SMED30013241

Overview
NameSMED30013241
Smed IDSMED30013241
Length (bp)1050
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30013241 (SMED30013241) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30013241 (SMED30013241) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013241 (SMED30013241) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013241 (SMED30013241) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013241

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013241SMESG000000524.1 SmedASXL_032259SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013241SMESG000007775.1 dd_Smed_v4_137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013241SMESG000007775.1 dd_Smed_v4_137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013241SMESG000007775.1 dd_Smed_v4_137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30013241SMESG000007775.1 dd_Smed_v6_137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013241SMESG000007775.1 dd_Smed_v6_137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30013241SMESG000007775.1 dd_Smed_v6_137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30013241SMESG000007775.1 dd_Smed_v4_137_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013241SMESG000007775.1 dd_Smed_v4_137_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013241SMESG000007775.1 dd_Smed_v4_137_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30013241 vs. Ensembl Human
Match: DYNLL2 (dynein light chain LC8-type 2 [Source:HGNC Symbol;Acc:HGNC:24596])

HSP 1 Score: 52.373 bits (124), Expect = 2.645e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 51.9878 bits (123), Expect = 3.249e-8
Identity = 29/69 (42.03%), Postives = 41/69 (59.42%), Query Frame = -2
Query:  426 VEDVFQNLES-NAER--AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 623
            VE   Q LE  N E+  A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   22 VECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 51.9878 bits (123), Expect = 3.249e-8
Identity = 29/69 (42.03%), Postives = 41/69 (59.42%), Query Frame = -2
Query:  426 VEDVFQNLES-NAER--AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 623
            VE   Q LE  N E+  A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   22 VECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 51.9878 bits (123), Expect = 3.249e-8
Identity = 29/69 (42.03%), Postives = 41/69 (59.42%), Query Frame = -2
Query:  426 VEDVFQNLES-NAER--AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 623
            VE   Q LE  N E+  A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   22 VECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 51.9878 bits (123), Expect = 3.249e-8
Identity = 29/69 (42.03%), Postives = 41/69 (59.42%), Query Frame = -2
Query:  426 VEDVFQNLES-NAER--AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 623
            VE   Q LE  N E+  A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   22 VECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 53.9138 bits (128), Expect = 3.024e-9
Identity = 25/84 (29.76%), Postives = 44/84 (52.38%), Query Frame = -2
Query:  426 TIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 677
             I+++  +DD  +   +      +      + A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:    7 VIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 53.9138 bits (128), Expect = 3.024e-9
Identity = 25/84 (29.76%), Postives = 44/84 (52.38%), Query Frame = -2
Query:  426 TIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 677
             I+++  +DD  +   +      +      + A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:    7 VIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 53.9138 bits (128), Expect = 3.024e-9
Identity = 25/84 (29.76%), Postives = 44/84 (52.38%), Query Frame = -2
Query:  426 TIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 677
             I+++  +DD  +   +      +      + A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:    7 VIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070706)

HSP 1 Score: 52.373 bits (124), Expect = 1.127e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070704)

HSP 1 Score: 52.373 bits (124), Expect = 1.127e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0307065)

HSP 1 Score: 52.373 bits (124), Expect = 1.127e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070707)

HSP 1 Score: 52.373 bits (124), Expect = 1.127e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Fly
Match: Cdlc2 (gene:FBgn0026141 transcript:FBtr0077924)

HSP 1 Score: 51.9878 bits (123), Expect = 1.856e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Zebrafish
Match: dynll2a (dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:ZDB-GENE-030828-11])

HSP 1 Score: 52.373 bits (124), Expect = 1.838e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Zebrafish
Match: dynll2b (dynein, light chain, LC8-type 2b [Source:ZFIN;Acc:ZDB-GENE-050320-132])

HSP 1 Score: 52.373 bits (124), Expect = 1.838e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Zebrafish
Match: dynll2a (dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:ZDB-GENE-030828-11])

HSP 1 Score: 52.373 bits (124), Expect = 1.838e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Zebrafish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 51.9878 bits (123), Expect = 2.514e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Zebrafish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 51.9878 bits (123), Expect = 2.514e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Xenopus
Match: dynll2 (dynein light chain LC8-type 2 [Source:NCBI gene;Acc:100038056])

HSP 1 Score: 52.373 bits (124), Expect = 2.398e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Xenopus
Match: dynll1 (dynein light chain LC8-type 1 [Source:NCBI gene;Acc:448652])

HSP 1 Score: 51.6026 bits (122), Expect = 4.189e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 52.373 bits (124), Expect = 1.816e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 52.373 bits (124), Expect = 1.816e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 52.373 bits (124), Expect = 1.816e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Mouse
Match: Dynll1 (dynein light chain LC8-type 1 [Source:MGI Symbol;Acc:MGI:1861457])

HSP 1 Score: 51.9878 bits (123), Expect = 2.230e-8
Identity = 29/69 (42.03%), Postives = 41/69 (59.42%), Query Frame = -2
Query:  426 VEDVFQNLES-NAER--AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 623
            VE   Q LE  N E+  A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   22 VECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Mouse
Match: Dynll1 (dynein light chain LC8-type 1 [Source:MGI Symbol;Acc:MGI:1861457])

HSP 1 Score: 51.9878 bits (123), Expect = 2.230e-8
Identity = 29/69 (42.03%), Postives = 41/69 (59.42%), Query Frame = -2
Query:  426 VEDVFQNLES-NAER--AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 623
            VE   Q LE  N E+  A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   22 VECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. UniProt/SwissProt
Match: sp|Q6BZF8|DYL1_DEBHA (Dynein light chain 1, cytoplasmic OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=DYN2 PE=3 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 5.260e-9
Identity = 28/86 (32.56%), Postives = 48/86 (55.81%), Query Frame = -2
Query:  426 PVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 683
            P+ +++S   ++   RI E+  +   N +   + A  +K +LDQ +   W  IVGK+F +YVTHE+  F +  +G Q    +FK+G
Sbjct:    8 PI-LKASDLPEEMQTRIFELSNEAVSNYKIEKDIATYLKKELDQLYGATWHVIVGKSFGSYVTHEQGFFTYFYIG-QLAFLIFKSG 91          
BLAST of SMED30013241 vs. UniProt/SwissProt
Match: sp|Q22799|DYL1_CAEEL (Dynein light chain 1, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=dlc-1 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.847e-8
Identity = 25/84 (29.76%), Postives = 44/84 (52.38%), Query Frame = -2
Query:  426 TIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 677
             I+++  +DD  +   +      +      + A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:    7 VIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. UniProt/SwissProt
Match: sp|O02414|DYL1_HELCR (Dynein light chain LC6, flagellar outer arm OS=Heliocidaris crassispina OX=1043166 PE=3 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 1.065e-7
Identity = 26/88 (29.55%), Postives = 44/88 (50.00%), Query Frame = -2
Query:  426 EMPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 689
            E    I+++   +D  +   +      +      + A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  V +FK+G
Sbjct:    3 ERKAVIKNADMPEDMQQDAVDCATQALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAVLLFKSG 89          
BLAST of SMED30013241 vs. UniProt/SwissProt
Match: sp|Q24117|DYL1_DROME (Dynein light chain 1, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=ctp PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 1.129e-7
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. UniProt/SwissProt
Match: sp|Q78P75|DYL2_RAT (Dynein light chain 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll2 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 1.270e-7
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. TrEMBL
Match: A0A2G8LHP4 (Dynein light chain OS=Stichopus japonicus OX=307972 GN=BSL78_03349 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.142e-8
Identity = 30/85 (35.29%), Postives = 48/85 (56.47%), Query Frame = -2
Query:  426 VTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 680
            V +++S   DD  +  ++I ++ F   +   + A  IK + D +F   W CIVG+NF +YVTHE   F ++ V  Q  V +FK+G
Sbjct:   44 VVVKNSDMEDDMKEEATKITQEAFDQFKVEKDIAAYIKKEFDSKFGAAWHCIVGRNFGSYVTHETRNFIYMYV-KQVAVLLFKSG 127          
BLAST of SMED30013241 vs. TrEMBL
Match: G8BSQ3 (Dynein light chain OS=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) OX=1071381 GN=TPHA0D02370 PE=3 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.048e-8
Identity = 33/86 (38.37%), Postives = 48/86 (55.81%), Query Frame = -2
Query:  432 EMPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFK 689
            E P+ +++S   DD    I +I  + F   +   + A  IK +LD +F   W  IVGKNF +YVTHE+  F +  +GS T + VFK
Sbjct:    7 ESPI-LKASDINDDMKDEIFKISTEAFNEFKVERDIAGSIKKQLDTKFGNTWHVIVGKNFGSYVTHEKGHFIYFYIGS-TALLVFK 90          
BLAST of SMED30013241 vs. TrEMBL
Match: A0A5K3G490 (Dynein light chain OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.737e-8
Identity = 29/85 (34.12%), Postives = 48/85 (56.47%), Query Frame = -2
Query:  432 MPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFK 686
            M V + SS   + + K  ++++ +         + AK IK+  D+++   W CIVGK+FA YVTHE++ F H  +G+   V +FK
Sbjct:   14 MKVNVRSSDMPEAQQKEAAKVIAEALSIHTKETQVAKTIKSHFDEKYGRAWHCIVGKHFAGYVTHEQNTFMHAHIGN-VSVMLFK 97          
BLAST of SMED30013241 vs. TrEMBL
Match: A0A0F6MV57 (Dynein light chain OS=Spirometra erinaceieuropaei OX=99802 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.568e-8
Identity = 28/84 (33.33%), Postives = 46/84 (54.76%), Query Frame = -2
Query:  426 TIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 677
             ++++  +D+  +R  EI ++         + A  IK   D+EF   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:    7 VVKNADMSDEMQQRAVEIGQEALDKFNIEKDIAAHIKKSFDKEFNPTWHCIVGRNFGSYVTHESKHFIYSYMG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. TrEMBL
Match: A0A0R3TD46 (Dynein light chain OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS4983 PE=3 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 4.088e-8
Identity = 29/84 (34.52%), Postives = 45/84 (53.57%), Query Frame = -2
Query:  426 TIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 677
             I+++  TDD  ++  +  +D         + A  IK + D+ F   W CIVGKNF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   12 VIKNADMTDDMQQKAVDCAQDAMNKYSVEKDVAAHIKKEFDRIFGPTWHCIVGKNFGSYVTHETRHFIYFYMG-QVAILLFKSG 94          
BLAST of SMED30013241 vs. Ensembl Cavefish
Match: ENSAMXT00000047143.1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:103041528])

HSP 1 Score: 52.373 bits (124), Expect = 1.557e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Cavefish
Match: dynll2b (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:103041528])

HSP 1 Score: 52.373 bits (124), Expect = 1.557e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Cavefish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 49.6766 bits (117), Expect = 2.386e-7
Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = -2
Query:  435 EIVEDVFQNLES-NAER--AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVF 629
            + VE   Q LE  N E+  A  IK + D+++   W CIVG+NF +YVTHE   F +  +G + G  V+
Sbjct:   20 DAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQRNGWAVW 87          
BLAST of SMED30013241 vs. Ensembl Yeast
Match: DYN2 (Cytoplasmic light chain dynein, microtubule motor protein; required for intracellular transport and cell division; involved in mitotic spindle positioning; forms complex with dynein intermediate chain Pac11p that promotes Dyn1p homodimerization, potentiates motor processivity; Dyn2p-Pac11p complex important for interaction of dynein motor complex with dynactin complex; acts as molecular glue to dimerize, stabilize Nup82-Nsp1-Nup159 complex module of cytoplasmic pore filaments [Source:SGD;Acc:S000002832])

HSP 1 Score: 49.6766 bits (117), Expect = 1.724e-8
Identity = 26/79 (32.91%), Postives = 42/79 (53.16%), Query Frame = -2
Query:  459 NFEMPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVG 695
            N   P+ +++S  TD   + I  I +D     +   + A  +K +LD ++   W  IVGKNF +YVTHE+  F +  +G
Sbjct:    5 NKSTPI-VKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIG 82          
BLAST of SMED30013241 vs. Ensembl Nematostella
Match: EDO44582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI5])

HSP 1 Score: 52.373 bits (124), Expect = 5.415e-9
Identity = 26/88 (29.55%), Postives = 43/88 (48.86%), Query Frame = -2
Query:  426 EMPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 689
            E    I+++   +D      E      +      + A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:    3 ERKAVIKNADMAEDMQTDAIECATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Medaka
Match: dynll1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101171417])

HSP 1 Score: 52.7582 bits (125), Expect = 9.487e-9
Identity = 25/84 (29.76%), Postives = 44/84 (52.38%), Query Frame = -2
Query:  426 TIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 677
             I+++  ++D  +   E      +      + A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:    7 VIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Medaka
Match: ENSORLT00000005747.2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101162462])

HSP 1 Score: 51.9878 bits (123), Expect = 1.938e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  IK + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Ensembl Medaka
Match: DYNLL2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101174042])

HSP 1 Score: 51.2174 bits (121), Expect = 3.353e-8
Identity = 21/52 (40.38%), Postives = 33/52 (63.46%), Query Frame = -2
Query:  426 AKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 581
            A  +K + D+++   W CIVG+NF +YVTHE   F +  +G Q  + +FK+G
Sbjct:   39 AAYVKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLG-QVAILLFKSG 89          
BLAST of SMED30013241 vs. Planmine SMEST
Match: SMESG000007775.1 (SMESG000007775.1)

HSP 1 Score: 184.111 bits (466), Expect = 1.647e-58
Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = -2
Query:  423 MPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAGY 686
            MPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAGY
Sbjct:    1 MPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAGY 88          
BLAST of SMED30013241 vs. Planmine SMEST
Match: SMESG000008800.1 (SMESG000008800.1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.172e-19
Identity = 36/84 (42.86%), Postives = 56/84 (66.67%), Query Frame = -2
Query:  429 VTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKA 680
            +T+  SK + ++N+ I E V ++F    +N ERAK+IK KLD +F   WQ I+G +F T +THE+ + C +KVG + G+Q+FK 
Sbjct:    8 ITLIDSKMSTEDNEFIVETVGNIFNEKNTNRERAKDIKTKLDIQFGTSWQVIIGLSFTTMITHEQDQICTLKVGEKIGIQMFKT 91          
BLAST of SMED30013241 vs. Planmine SMEST
Match: SMESG000009941.1 (SMESG000009941.1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.448e-18
Identity = 36/85 (42.35%), Postives = 54/85 (63.53%), Query Frame = -2
Query:  426 VTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 680
            + ++ +K   +    I EIV+ VF+  ES  +RA+ IK +LD +FE  W  ++GK F T+VT+EE K+CH+  G  T VQ+FK G
Sbjct:    6 IEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 90          
BLAST of SMED30013241 vs. Planmine SMEST
Match: SMESG000008800.1 (SMESG000008800.1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.465e-17
Identity = 33/74 (44.59%), Postives = 50/74 (67.57%), Query Frame = -2
Query:  429 DENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKA 650
            ++N+ I E V ++F    +N ERAK+IK KLD +F   WQ I+G +F T +THE+ + C +KVG + G+Q+FK 
Sbjct:    4 EDNEFIVETVGNIFNEKNTNRERAKDIKTKLDIQFGTSWQVIIGLSFTTMITHEQDQICTLKVGEKIGIQMFKT 77          
BLAST of SMED30013241 vs. Planmine SMEST
Match: SMESG000008798.1 (SMESG000008798.1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.209e-12
Identity = 28/87 (32.18%), Postives = 52/87 (59.77%), Query Frame = -2
Query:  426 MPVTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 686
            M   +  ++ + ++  ++ EI E  F+  + + +R   IK K+D++F   W  I+GK+F T + +EE  FCH ++ +  GVQV+K+G
Sbjct:    1 MLTKVIETEMSTEKTDQMVEIFEKAFEENDLDCDRVVAIKKKVDEQFGTNWHVIIGKHFITKINYEEDNFCHCRMPNNMGVQVYKSG 87          
The following BLAST results are available for this feature:
BLAST of SMED30013241 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNLL22.645e-842.31dynein light chain LC8-type 2 [Source:HGNC Symbol;... [more]
DYNLL13.249e-842.03dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL13.249e-842.03dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL13.249e-842.03dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL13.249e-842.03dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of SMED30013241 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dlc-13.024e-929.76Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-13.024e-929.76Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-13.024e-929.76Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
back to top
BLAST of SMED30013241 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctp1.127e-842.31gene:FBgn0011760 transcript:FBtr0070706[more]
ctp1.127e-842.31gene:FBgn0011760 transcript:FBtr0070704[more]
ctp1.127e-842.31gene:FBgn0011760 transcript:FBtr0307065[more]
ctp1.127e-842.31gene:FBgn0011760 transcript:FBtr0070707[more]
Cdlc21.856e-842.31gene:FBgn0026141 transcript:FBtr0077924[more]
back to top
BLAST of SMED30013241 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dynll2a1.838e-842.31dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:... [more]
dynll2b1.838e-842.31dynein, light chain, LC8-type 2b [Source:ZFIN;Acc:... [more]
dynll2a1.838e-842.31dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:... [more]
dynll12.514e-842.31dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
dynll12.514e-842.31dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30013241 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dynll22.398e-842.31dynein light chain LC8-type 2 [Source:NCBI gene;Ac... [more]
dynll14.189e-842.31dynein light chain LC8-type 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of SMED30013241 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dynll21.816e-842.31dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll21.816e-842.31dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll21.816e-842.31dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll12.230e-842.03dynein light chain LC8-type 1 [Source:MGI Symbol;A... [more]
Dynll12.230e-842.03dynein light chain LC8-type 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of SMED30013241 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6BZF8|DYL1_DEBHA5.260e-932.56Dynein light chain 1, cytoplasmic OS=Debaryomyces ... [more]
sp|Q22799|DYL1_CAEEL3.847e-829.76Dynein light chain 1, cytoplasmic OS=Caenorhabditi... [more]
sp|O02414|DYL1_HELCR1.065e-729.55Dynein light chain LC6, flagellar outer arm OS=Hel... [more]
sp|Q24117|DYL1_DROME1.129e-742.31Dynein light chain 1, cytoplasmic OS=Drosophila me... [more]
sp|Q78P75|DYL2_RAT1.270e-742.31Dynein light chain 2, cytoplasmic OS=Rattus norveg... [more]
back to top
BLAST of SMED30013241 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8LHP41.142e-835.29Dynein light chain OS=Stichopus japonicus OX=30797... [more]
G8BSQ32.048e-838.37Dynein light chain OS=Tetrapisispora phaffii (stra... [more]
A0A5K3G4902.737e-834.12Dynein light chain OS=Mesocestoides corti OX=53468... [more]
A0A0F6MV573.568e-833.33Dynein light chain OS=Spirometra erinaceieuropaei ... [more]
A0A0R3TD464.088e-834.52Dynein light chain OS=Rodentolepis nana OX=102285 ... [more]
back to top
BLAST of SMED30013241 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000047143.11.557e-842.31dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll2b1.557e-842.31dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll12.386e-739.71dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30013241 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013241 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN21.724e-832.91Cytoplasmic light chain dynein, microtubule motor ... [more]
back to top
BLAST of SMED30013241 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445825.415e-929.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30013241 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dynll19.487e-929.76dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
ENSORLT00000005747.21.938e-842.31dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
DYNLL23.353e-840.38dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
back to top
BLAST of SMED30013241 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007775.11.647e-58100.00SMESG000007775.1[more]
SMESG000008800.16.172e-1942.86SMESG000008800.1[more]
SMESG000009941.16.448e-1842.35SMESG000009941.1[more]
SMESG000008800.15.465e-1744.59SMESG000008800.1[more]
SMESG000008798.12.209e-1232.18SMESG000008798.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013241 ID=SMED30013241|Name=SMED30013241|organism=Schmidtea mediterranea sexual|type=transcript|length=1050bp
TTATTGTTGATGATATACTAGTTTTCACTTTAAATTCATAAAGCACATGA
TAAATTAATTCATTTTCGATAAAATCAATGAAAAACCCAAAAATATACCT
CTTAAACGAATAAAGTGGGAGATTTTACTAATTGAAGTTGAGCAATTAAA
AGTTACATTATTTTTTGTAATTATCTACGACATATGTTTTTAAACTGTTG
CGGGCGTAGAAAAAACAAAATTAAATTGAAGGTCCGCATATTTTAGATTT
TATACGAGTGTTCCGTGAAGTAAAACGTTTAAGAACCACTGGACAAAAAT
ATAATATTACCGCAAAATAAAATACATATTAAAATGTTTNTTTTTTTGAA
AGATAAAATTAAAATTTATTAAAATTTTTCTAACAAGTCATAACATAATT
TGAAAATAAACTATTTTCTTTAATATCCAGCTTTGAAAACTTGGACTCCA
GTTTGAGAACCGACTTTCACATGACAGAATTTATGTTCCTCATGAGTAAC
GTATGTTGCGAAATTCTTTCCAACAATGCATTGCCATGGGCCTTCAAATT
CCTGGTCTAGTTTGGCTTTAATTTCTTTTGCTCGTTCAGCATTTGACTCC
AAATTTTGAAAAACATCTTCGACAATTTCGGAAATTCGTTTATTTTCATC
ATCGGTACATTTGCTACTTTCAATTGTTACTGGCATTTCAAAATTTTATT
TTGCTGNNAATGAAGAAATNNNNNNTANNTNNNNANANNNNNNNNNGTTT
CTGGCTGGCCAGTTATTTGTGTATATATCCGATATTTTTATACAAGCGGC
TATTAATGTAGACCGACTACTGTAAATATGATGCTGCAGTGTTCCTTTTT
ATTAGGCTGACACCGACAGCAAGGGCAACATTGAATGCTTTAGGCGATAT
TTTCACTTTTTGTACGTATGAGACGATTATGAGCCGCAGCGGCCGCCGCC
ATTGCCGCCGCCGCCGCCGCCGCCTCCGCCGCCTCACCTCAGTTTCTGTA
TGTCTAGCACAAATTTTCCTTGGATTATGAATAAATCTTTTTGATTAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR001372Dynein_light_chain_typ-1/2
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 26..46
NoneNo IPR availablePANTHERPTHR11886:SF35DYNEIN LIGHT CHAIN 2, CYTOPLASMICcoord: 4..87
IPR001372Dynein light chain, type 1/2SMARTSM01375Dynein_light_2coord: 1..86
e-value: 2.5E-19
score: 80.2
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 4..85
e-value: 6.9E-20
score: 71.2
IPR001372Dynein light chain, type 1/2PANTHERPTHR11886DYNEIN LIGHT CHAINcoord: 4..87
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 2..87
e-value: 6.9E-20
score: 72.9
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 3..86