKGFSPATDWDTVDFKSAPAIQELPIQSAITQPAEGAVVERSAEEVTVKGYAWSGGGREVVRVDVSLDGGRTWQVAQLLSSEKGQVPAPSPPPGRAWAWKLWELTAPLPPAAQELEIVCKAVDNSYNMQPDSVAPIWNLRGVLSNAWHRVKVTV 577          
BLAST of Sulfite oxidase vs. TrEMBL
Match: A0A556TK38 (Sulfite oxidase, mitochondrial OS=Bagarius yarrelli OX=175774 GN=Baya_1080 PE=4 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 4.687e-171
Identity = 264/547 (48.26%), Postives = 360/547 (65.81%), Query Frame = 3
Query:  144 KNNILFHFKNIRFPFCYNENESKKTRNSE-ESDKFSFKVPIYSILMGSFLYFGI--KKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLI-VKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTS--SHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            K+ I+  F    F   ++ + S+  R S     +++F +       G+ L +G+   K  ++    T   +  +Y++EE+ KH + E G+WVTYK  VYDIT+F+  HPGGDKI LAAG A+EP+W+LYAVH + + V++IL E ++G +  +  +K++    DP+ TDP RHPALKV + KPFNAE P  +L +N++TP+ +FF RNHLPVP VD + +RL +EG+      ++L +DE+K+L    +V +T+ C+GNRR +M   K VKGL W   AIS A W+G  L D L  Y   +   +   A+H+QFEGLD D  G  YGASIP+  A   + DVLLA+EMN E+LP DHG+P+RVI+PGVVGAR VKWL KIVIS+ ES S WQQNDYK FSP  D+D VD+ S PAI E  VQSAI+   DG LI  D   I VKGYAWSG GR I+RV+VS+DGG TW  A + + ++  TS  S    + WAW LWE  IP+    +++E++CKAVDSS NTQP+S    WN+RG+L+N+WHR+NV
Sbjct:   45 KSPIVAVFVRSGFLALHSGSGSRDQRYSSFRRSRYNFAITGLVAGTGAVLAYGLHRNKAEQAAVPVTQTNSLPVYSQEEVTKHCSIEKGIWVTYKGGVYDITDFVTIHPGGDKILLAAGKALEPFWALYAVH-EQEHVLEILSEYKVGVLQAEERKKEDVKSPDPYSTDPPRHPALKVNSLKPFNAEPPPAILTDNYITPSAIFFKRNHLPVPRVDPKTYRLKIEGL--PGGTVSLTLDELKSLFPKRTVTATLQCAGNRRSEMNKVKQVKGLNWEIAAISNATWSGASLRDVL--YHYGFGPEVAAKAQHVQFEGLDMDVTGTAYGASIPLNKATSEEGDVLLAYEMNGEDLPADHGFPVRVIVPGVVGARNVKWLGKIVISENESQSHWQQNDYKGFSPGTDWDTVDFKSAPAIQELPVQSAITNLVDGSLIDRDMENINVKGYAWSGGGREIVRVDVSLDGGKTWQVAKLQNGEEGDTSAPSPPPGRAWAWKLWEITIPLPKGAQELEVVCKAVDSSYNTQPDSVAPIWNLRGVLSNSWHRVNV 586          
BLAST of Sulfite oxidase vs. Ensembl Cavefish
Match: suox (sulfite oxidase [Source:ZFIN;Acc:ZDB-GENE-070718-3])

HSP 1 Score: 474.937 bits (1221), Expect = 4.186e-161
Identity = 249/522 (47.70%), Postives = 347/522 (66.48%), Query Frame = 3
Query:  243 FSFKVPIYSILMGSFLYFGIKKVSKSFHHQ---------TAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLI-RNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSK--DVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            ++ +VP +  ++   +      ++  FHH          T   +  +YT++E+ KH + + G+WVTYK  VYDIT F+  HPGGDKI LAAG A+EP+W+LYAVH   + V++IL E ++G ++   + KK E  +  DP+ TDP RHPAL + + KPFN E P  LL +N++TP+ LFF RNHLPVP +D +K+RL +EG+      ++L ++++K     ++V +T+ C+GNRR DM   K VKGL W   AIS A W+G  L D L  Y   +   +   A+H+QFEGLD D  G  YGASIP+  A+  + DVLLA+EMN E+LP DHGYP+RV++PGVVGAR VKWL KIV+S++ES S WQQNDYK FSP+ID+D VDY S PAI E  VQSAI++P +G ++ R+   + VKGYAWSG GR ++RV+VS+DGG TW  A +   +    P       + WAW LWE  IP+ +  +++E++CKAVDSS N+QP+S    WN+RG+L+NAWHR+ V
Sbjct:   84 YNTRVPKFRYVLTGLVAGTGAVLAYGFHHSKPERAAASVTQTSSLPVYTQDEVSKHSSLDEGIWVTYKGSVYDITKFVSMHPGGDKILLAAGRALEPFWALYAVH-GQEHVLEILSEYKVG-VLRLEDCKKQELSNPADPYSTDPPRHPALVINSSKPFNGEPPPALLTDNYITPSALFFKRNHLPVPQIDPDKYRLQIEGL--PGGAVSLSLEDLKTRFPKHTVTATLQCAGNRRSDMNKVKQVKGLNWGVAAISNATWSGASLRDVLCHYG--FGPEVAAKAQHVQFEGLDRDVTGTSYGASIPLNKAVSEEGDVLLAYEMNGEDLPQDHGYPVRVVVPGVVGARNVKWLGKIVVSEEESQSHWQQNDYKGFSPSIDWDTVDYKSAPAIQELPVQSAITQPAEGAVVDRDMEEVTVKGYAWSGGGREVVRVDVSLDGGKTWHVAELQSGEKGQQPAPPPPPGRAWAWKLWEITIPLPEGAQELELVCKAVDSSYNSQPDSMAPIWNLRGVLSNAWHRVKV 599          
BLAST of Sulfite oxidase vs. Ensembl Cavefish
Match: fads2 (fatty acid desaturase 2 [Source:NCBI gene;Acc:103027972])

HSP 1 Score: 53.9138 bits (128), Expect = 2.841e-7
Identity = 42/143 (29.37%), Postives = 68/143 (47.55%), Query Frame = 3
Query:  345 ATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIV-NDPNE--KKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRN 758
            A  +YT +E+ KH  +    WV  + KVY+++N++  HPGG ++    A   A E +    A H D K V   +K L +GE+  ++P++  KKN  +   F+   E+           FN        AE     +PLFF+ +
Sbjct:   18 ANAVYTWDEVQKHSHRGDQ-WVVIERKVYNVSNWVNRHPGGRRVIGHYAGEDATEAF---TAFHPDQKFVRKFMKPLLVGELAPSEPSQDNKKNAALVADFQALREK-----------FN--------AEGLFRTSPLFFMMH 137          
BLAST of Sulfite oxidase vs. Ensembl Cavefish
Match: cyb5b (cytochrome b5-like [Source:NCBI gene;Acc:103032077])

HSP 1 Score: 47.7506 bits (112), Expect = 4.913e-6
Identity = 30/93 (32.26%), Postives = 52/93 (55.91%), Query Frame = 3
Query:  342 CATKLYTKEEICKHK-TKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGG--AVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKN 611
               K Y+ EE+  H  +K+T  W+   +KVYDIT F+E HPGG+++ L   G  A E +  +      + +  ++L++  IGE+  D  +K++
Sbjct:   29 AGVKYYSLEEVQTHNMSKDT--WLIIHDKVYDITRFLEEHPGGEEVLLEQAGADATESFEDV----GHSTDAREMLQQYYIGELHMDDRKKES 115          
BLAST of Sulfite oxidase vs. Ensembl Cavefish
Match: fa2h (fatty acid 2-hydroxylase [Source:NCBI gene;Acc:103043062])

HSP 1 Score: 49.2914 bits (116), Expect = 7.414e-6
Identity = 27/95 (28.42%), Postives = 50/95 (52.63%), Query Frame = 3
Query:  345 ATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGA-VEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDD 626
            + + +T++E+ +H +KE+  WV    +VYD+T F+  HPGG+ + L   G  + P       H+ ++     +++  IGE+  D  E   E + D
Sbjct:    6 SPRFFTEKEVARHCSKES-CWVLKGTRVYDVTGFLRMHPGGEALILRRSGKDISPELEG-PPHRHSENARRWMEQYYIGELDRDSTEYYTEDLVD 98          
BLAST of Sulfite oxidase vs. Ensembl Sea Lamprey
Match: suox (sulfite oxidase [Source:ZFIN;Acc:ZDB-GENE-070718-3])

HSP 1 Score: 499.204 bits (1284), Expect = 6.105e-173
Identity = 242/478 (50.63%), Postives = 330/478 (69.04%), Query Frame = 3
Query:  336 AYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDG-QLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            A     +YT+ E+ KH+T    +WV+YK  VYDIT F+E HPGGDKI LAAGGA+EP+W++YAVH +N+ V++IL+E  IG +        +  + DP+ TDP R P L++ + KPFNAE PS+LLA+ +LTPN +FF RNHLPVPV+D E +RL V+G+G + + I+L + ++K+    + V +T+ C+GNRR +M   + VKGL W   AI TA+W G+ L D L    +    L + G  H+QFEGLD D  G+ YGAS+P+  ALD ++DVLLA+EMN EELP DHG+PLR I+PG+VGAR VKWL ++++S  ES S WQQNDYK FSP++D+D VDY + PAI E  VQSAI+EP DG +L  N   + V+GYAWSG GR ++RV+VS+DGG TW  A +    +  ++     + WAW LW    P+ +    +EI+CKAVDS+ N QP+SF   WN+RG+LA AWHR+NV
Sbjct:    4 AVTELPIYTEAEVAKHRTPSDKIWVSYKGGVYDITAFVELHPGGDKILLAAGGALEPFWAMYAVH-NNEHVLEILEEYRIGRLDQSSVTAASLDLSDPYSTDPARLPILRINSLKPFNAEPPSQLLADTYLTPNAIFFKRNHLPVPVIDPETYRLEVQGLGMK-RPISLSLHDLKSKFKKHEVVATLQCAGNRRTEMNRVRQVKGLEWGIAAIGTARWGGVLLRDVLLYAGVKEDQLPQNG--HVQFEGLDKDVTGSAYGASVPLHKALDRRADVLLAYEMNGEELPRDHGFPLRAIVPGIVGARNVKWLGRVLLSHDESLSHWQQNDYKGFSPSVDWDTVDYKTAPAIQELPVQSAITEPVDGTELTENADEVTVRGYAWSGGGRSVVRVDVSLDGGRTWQTAELLPPSN-DSAPQDEGRAWAWKLWSLTAPIPNGQRSLEIVCKAVDSAYNVQPDSFAPIWNLRGVLATAWHRVNV 476          
BLAST of Sulfite oxidase vs. Ensembl Sea Lamprey
Match: cyb5b (cytochrome b5 type B [Source:ZFIN;Acc:ZDB-GENE-040426-2614])

HSP 1 Score: 50.8322 bits (120), Expect = 5.867e-8
Identity = 26/97 (26.80%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  354 LYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKL--AAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRT 638
            LY + ++  H    +G W+   + VYD+++F++ HPGG+++ L  A G   E +  +      +++  ++L +  +G +   P+E+KN    D F T
Sbjct:   18 LYRRADVKLHNDTASGTWIILHDSVYDVSSFLDQHPGGEEVLLEQAGGDGTESFEDV----GHSRDARELLPQYLVGHL--HPDERKNTETKDIFIT 108          
BLAST of Sulfite oxidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000362.1 (pep scaffold:Pmarinus_7.0:GL476650:20325:26962:-1 gene:ENSPMAG00000000324.1 transcript:ENSPMAT00000000362.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 1.146e-7
Identity = 21/50 (42.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:  345 ATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGG 494
            A++L + +E+ KH T E+  W+   +KVYD+T+F++ HPGG  + L  GG
Sbjct:    2 ASRLVSLDEVRKHCTSES-TWIVLHDKVYDVTSFLDKHPGGTAVLLDRGG 50          
BLAST of Sulfite oxidase vs. Ensembl Yeast
Match: CYB5 (Cytochrome b5; involved in the sterol and lipid biosynthesis pathways; acts as an electron donor to support sterol C5-6 desaturation [Source:SGD;Acc:S000005055])

HSP 1 Score: 51.9878 bits (123), Expect = 1.099e-8
Identity = 29/80 (36.25%), Postives = 47/80 (58.75%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGG--AVEPYWSLYAVHKDNKEVMDILKELEIGEI 584
            K+Y+ +E+ +H   E   W+   +KVYD++ F + HPGGD+I +  GG  A E +  +   H D  E + +LK L IG++
Sbjct:    3 KVYSYQEVAEHNGPEN-FWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG--HSD--EALRLLKGLYIGDV 77          
BLAST of Sulfite oxidase vs. Ensembl Nematostella
Match: EDO45092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTU7])

HSP 1 Score: 478.019 bits (1229), Expect = 1.262e-164
Identity = 239/471 (50.74%), Postives = 328/471 (69.64%), Query Frame = 3
Query:  363 KEEICKHKTKETGVWVTYKNKVYDITNFIESHPGG-DKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECI----DDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLI-RNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHR 1757
            ++E+ KH  +++ +WVTYK  VYDIT+FI+ HPGG  KI LAAG A+EPYW++YAVHK  +EV++IL+E  IG++ ++     ++ I    DDPF+ DPERHPALK  ++KPFNAE P +LL ++++TPN LFFVRNHLPVPV+D + +R+ V G G   + I L ++E+K     +++ STI C+GNRR DM   K VKGL WS GAISTA+W G  L D L    L   ++  +   H+QFEGLD D  GA YGASIPI+ A+  + DV+LA+EMN +++P DHGYP+R + PG+VGAR VKW++K++ S +ES S WQQNDYK F+P  D+D VD+ S PAI +  V SAI +P  G LI R++  + + GYAWSG GR ++RV+VS+DGG  W  AT+   KD P       + WAW LW + +P+  D  K++++CKAVD S N QP+S    WN+RG+L+NAWHR
Sbjct:    6 EKEVSKHNNRKSRIWVTYKGGVYDITDFIDGHPGGTSKIILAAGAALEPYWAMYAVHK-KEEVLEILEEYRIGDLAHE-----DQVIEFKEDDPFKEDPERHPALKKNSEKPFNAEPPLQLLGDSYITPNELFFVRNHLPVPVIDPKLYRIEVTGEGV--RTIKLSLEELKTKFKKHNIVSTIQCAGNRRSDMNRVKKVKGLDWSEGAISTAEWGGALLKDVLKYAGLSEDDVERLEINHVQFEGLDTDITGATYGASIPIQKAISSRGDVILAYEMNGKDIPRDHGYPVRAVAPGIVGARNVKWVSKVISSKEESPSHWQQNDYKGFAPCTDWDTVDFKSSPAIQDLPVTSAICQPLPGTLISRDEEEITLSGYAWSGGGRRVVRVDVSLDGGKNWSIATL-DGKDQPPG-----RAWAWSLWSTTLPIPPDANKLDVVCKAVDESFNVQPDSVAPIWNLRGVLSNAWHR 462          
BLAST of Sulfite oxidase vs. Ensembl Nematostella
Match: EDO34347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPM8])

HSP 1 Score: 393.66 bits (1010), Expect = 1.593e-131
Identity = 199/473 (42.07%), Postives = 289/473 (61.10%), Query Frame = 3
Query:  369 EICKHKTKETGVWVTYKNKVYDITNFIESHPGGDK-IKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNEC-IDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDM--FNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQ-LIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINVSF 1772
            E+ +H     GVW TY++ VYD+T+FIE HPGG + I LAAG  ++PYW+++  HK  ++++ IL E  IG ++ +  +      +DDP+ TDP+RHPAL V   KPF AE P  LL  + +TP  +F++RNH+PVP+++ + ++L +   G   K     + + K    V    +T+ C+GNR  +M   N +    +G     ISTA+W G+ L D L++  +    +   G +H++ EGLD D  G +Y  SIPI IA+ P  DV+LA+EMN +ELP DHGYP+R ++PGV GAR VKWL ++ +S ++S S WQQ  YK   P  +   VD  +   I E  V S I  P++G+ L+R +  + + GYAWSG GRGI+RV+VS+DGG TW  A++   K        + K WAW LWE   P+    ++MEI+CKAVDSS N QP++    +N RG L NAWHR+NV+ 
Sbjct:    5 EVARHTDSRNGVWTTYEDGVYDLTDFIEQHPGGKRMIMLAAGSRLDPYWNIHDFHK-REDIVKILSEFRIGSLMKEEIKASTLLNLDDPYSTDPKRHPALTVFCNKPFLAEPPLGLLGHSLITPTEVFYIRNHMPVPLINKDGYKLEISAKGVSTKLTFEDLIQFKKRIVV----ATLQCAGNRCNEMAAVNREDFVDVGGGPATISTAQWGGVLLRDVLESVGITDSVVEREGYKHVRLEGLDQDLSGTKYEVSIPIHIAMSPTGDVMLAYEMNGKELPRDHGYPVRCLVPGVAGARSVKWLGRVSLSKQKSQSMWQQTAYKGVPPCANQKTVDLQAAEDINELPVTSVICHPEEGETLLREEEEVTISGYAWSGGGRGIVRVDVSLDGGKTWNTASLDGVK------QPYGKAWAWSLWELTAPLPAHGDRMEIICKAVDSSFNVQPDTVAPIYNYRGYLCNAWHRVNVTL 466          
BLAST of Sulfite oxidase vs. Ensembl Nematostella
Match: EDO34529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP42])

HSP 1 Score: 366.311 bits (939), Expect = 1.056e-119
Identity = 199/534 (37.27%), Postives = 294/534 (55.06%), Query Frame = 3
Query:  324 HHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDK-IKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNEC-IDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDM--FNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYK----------------------------------------------TFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQ-LIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINVSF 1772
            H + +   ++ ++  E+ +H     GVW TY++ VYD+T+FIE HPGG K I LAAG  ++PYW+++  HK + +++ IL E  IG +  +  +      +DDP+  DP+RHPAL V   KPF AE    LL  + +TP  +F++RNH+PVP++D + ++L +   G   K   L  +++K      ++ +T+ C+GNR  +M   N +    +G     ISTA+W G  L D L++  +    +   G +H++ EGLD D  G +Y  SIPI IA+ P  DV+LA+EMN +ELP DHGYP+R ++PGV GAR VKWL ++ +S ++S S WQQ  YK                                                 P  +   VD      I E  V S I  P++G+ ++R +  + + GYAWSG GRGI+RV+VS+DGG TW  A++   K        + K WAW LWE   P+    ++MEI+CKAVDSS N QP++    +N RG L NAWHR+NV+ 
Sbjct:   38 HARNSSSPSRTFSLSEVARHTDARHGVWTTYEDGVYDLTDFIEQHPGGKKMIMLAAGSRLDPYWNIHDFHKRD-DIVKILSEFRIGSLRKEEIKASTLLNLDDPYFRDPKRHPALTVYCNKPFLAEPLLGLLGHSLITPTEVFYIRNHMPVPLIDKDGYKLQISVKGVSTK---LTFEDLKQYKK-RTIVATLQCAGNRCNEMAAVNREDFVDVGGGPATISTAQWGGALLRDVLESVGITDSVVEREGYKHVRLEGLDQDLSGTKYEVSIPIHIAMSPTGDVMLAYEMNGKELPRDHGYPVRCLVPGVAGARSVKWLGRVSLSKQKSQSMWQQTAYKGVPLYANQGVPLYANQVLPLPLQGVPPCANQGVPPCANQVLPLPLQGVPPCANQKTVDLQVAEDIHELPVTSVICHPEEGKTILREEEEVTISGYAWSGGGRGIVRVDVSLDGGKTWNTASLDGVK------QPYGKAWAWSLWELTAPLPAHGDRMEIICKAVDSSFNVQPDTVAPIYNYRGYLCNAWHRVNVTL 560          
BLAST of Sulfite oxidase vs. Ensembl Nematostella
Match: EDO28871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T593])

HSP 1 Score: 359.762 bits (922), Expect = 2.513e-118
Identity = 187/479 (39.04%), Postives = 275/479 (57.41%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDK-IKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNEC-IDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDM--FNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQ-LIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINVSF 1772
            + ++  E+ KH     GVW TY++ VYD+T+FIE HPGG K I LAAG  ++PYW+++  HK + +++ IL E  IG +  +  +      +DDP+  DP+RHPA  +   KPF AE P  LL  + +TP  +F++RNH+PVP++D + ++L +   G   K   L  ++++      ++ +T+ C+GNR  +M   N +    +G     ISTA+W G+ L D L++  +    +   G +H++ EGLD D  G +Y  SIPI IA+ P  DV+LA+EMN +ELP DHGYP+R ++PGV GAR VKWL ++ +S ++S S WQQ  YK   P  +   VD      I E  V S I  P++G+ L+R +  + + GYAWSG GRGI                              + K WAW LWE   P+    ++MEI+CKAVDSS N QP++    +N RG L NAWHR+NV+ 
Sbjct:   32 RTFSLSEVAKHTDARHGVWTTYEDGVYDLTDFIEQHPGGKKMIMLAAGSRLDPYWNIHDFHKRD-DIVKILSEFRIGSLRKEKIKASTGLNLDDPYSRDPKRHPAYTIYCNKPFLAEPPLGLLGHSLITPTEVFYIRNHMPVPLIDKDGYKLEISVKGVSTK---LTFEDLRQYKK-RTIVATLQCAGNRCNEMAAVNREDFVDVGGGPATISTAQWGGVLLRDVLESVGITDSVVEREGYKHVRLEGLDQDLSGTKYEVSIPIHIAMSPTGDVMLAYEMNGKELPRDHGYPVRCLVPGVAGARSVKWLGRVSLSKQKSQSMWQQTAYKGVPPCANQKTVDLQLAEDIHELPVTSVICHPEEGETLLREEKEVTISGYAWSGGGRGI-----------------------------PYGKAWAWSLWELTAPLPAHGDRMEIICKAVDSSFNVQPDTVAPIYNYRGYLCNAWHRVNVTL 476          
BLAST of Sulfite oxidase vs. Ensembl Nematostella
Match: EDO40543 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Y9])

HSP 1 Score: 51.6026 bits (122), Expect = 1.532e-8
Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 3
Query:  351 KLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKL-AAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI 584
            KLYT +E+ K+  K  G W+   NKV+D+T F++ HPGG+++ L  AGG     +       D +E+M+   E  IGE+
Sbjct:    8 KLYTFDEV-KNHNKAGGCWLVIHNKVFDVTKFLDEHPGGEEVLLEQAGGDASESFEDVGHSSDARELMN---EYCIGEL 82          
BLAST of Sulfite oxidase vs. Ensembl Medaka
Match: suox (sulfite oxidase [Source:NCBI gene;Acc:101162594])

HSP 1 Score: 468.003 bits (1203), Expect = 8.952e-159
Identity = 241/474 (50.84%), Postives = 327/474 (68.99%), Query Frame = 3
Query:  354 LYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECID--DPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLI-RNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINV 1766
            ++ +EE+ KH++   GVWVT++  VYDIT+F+  HPGG+KI LAAGGA+EP+W+LYAVH + + V++IL E ++GE+  + + KK E  +  DP+ TDP+RHP L+V + KPFNAE P E+L ++++TP+  FF RNHLPVP VD   ++L VEG+      +   ++++K     + V +T+ C+GNRR +M   K VKGL W   AIS AKW+G +L D L A    +   +   ARH+ FEGLD D  GA YGASIP+  A+  + DVLLA+EMN E++P DHG+P+RV++PGVVGAR VKW+ KI +S +ES S WQQ DYK F P  D++ VDY S PAI E  VQSAI+ P DG LI  +DGFL VKGYAWSG GR ++RV+VS+DGG TW  A +  S +   +     + WAW LWE   P+    +++EI+CKAVDSS N QPE+F   WN+RGLL+NAWHR+ V
Sbjct:   96 VFGQEEVSKHRSLSEGVWVTFRGGVYDITDFVAMHPGGEKILLAAGGALEPFWALYAVH-NQEHVLEILSEYKVGELCAE-DLKKQEPAESSDPYSTDPDRHPVLRVNSLKPFNAEPPPEILTDSYITPSAFFFKRNHLPVPQVDPASYQLQVEGL--PGGAVTFSLEDLKTRFPKHDVTATVQCAGNRRSEMDREKQVKGLSWGISAISNAKWSGARLRDVLLAAG--FGPDVAQWARHVHFEGLDKDVTGAAYGASIPLNKAVSEEGDVLLAYEMNGEKIPPDHGFPVRVVVPGVVGARSVKWVGKIAVSAEESSSHWQQYDYKGFPPGTDWNTVDYKSAPAIQELPVQSAITSPADGALIDSSDGFLTVKGYAWSGGGREVVRVDVSLDGGQTWQVAKLRSSDEAHEAPPPPGRAWAWKLWELTAPLPPPAQELEIICKAVDSSYNVQPETFPPIWNLRGLLSNAWHRVTV 563          
BLAST of Sulfite oxidase vs. Ensembl Medaka
Match: cyb5b (cytochrome b5 [Source:NCBI gene;Acc:101155998])

HSP 1 Score: 51.6026 bits (122), Expect = 1.799e-7
Identity = 27/64 (42.19%), Postives = 38/64 (59.38%), Query Frame = 3
Query:  306 KVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGA 497
            K + S H +T   A K +T EEI  H       W+   +KVYDI++F+E HPGG+++ L  GGA
Sbjct:   12 KSTNSDHCETVDNALKYFTLEEIRVHNMI-NDTWLVIHDKVYDISSFVEEHPGGEEVLLEQGGA 74          
BLAST of Sulfite oxidase vs. Ensembl Medaka
Match: fads2 (fatty acid desaturase 2 [Source:NCBI gene;Acc:101156321])

HSP 1 Score: 54.299 bits (129), Expect = 2.543e-7
Identity = 32/92 (34.78%), Postives = 52/92 (56.52%), Query Frame = 3
Query:  348 TKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIV-NDPNEKKNE 614
            + ++T EE+ KH ++ T  W+    KVY+IT +++ HPGG ++    A   A E +    A H D K V   LK L IGE+   +P++ +N+
Sbjct:   19 SGVFTWEEVQKHSSR-TDQWLVINRKVYNITQWVKRHPGGSRVISHYAGEDATEAF---TAFHPDLKFVQKFLKPLLIGELAPTEPSQDRNK 106          
BLAST of Sulfite oxidase vs. Ensembl Medaka
Match: fads2 (fatty acid desaturase 2-like [Source:NCBI gene;Acc:101156814])

HSP 1 Score: 51.9878 bits (123), Expect = 1.214e-6
Identity = 38/116 (32.76%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  345 ATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKI--KLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEI-VNDPNE--KKNECID---DPFRTDPERHPALKV 668
             T  +T EE+ KH  +    W+  K KVY++TN+ + HPGG ++    A   A E +    A H D   V   LK L IGE+   +P++  +KN+ I    D  R   E+    K 
Sbjct:   15 GTGFFTWEEVQKHSNRNDQ-WLVVKRKVYNVTNWAKRHPGGFRVISHYAGEDATEVF---AAFHPDQDFVQKFLKPLHIGELAATEPSQDREKNDSIIKDFDSLRVQTEKEGLFKA 126          
BLAST of Sulfite oxidase vs. Planmine SMEST
Match: SMESG000033460.1 (SMESG000033460.1)

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 500/502 (99.60%), Postives = 501/502 (99.80%), Query Frame = 3
Query:  276 MGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRINVSFYCE 1781
            MGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVE+SIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLAN WHRINVSFYCE
Sbjct:    1 MGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELLAENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKNLASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDFLDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVLLAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQNDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVKGYAWSGAGRGIIRVELSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVLWESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANVWHRINVSFYCE 502          
BLAST of Sulfite oxidase vs. Planmine SMEST
Match: SMESG000023205.1 (SMESG000023205.1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.329e-8
Identity = 31/88 (35.23%), Postives = 50/88 (56.82%), Query Frame = 3
Query:  354 LYTKEEICKHKTKETGVWVTYKNKVYDITNFIESHPGGDKIKLAAGG--AVEPYWSLYAVHKDNKEVMDILKELEIGEIVNDPNEKKN 611
            +Y   E+ +H + E+  WV   ++VYD+T F+E HPGG+++ L   G  A E +  +     D +E+M   K+ +IG I N+  E KN
Sbjct:    7 IYKLSEVKEHSSNES-CWVVIHDEVYDVTKFLEEHPGGEEVLLEQAGSHATEAFEDV-GHSTDARELM---KQYKIGRIANEDKENKN 89          
The following BLAST results are available for this feature:
BLAST of Sulfite oxidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUOX4.309e-15748.30sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460... [more]
SUOX4.309e-15748.30sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460... [more]
SUOX4.309e-15748.30sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460... [more]
SUOX4.309e-15748.30sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460... [more]
SUOX4.309e-15748.30sulfite oxidase [Source:HGNC Symbol;Acc:HGNC:11460... [more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
suox-11.805e-15148.42SUlfite OXidase [Source:UniProtKB/TrEMBL;Acc:Q9XT... [more]
suox-14.199e-2253.85SUlfite OXidase [Source:UniProtKB/TrEMBL;Acc:Q9XT... [more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
shop9.076e-14846.50gene:FBgn0030966 transcript:FBtr0074655[more]
Cyt-b54.399e-731.71gene:FBgn0264294 transcript:FBtr0088905[more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
suox2.195e-16249.23sulfite oxidase [Source:ZFIN;Acc:ZDB-GENE-070718-3... [more]
fads22.381e-734.21fatty acid desaturase 2 [Source:NCBI gene;Acc:1406... [more]
fads22.381e-734.21fatty acid desaturase 2 [Source:NCBI gene;Acc:1406... [more]
fads22.896e-734.55fatty acid desaturase 2 [Source:NCBI gene;Acc:1406... [more]
fa2h4.303e-626.67fatty acid 2-hydroxylase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
suox4.704e-16745.28sulfite oxidase [Source:NCBI gene;Acc:100145725][more]
cyb5a4.265e-735.63cytochrome b5 type A (microsomal) [Source:NCBI gen... [more]
cyb5a7.340e-736.25cytochrome b5 type A (microsomal) [Source:NCBI gen... [more]
kiaa16712.354e-634.83KIAA1671 [Source:Xenbase;Acc:XB-GENE-5870967][more]
kiaa16712.756e-634.83KIAA1671 [Source:Xenbase;Acc:XB-GENE-5870967][more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Suox2.699e-15146.29sulfite oxidase [Source:MGI Symbol;Acc:MGI:2446117... [more]
Cyb5a1.814e-747.27cytochrome b5 type A (microsomal) [Source:MGI Symb... [more]
Cyb5a4.542e-747.27cytochrome b5 type A (microsomal) [Source:MGI Symb... [more]
Fads11.804e-629.70fatty acid desaturase 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Sulfite oxidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P07850|SUOX_CHICK8.464e-15752.24Sulfite oxidase OS=Gallus gallus OX=9031 GN=SUOX P... [more]
sp|P51687|SUOX_HUMAN2.069e-15648.30Sulfite oxidase, mitochondrial OS=Homo sapiens OX=... [more]
sp|Q60HD0|SUOX_MACFA9.536e-15647.50Sulfite oxidase, mitochondrial OS=Macaca fascicula... [more]
sp|Q07116|SUOX_RAT1.676e-15046.31Sulfite oxidase, mitochondrial OS=Rattus norvegicu... [more]
sp|Q8R086|SUOX_MOUSE1.888e-15046.29Sulfite oxidase, mitochondrial OS=Mus musculus OX=... [more]
back to top
BLAST of Sulfite oxidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5NNT21.322e-17351.91Sulfite oxidase OS=Lepisosteus oculatus OX=7918 PE... [more]
A0A1S3P5592.861e-17148.83sulfite oxidase, mitochondrial isoform X2 OS=Salmo... [more]
A0A1S3P5793.034e-17144.54sulfite oxidase, mitochondrial isoform X1 OS=Salmo... [more]
A0A4W5P4874.112e-17148.64Sulfite oxidase OS=Hucho hucho OX=62062 PE=4 SV=1[more]
A0A556TK384.687e-17148.26Sulfite oxidase, mitochondrial OS=Bagarius yarrell... [more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
suox4.186e-16147.70sulfite oxidase [Source:ZFIN;Acc:ZDB-GENE-070718-3... [more]
fads22.841e-729.37fatty acid desaturase 2 [Source:NCBI gene;Acc:1030... [more]
cyb5b4.913e-632.26cytochrome b5-like [Source:NCBI gene;Acc:103032077... [more]
fa2h7.414e-628.42fatty acid 2-hydroxylase [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
suox6.105e-17350.63sulfite oxidase [Source:ZFIN;Acc:ZDB-GENE-070718-3... [more]
cyb5b5.867e-826.80cytochrome b5 type B [Source:ZFIN;Acc:ZDB-GENE-040... [more]
ENSPMAT00000000362.11.146e-742.00pep scaffold:Pmarinus_7.0:GL476650:20325:26962:-1 ... [more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CYB51.099e-836.25Cytochrome b5; involved in the sterol and lipid bi... [more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450921.262e-16450.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343471.593e-13142.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345291.056e-11937.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288712.513e-11839.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405431.532e-837.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sulfite oxidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
suox8.952e-15950.84sulfite oxidase [Source:NCBI gene;Acc:101162594][more]
cyb5b1.799e-742.19cytochrome b5 [Source:NCBI gene;Acc:101155998][more]
fads22.543e-734.78fatty acid desaturase 2 [Source:NCBI gene;Acc:1011... [more]
fads21.214e-632.76fatty acid desaturase 2-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Sulfite oxidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000033460.10.000e+099.60SMESG000033460.1[more]
SMESG000023205.13.329e-835.23SMESG000023205.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013244 ID=SMED30013244|Name=Sulfite oxidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1841bp
GAAAACAATTTAACTTGAATTGCATAAATAAATTTTAATTTAAAAATTTA
TTGGAAATATTCAATTTTCTCAGTTAAAAATTAGCCTTATTTCGACATCG
TTTCCTAAATTTTATGGCTAATAATTTTCTTAAGAAGATTTGTAAAAATA
ATATTTTATTTCATTTTAAAAATATAAGATTTCCATTTTGCTATAATGAA
AATGAGTCAAAAAAAACCAGAAATTCAGAAGAATCAGATAAATTCAGCTT
TAAAGTTCCAATTTACAGTATTTTAATGGGTAGCTTTTTGTATTTTGGAA
TAAAAAAGGTATCGAAGAGCTTTCATCATCAGACAGCGTATTGTGCAACT
AAGTTGTACACTAAAGAAGAAATTTGCAAACACAAAACAAAAGAAACAGG
AGTGTGGGTCACGTATAAAAATAAAGTCTATGACATAACAAATTTTATTG
AAAGTCATCCGGGTGGGGATAAAATTAAACTTGCTGCCGGAGGGGCTGTC
GAGCCGTATTGGTCACTGTACGCAGTTCACAAAGATAACAAAGAAGTAAT
GGATATTTTAAAAGAACTGGAAATCGGTGAAATAGTCAATGATCCAAATG
AGAAAAAAAATGAGTGCATTGATGATCCTTTCCGTACTGACCCCGAGCGT
CACCCTGCATTGAAAGTTGTCAATCAGAAACCTTTCAATGCCGAGACTCC
CAGTGAATTATTAGCGGAAAATTTCCTCACTCCGAATCCTTTATTCTTCG
TCCGGAATCATCTGCCGGTTCCAGTGGTTGACATAGAAAAATTCCGTTTA
ACAGTGGAAGGAATCGGAACTGAGAATAAGAAAATTAATTTGAAAATAGA
TGAAGTTAAAAATTTGGCTTCTGTCAACAGTGTTGAATCTACTATTATGT
GTTCTGGCAATAGACGCAAGGATATGTTTAATTTTAAACACGTTAAAGGT
TTGGGCTGGAGTTATGGTGCAATATCAACAGCAAAATGGACTGGGATAAA
ATTGGTTGATTTTCTTGATGCATATGATTTGCATTACAAAAATCTCATTG
AAATGGGCGCCAGGCACATTCAATTTGAAGGCCTGGATTTCGATCCAGTT
GGTGCAAGATACGGCGCATCAATTCCTATTGAAATAGCACTCGATCCTCA
ATCAGATGTCCTCTTAGCTTGGGAAATGAATAATGAAGAACTCCCCTTGG
ATCATGGCTATCCACTGCGAGTAATCATTCCAGGTGTTGTAGGAGCCAGA
CAAGTTAAATGGCTTACTAAAATAGTCATAAGTGATAAAGAAAGTGACAG
TTTTTGGCAACAAAATGATTACAAAACTTTTTCTCCAAATATTGACTTTG
ATAAAGTTGATTATTCTTCGATGCCTGCAATTATAGAACCAAATGTACAA
TCTGCCATCAGTGAACCGCAAGATGGACAATTAATTCGTAATGATGGGTT
CTTAATTGTAAAAGGTTATGCTTGGAGTGGTGCAGGCCGCGGGATAATTC
GTGTAGAGGTGTCTATAGACGGAGGCACAACCTGGATTCCAGCAACTATC
ACTCATTCGAAAGATGTCCCAACAAGCAGTCACATCCACAGGAAACAATG
GGCTTGGGTATTGTGGGAATCAGAAATACCAGTCGGCGATGATTGTGAGA
AAATGGAGATCTTATGTAAGGCTGTTGATTCTTCTCAAAACACTCAACCA
GAATCGTTCAAAGGCACTTGGAATGTTCGAGGATTGTTAGCAAATGCTTG
GCATAGAATAAACGTTTCATTTTACTGTGAATGACTTTTAGGATTTTAGA
TGGAAAATCACTTTGTAAAAAATATATATGTAATAAATAGA
back to top

protein sequence of SMED30013244-orf-1

>SMED30013244-orf-1 ID=SMED30013244-orf-1|Name=SMED30013244-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=557bp
MANNFLKKICKNNILFHFKNIRFPFCYNENESKKTRNSEESDKFSFKVPI
YSILMGSFLYFGIKKVSKSFHHQTAYCATKLYTKEEICKHKTKETGVWVT
YKNKVYDITNFIESHPGGDKIKLAAGGAVEPYWSLYAVHKDNKEVMDILK
ELEIGEIVNDPNEKKNECIDDPFRTDPERHPALKVVNQKPFNAETPSELL
AENFLTPNPLFFVRNHLPVPVVDIEKFRLTVEGIGTENKKINLKIDEVKN
LASVNSVESTIMCSGNRRKDMFNFKHVKGLGWSYGAISTAKWTGIKLVDF
LDAYDLHYKNLIEMGARHIQFEGLDFDPVGARYGASIPIEIALDPQSDVL
LAWEMNNEELPLDHGYPLRVIIPGVVGARQVKWLTKIVISDKESDSFWQQ
NDYKTFSPNIDFDKVDYSSMPAIIEPNVQSAISEPQDGQLIRNDGFLIVK
GYAWSGAGRGIIRVEVSIDGGTTWIPATITHSKDVPTSSHIHRKQWAWVL
WESEIPVGDDCEKMEILCKAVDSSQNTQPESFKGTWNVRGLLANAWHRIN
VSFYCE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036400Cyt_B5-like_heme/steroid_sf
IPR036374OxRdtase_Mopterin-bd_sf
IPR008335Mopterin_OxRdtase_euk
IPR001199Cyt_B5-like_heme/steroid-bd
IPR000572OxRdtase_Mopterin-bd_dom
IPR005066MoCF_OxRdtse_dimer
IPR018506Cyt_B5_heme-BS
IPR014756Ig_E-set
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0030151molybdenum ion binding
GO:0020037heme binding
GO:0005515protein binding
GO:0008482sulfite oxidase activity
GO:0043546molybdopterin cofactor binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0042128nitrate assimilation
GO:0006790sulfur compound metabolic process
GO:0070221sulfide oxidation, using sulfide:quinone oxidoreductase
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005758mitochondrial intermembrane space
GO:0005759mitochondrial matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008335Eukaryotic molybdopterin oxidoreductasePRINTSPR00407EUMOPTERINcoord: 534..547
score: 39.37
coord: 183..197
score: 35.56
coord: 377..390
score: 51.9
coord: 285..300
score: 41.11
coord: 423..435
score: 45.64
coord: 494..504
score: 36.77
coord: 463..475
score: 55.04
coord: 344..360
score: 46.01
coord: 519..531
score: 48.21
coord: 361..374
score: 63.81
coord: 449..463
score: 53.63
coord: 204..220
score: 67.06
coord: 259..270
score: 57.59
IPR001199Cytochrome b5-like heme/steroid binding domainSMARTSM01117Cyt_b5_2coord: 82..158
e-value: 8.5E-14
score: 61.8
IPR001199Cytochrome b5-like heme/steroid binding domainPFAMPF00173Cyt-b5coord: 83..157
e-value: 5.1E-12
score: 45.8
IPR001199Cytochrome b5-like heme/steroid binding domainPROSITEPS50255CYTOCHROME_B5_2coord: 79..158
score: 19.013
IPR005066Moybdenum cofactor oxidoreductase, dimerisationPFAMPF03404Mo-co_dimercoord: 422..551
e-value: 1.1E-37
score: 129.1
IPR000572Oxidoreductase, molybdopterin-binding domainPFAMPF00174Oxidored_molybcoord: 216..398
e-value: 6.0E-53
score: 179.0
IPR036400Cytochrome b5-like heme/steroid binding domain superfamilyGENE3DG3DSA:3.10.120.10coord: 77..157
e-value: 1.7E-25
score: 90.6
IPR036400Cytochrome b5-like heme/steroid binding domain superfamilySUPERFAMILYSSF55856Cytochrome b5-like heme/steroid binding domaincoord: 80..160
NoneNo IPR availableGENE3DG3DSA:2.60.40.650coord: 425..554
e-value: 4.7E-42
score: 144.8
NoneNo IPR availablePANTHERPTHR19372:SF7SULFITE OXIDASE, MITOCHONDRIALcoord: 81..553
NoneNo IPR availablePANTHERPTHR19372SULFITE REDUCTASEcoord: 81..553
NoneNo IPR availableCDDcd02111eukary_SO_Mococoord: 182..551
e-value: 1.31897E-171
score: 488.054
IPR036374Oxidoreductase, molybdopterin-binding domain superfamilyGENE3DG3DSA:3.90.420.10coord: 171..424
e-value: 2.6E-96
score: 323.4
IPR036374Oxidoreductase, molybdopterin-binding domain superfamilySUPERFAMILYSSF56524Oxidoreductase molybdopterin-binding domaincoord: 171..419
IPR018506Cytochrome b5, heme-binding sitePROSITEPS00191CYTOCHROME_B5_1coord: 111..118
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 426..552