Peptidase C50 domain-containing protein

Overview
NamePeptidase C50 domain-containing protein
Smed IDSMED30013237
Length (bp)3473
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase C50 domain-containing protein (SMED30013237) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase C50 domain-containing protein (SMED30013237) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase C50 domain-containing protein (SMED30013237) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase C50 domain-containing protein (SMED30013237) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013237

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013237SMESG000017514.1 SMESG000017512.1 SmedASXL_016572SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013237SMESG000017514.1 SMESG000017512.1 SmedASXL_016572SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30013237SMESG000017514.1 SMESG000017512.1 dd_Smed_v4_6610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013237SMESG000017514.1 SMESG000017512.1 dd_Smed_v4_6610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013237SMESG000017514.1 SMESG000017512.1 dd_Smed_v4_6610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30013237SMESG000017514.1 SMESG000017512.1 dd_Smed_v6_6610_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30013237SMESG000017514.1 SMESG000017512.1 dd_Smed_v4_6610_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013237SMESG000017514.1 SMED_05179_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30013237SMESG000017514.1 SMED_05179_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30013237SMESG000017514.1 SMED_04380_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30013237SMESG000017514.1 SMED_04380_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Human
Match: ESPL1 (extra spindle pole bodies like 1, separase [Source:HGNC Symbol;Acc:HGNC:16856])

HSP 1 Score: 137.887 bits (346), Expect = 5.704e-32
Identity = 79/255 (30.98%), Postives = 122/255 (47.84%), Query Frame = 3
Query: 2640 IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSR 3404
            +++ D+DL ++P ES+       +  +TR+P+   L+ +     +  +                ++P  TFYV+NP + L  TE+     F  +  W+G  G+  +  +  + L   D+ IY GHGAG R+   +    ++      L GC SA   V G  E  G+++ Y+  GCP   G LWDVTDR+ID++T  LL  WL              P AP+  +V  N+   A +LK L G API +GLP   R
Sbjct: 1892 VLVLDKDLQKLPWESM---PSLQALPVTRLPSFRFLLSYSIIKEYGASPVLSQG----------VDPRSTFYVLNPHNNLSSTEEQFRANFSSEAGWRGVVGEVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVRGNLEGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAG-----------PGAPLLYYV--NQARQAPRLKYLIGAAPIAYGLPVSLR 2120          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Celegans
Match: sep-1 (Separin homolog sep-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ED39])

HSP 1 Score: 92.8189 bits (229), Expect = 9.872e-19
Identity = 56/195 (28.72%), Postives = 96/195 (49.23%), Query Frame = 3
Query: 2826 LEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRS-EAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSRE 3407
            L+I+    +Y+++PD+ L ET++ ++  +  + +W+GT G + K  E S  L+ +D   + GHG+G         K  T      L+GC S R   +    +    I+ Y    CP I G LW VTD EID+F ++++ +  E +   T           M      +E  +  +LK LTG A +++GLP  +++
Sbjct:  953 LQIDVQNAYYILDPDNNLGETQKRMVE-YINKFNWEGTVGSAPKSNEISAALSQRDAFFFIGHGSGSSVMPRSVLKQSTCNAISLLMGCGSVRTIPQALGFDGKTAILDYAMAKCPLIVGCLWTVTDGEIDRFLIRMIDDCFEDSKSLTGIDKLRQLSEAM------HEARSKARLKYLTGAAVVMYGLPVVAKQ 1140          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Celegans
Match: sep-1 (Separin homolog sep-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ED39])

HSP 1 Score: 92.8189 bits (229), Expect = 9.872e-19
Identity = 56/195 (28.72%), Postives = 96/195 (49.23%), Query Frame = 3
Query: 2826 LEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRS-EAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSRE 3407
            L+I+    +Y+++PD+ L ET++ ++  +  + +W+GT G + K  E S  L+ +D   + GHG+G         K  T      L+GC S R   +    +    I+ Y    CP I G LW VTD EID+F ++++ +  E +   T           M      +E  +  +LK LTG A +++GLP  +++
Sbjct:  953 LQIDVQNAYYILDPDNNLGETQKRMVE-YINKFNWEGTVGSAPKSNEISAALSQRDAFFFIGHGSGSSVMPRSVLKQSTCNAISLLMGCGSVRTIPQALGFDGKTAILDYAMAKCPLIVGCLWTVTDGEIDRFLIRMIDDCFEDSKSLTGIDKLRQLSEAM------HEARSKARLKYLTGAAVVMYGLPVVAKQ 1140          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Celegans
Match: ZK430.5 (pep chromosome:WBcel235:II:4405864:4416553:1 gene:WBGene00022741.1 transcript:ZK430.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK430.5)

HSP 1 Score: 76.6406 bits (187), Expect = 9.552e-14
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 3
Query: 2826 LEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRS-EAFGMIMYYLTIGCPSIFGLLWDV 3197
            L I     FY+++PD+ L  T++ +L  +  + +W+G+ G + K  E +D L+ +D   Y GHG+G         +  T     FL+GC+S R   +    +   +I  Y    CPS+ G LWDV
Sbjct:  976 LNIGLENAFYILDPDNNLNGTKRRMLK-YINKFNWEGSVGSAPKLTEVTDALSKRDAFFYFGHGSGSSVVTQSLIRQTTCNAISFLMGCESVRTIPQAHGFDGTSVIQDYAMAKCPSLVGCLWDV 1099          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Fly
Match: Sse (gene:FBgn0035627 transcript:FBtr0077125)

HSP 1 Score: 58.151 bits (139), Expect = 4.414e-8
Identity = 41/133 (30.83%), Postives = 54/133 (40.60%), Query Frame = 3
Query: 2856 VINPDDTLPETEQTILPVFKRQTS-WQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEA-FGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWL 3248
            VINPD  L  + + +   F+   S WQ                   D  +Y GHG+G +Y   R        + +FL GC S R    G   A +G   YY    CPSI G L    D  +D  +V +L  WL
Sbjct:  418 VINPDADLVNSGRRLRSFFEYWLSQWQHLFETVPNEEVMVKQALQADCFVYAGHGSGLQYVNGRIICRARVRSVVFLFGCDSTRMLGTGLYSALYGAHDYYHGALCPSIVGTLMPALDGNMDTVSVTILSRWL 550          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Zebrafish
Match: espl1 (extra spindle pole bodies like 1, separase [Source:ZFIN;Acc:ZDB-GENE-030131-5188])

HSP 1 Score: 159.844 bits (403), Expect = 6.730e-39
Identity = 99/291 (34.02%), Postives = 153/291 (52.58%), Query Frame = 3
Query: 2538 NLKSLIDQMRSDWFTDSDLKWLMDEG-SNLIG--EPK---IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLP 3392
            +L+ L++ M      D DL  L+  G + L G  EP+   ++I D+ L R+P E+I       S+ +TRMP++ +++GH   S  R  D+S V        +  +NP + +YV+NPD  LP+TE      F  + +WQG  G++    +  + +  KD+ IY GHGAG R+   +    +   T+  L GC SA  +V G+ E  G+I+ YLT GCP + G LWDVTDR++D+FT  LL +WL   +  +                   ++ +A  LK + G API +GLP
Sbjct: 1917 DLQCLLEGMN---VQDKDLLKLLQRGVAELRGREEPQGHTVLILDKYLQRLPWENIAC---LKSQSVTRMPSLHAVLGH---SHLREVDTSCVL-------SCGVNPKQVYYVLNPDGNLPDTENRFKEWFTGERTWQGVCGRAPDPEKLQEAVTTKDLYIYIGHGAGARFLDAQRVLKVPVRTAALLFGCSSAALSVLGQQEGTGIILSYLTAGCPLVLGNLWDVTDRDLDRFTSALLQSWLSAGSGSS-------------LLQHLAKSRSATHLKHIIGAAPIAYGLP 2178          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Xenopus
Match: ESPL1 (extra spindle pole bodies like 1, separase [Source:NCBI gene;Acc:100158636])

HSP 1 Score: 143.28 bits (360), Expect = 9.633e-34
Identity = 78/255 (30.59%), Postives = 125/255 (49.02%), Query Frame = 3
Query: 2640 IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSR 3404
            +++ D+ L ++P ESI        + +TR+P++  L+ +  Q +++   +              ++P + FYV+NP   LP TE+     FK +  W+G    + K       L  KD+ IY GHGAG  +   +T + +     + L GC S    V G  E  G+++ YL  GCP + G LWDVTDREID++TV  L +WL+               +  P   + +E+  A +LK + G AP+ +GLP   R
Sbjct: 1673 VLVLDKHLQKLPWESIPC---LQKQSVTRLPSLRFLLSYGLQRKYQPETTLMKG----------VDPKQAFYVLNPHANLPGTEERFRDWFKNEPGWKGVIRSAPKSEMIQSALTKKDLYIYVGHGAGAHFLDVQTLQRLHCNAVVLLFGCSSVALAVRGDLEGAGIVLKYLMAGCPLVLGNLWDVTDREIDRYTVAFLQSWLKAG-------------SGAPLLKYLSESRQAPKLKYIIGAAPVAYGLPVALR 1901          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Mouse
Match: Espl1 (extra spindle pole bodies 1, separase [Source:MGI Symbol;Acc:MGI:2146156])

HSP 1 Score: 137.117 bits (344), Expect = 7.215e-32
Identity = 79/251 (31.47%), Postives = 120/251 (47.81%), Query Frame = 3
Query: 2640 IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLP 3392
            +++ D+DL ++P ES  I     ++ +TR+P+           RF  + +        S  +  ++P  TFYV+NP   L  TE+     F  +T W+G  G+     +    L  +D+ IY GHGAG R+   +    ++      L GC SA   V G  E  G+++ Y+  GCP   G LWDVTDR+ID++T  LL  WL              P AP     + ++   A +LK L G AP+ +GLP
Sbjct: 1888 VLVLDKDLQKLPWESTPI---LQAQPVTRLPSF----------RFLLSYTVTKEAGASSVLSQGVDPQNTFYVLNPHSNLSSTEERFRASFSSETGWKGVIGEVPSLDQVQAALTERDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGNLEGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAG-----------PGAPF--LYYASQARQAPRLKYLIGAAPVAYGLP 2112          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Mouse
Match: Espl1 (extra spindle pole bodies 1, separase [Source:MGI Symbol;Acc:MGI:2146156])

HSP 1 Score: 137.117 bits (344), Expect = 7.215e-32
Identity = 79/251 (31.47%), Postives = 120/251 (47.81%), Query Frame = 3
Query: 2640 IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLP 3392
            +++ D+DL ++P ES  I     ++ +TR+P+           RF  + +        S  +  ++P  TFYV+NP   L  TE+     F  +T W+G  G+     +    L  +D+ IY GHGAG R+   +    ++      L GC SA   V G  E  G+++ Y+  GCP   G LWDVTDR+ID++T  LL  WL              P AP     + ++   A +LK L G AP+ +GLP
Sbjct: 1888 VLVLDKDLQKLPWESTPI---LQAQPVTRLPSF----------RFLLSYTVTKEAGASSVLSQGVDPQNTFYVLNPHSNLSSTEERFRASFSSETGWKGVIGEVPSLDQVQAALTERDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGNLEGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAG-----------PGAPF--LYYASQARQAPRLKYLIGAAPVAYGLP 2112          
BLAST of Peptidase C50 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14674|ESPL1_HUMAN (Separin OS=Homo sapiens OX=9606 GN=ESPL1 PE=1 SV=3)

HSP 1 Score: 137.887 bits (346), Expect = 2.739e-31
Identity = 79/255 (30.98%), Postives = 122/255 (47.84%), Query Frame = 3
Query: 2640 IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSR 3404
            +++ D+DL ++P ES+       +  +TR+P+   L+ +     +  +                ++P  TFYV+NP + L  TE+     F  +  W+G  G+  +  +  + L   D+ IY GHGAG R+   +    ++      L GC SA   V G  E  G+++ Y+  GCP   G LWDVTDR+ID++T  LL  WL              P AP+  +V  N+   A +LK L G API +GLP   R
Sbjct: 1892 VLVLDKDLQKLPWESM---PSLQALPVTRLPSFRFLLSYSIIKEYGASPVLSQG----------VDPRSTFYVLNPHNNLSSTEEQFRANFSSEAGWRGVVGEVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVRGNLEGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAG-----------PGAPLLYYV--NQARQAPRLKYLIGAAPIAYGLPVSLR 2120          
BLAST of Peptidase C50 domain-containing protein vs. UniProt/SwissProt
Match: sp|P60330|ESPL1_MOUSE (Separin OS=Mus musculus OX=10090 GN=Espl1 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 5.047e-31
Identity = 79/251 (31.47%), Postives = 120/251 (47.81%), Query Frame = 3
Query: 2640 IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLP 3392
            +++ D+DL ++P ES  I     ++ +TR+P+           RF  + +        S  +  ++P  TFYV+NP   L  TE+     F  +T W+G  G+     +    L  +D+ IY GHGAG R+   +    ++      L GC SA   V G  E  G+++ Y+  GCP   G LWDVTDR+ID++T  LL  WL              P AP     + ++   A +LK L G AP+ +GLP
Sbjct: 1888 VLVLDKDLQKLPWESTPI---LQAQPVTRLPSF----------RFLLSYTVTKEAGASSVLSQGVDPQNTFYVLNPHSNLSSTEERFRASFSSETGWKGVIGEVPSLDQVQAALTERDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGNLEGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAG-----------PGAPF--LYYASQARQAPRLKYLIGAAPVAYGLP 2112          
BLAST of Peptidase C50 domain-containing protein vs. UniProt/SwissProt
Match: sp|P33144|BIMB_EMENI (Separin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bimB PE=4 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 6.007e-23
Identity = 61/189 (32.28%), Postives = 87/189 (46.03%), Query Frame = 3
Query: 2826 LEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLP 3392
            L I+     Y++NP   L  T++T          W G   +     E  D L  K + +Y GHG+G +Y   RT K +      FL+GC S   T  G  E +G  M YL  G P++   LWDVTD++ID+F      +W    N H            + A V  +++  A  LK L G AP+V+G+P
Sbjct: 1876 LSIDRRNGTYILNPTGDLKTTQETFEKDLSSLKGWTGMVNRQPTEDEFKDSLQSKSLFLYFGHGSGAQYIRGRTVKRLDRCAVAFLMGCSSGTLTEAGEYEPYGTPMNYLQAGSPALVATLWDVTDKDIDRFAKATFEHWGLIGNGHRGNEGIGEAGVALDAAV--SQSRGACVLKYLNGAAPVVYGVP 2062          
BLAST of Peptidase C50 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5IBC5|ESP1_ARATH (Separase OS=Arabidopsis thaliana OX=3702 GN=ESP1 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.615e-22
Identity = 65/209 (31.10%), Postives = 111/209 (53.11%), Query Frame = 3
Query: 2631 EPKIIITDRDLCRIPLESI-LIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEK 3254
            EP I++ D ++  +P E+I ++R Q     + RMP++  +   L +   +   +              I+PL +FY++NP   L +T+ T    F+ Q +++G AG     IE ++ L   D+ +Y GHG+G +Y   R  + + + ++ FL+GC S    ++G     G+ + YL  G P+I   LWDVTDR+ID+F   LL  WL++
Sbjct: 1876 EPIILVLDPEVQMLPWENIPILRKQE----VYRMPSVGCISAVLKKRSLQGEPAKSHVASFPL-----IDPLDSFYLLNPGGDLTDTQVTFESWFRDQ-NFEGKAGSEPSAIELTEALETHDLFLYFGHGSGAQYIPRREIEKLDNCSATFLMGCSSGSLWLKGCYIPQGVPLSYLLGGSPAIVATLWDVTDRDIDRFGKALLEAWLQE 2074          
BLAST of Peptidase C50 domain-containing protein vs. UniProt/SwissProt
Match: sp|P18296|CUT1_SCHPO (Separin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut1 PE=1 SV=3)

HSP 1 Score: 94.3597 bits (233), Expect = 4.854e-18
Identity = 64/256 (25.00%), Postives = 118/256 (46.09%), Query Frame = 3
Query: 2640 IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKR---QTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTW 3398
            +++ D+ + + P ES+      N + ++R+P++  L   L QS   N +             +E+      Y++NP   L  T++    +F+    +  W+G         +   +L+  D  +Y GHG G +Y       ++       L+GC S      G  E +G  + YL+ GCP++   LWDVTD++ID+F++K+L +W    N       T +  A        +E+ +   L+ L G AP+++G+P +
Sbjct: 1596 VLVLDKSVHQFPWESL---PCLNRQSVSRVPSLSILRDILSQSFVVNGEY------------VEVRKEAGSYILNPSLDLKHTQE----MFEHKLVEGGWKGLIASQPSNRDFIKMLSGNDFFLYFGHGGGEQYTTSYDLATLKRCAVTILMGCSSGALYECGSFEPWGTPLDYLSAGCPTLVANLWDVTDKDIDRFSLKMLESWGLFENKAPFVNSTSICTAV-------SESRSCCHLRYLNGAAPVIYGIPAY 1825          
BLAST of Peptidase C50 domain-containing protein vs. TrEMBL
Match: A0A4E0R6A8 (Separin OS=Fasciola hepatica OX=6192 GN=D915_007118 PE=4 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.952e-57
Identity = 165/545 (30.28%), Postives = 258/545 (47.34%), Query Frame = 3
Query: 1929 LEEHAAQFKHVNVPVLHRAVYQRLALHYLSSNAGKTA-YYLSLSIGMGFRQLYLSECFMK-ARNKKSEHA---------ERWTQTLEAAFSCME--------NESLMHAKLSELLPANWTVLQFNMIDEIPISCIKSSSLN-NVDGG------CLGARNCAVLLVTKYQNLQIDGEGMKLTTETKVLHGFRKTGMQLLDRFEYVKLESTRRLKISDRKAWWSNRHKMDCNLKSLIDQMRSDWFTDSDLKWLMDE---------GSNLIGEPKIIITDRDLCRIPLESILI--RGQANSK--CITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEI--------NPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSREDIQLP 3422
            +E    +   + VP L R V   L L++L  ++   A  YL+ S+G+    LY+S    + A  K S+ A           W+  L+    C+           +   A       A   V+Q  ++DEI    +   S + +   G       LGARN A L+ T+Y  L    +   L  ET+VLHGF  TG++ LD F+ +++ES   ++I DR  +W  R+K+D  L++++ +M  DWFT  DLKWL+             + +    ++I DR L  +P E IL     ++NS     TR  ++  ++GHL      ++ S   P      +NLEI        NP +TFYV+NP+  L  T+QT  P+F+   +W G   +     E +      D+ IY GHG G R+ +    + + +     ++GC S +   EGR E +  +  +L  GCP + GLLWDVTDR++D+FT++ L  WL      +  TDT L    + + V  +    A +LK L G + IV+GLP     +  LP
Sbjct:  939 VEAAYRRLAAIPVPNLLRPVCHWLGLYWLGKDSQTQAGRYLAQSVGIAATSLYVSILSSRIAEMKPSQSAMTPPSPEQLSNWSNALKRTKQCVAPCHPLRNPRSNTSSAITDSTESAGLRVIQLCLVDEIAAGTVSPHSFHLDCPSGHQPLPMGLGARNAAYLVATRYTGLS-STDPHALQAETRVLHGFTNTGLKALDSFDELQVESLDSMQIEDRVRYWRTRYKLDSRLEAMLSEMHRDWFTPDDLKWLLGPLPPTVDPICAKSSVATSVVLILDRRLSYLPWEWILSPEDEESNSARPTFTRSFSLPLVLGHL------SSTSRTGPRIAQVANNLEISRSASPTFNPRETFYVLNPEANLSFTQQTFEPIFQGFPTWHGVIRRLPTTEEVNTGFTDHDLFIYLGHGNGSRFLLQTFNQGMCARAVTLVLGCSSGKPRWEGRHEPYSSLFNHLIAGCPLVAGLLWDVTDRDVDRFTLRFLTRWL---CDESDVTDTALERPSLGSCV--SSATTACKLKHLVGKSVIVYGLPIEPNPNYVLP 1471          
BLAST of Peptidase C50 domain-containing protein vs. TrEMBL
Match: A0A504Z543 (Separin OS=Fasciola gigantica OX=46835 GN=FGIG_05654 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 6.541e-57
Identity = 163/545 (29.91%), Postives = 256/545 (46.97%), Query Frame = 3
Query: 1929 LEEHAAQFKHVNVPVLHRAVYQRLALHYLSSNAGKTA-YYLSLSIGMGFRQLYLSECFMK-ARNKKSEHA---------ERWTQTLEAAFSCME--------NESLMHAKLSELLPANWTVLQFNMIDEIPISCIKSSSLN-NVDGG------CLGARNCAVLLVTKYQNLQIDGEGMKLTTETKVLHGFRKTGMQLLDRFEYVKLESTRRLKISDRKAWWSNRHKMDCNLKSLIDQMRSDWFTDSDLKWLMDE---------GSNLIGEPKIIITDRDLCRIPLESILI--RGQANSK--CITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEI--------NPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSREDIQLP 3422
            +E    +   + VP L R V   L L++L  ++   A  YL+ S+G+    LY+S    + A  K S+ A           W+  L     C+               A       A   V+Q  ++DEI    +   S + +   G       LGARN A L+ T+Y  L    +   L  ET+VLHGF  TG++ LD F+ +++ES   ++I DR  +W  R+K+D  L++++ +M  DWFT  DLKWL+             + +    ++I DR L  +P E +L     ++NS     TR  ++  ++GHL      ++ S   P      +NLE+        NP +TFYV+NP+  L  T+QT  P+F+   +W G   +     E +      D+ IY GHG G R+ +    + + +     ++GC S +   EGR E +  +  +L  GCP + GLLWDVTDR++D+FT++ L  WL      +  TDT L    + + V  +    A +LK L G + IV+GLP     +  LP
Sbjct:  938 VEAAYRRLAAIPVPNLLRPVCHWLGLYWLGKDSQTQAGRYLAQSVGIAATSLYVSILSSRIAEMKPSQSAVTPPPPEQLSNWSNALRRTKQCVAPCHPLRNPRSHTSSAITDSTESAGLRVIQLCLVDEIAAGTVSPHSFHLDCPSGHQPLPMGLGARNAAYLVATRYTGLS-STDPHALQAETRVLHGFTNTGLKALDSFDELQVESLDSMQIEDRVRYWRTRYKLDSRLEAMLSEMHRDWFTPDDLKWLLGPLPPTFDPICAKSPVATSVVLILDRRLSYLPWEWVLSPEDEESNSARPTFTRSFSLPLVLGHL------SSTSRTGPRIPQVANNLEVSRSVSPTFNPRETFYVLNPEANLSFTQQTFEPIFQGFPTWHGVIRRLPTTEEVNTGFTDHDLFIYLGHGNGSRFLLQTFNQGMCARAVTLVLGCSSGKPRWEGRHEPYSSLFNHLIAGCPLVAGLLWDVTDRDVDRFTLRFLTRWL---CDESDATDTALERPSLGSCV--SSATTACKLKHLVGKSVIVYGLPIEPNPNYMLP 1470          
BLAST of Peptidase C50 domain-containing protein vs. TrEMBL
Match: A0A183PEH3 (Peptidase C50 domain-containing protein OS=Schistosoma mattheei OX=31246 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 3.020e-56
Identity = 163/530 (30.75%), Postives = 252/530 (47.55%), Query Frame = 3
Query: 1947 QFKHVNVPVLHRAVYQRLALHYLS-SNAGKTAYYLSLSIGMGFRQLYLS--------------ECFMKARNKKSEHAERWTQTLEAAFS-CMENESLMHAKLSELLPA-------NWTVLQFNMIDEIPISCIKSSSLNNVDG--------GCLGARNCAVLLVTKYQNLQIDGEGMKLTT---ETKVLHGFRKTGMQLLDRFEYVKLESTRRLKISDRKAWWSNRHKMDCNLKSLIDQMRSDWFTDSDLKWLM--------DEGSNLIGEPKI-IITDRDLCRIPLESILIRGQANSKCITRMPNIISL---IGHLYQSRFRNTDXXXXXXXXXXXXNL-EINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPT 3395
            Q     VP L R + Q L +++L   +  +   +LS +IG+G   LYLS              +  +  RNKK      W   L    + C  N  LM   +   +P           V+Q  ++DE+  SC KS+ ++  DG          LGAR+   LLV++Y    I   G  LTT   ET+V+HGF  +G + +D F+ ++ ES   + I DR  +W  R+ +D  L++L+ ++R +WFT  DL WL         +E  N    P + II DR L  +P E IL      S C   M    SL   +GHL        +      P      L   NP + FY++NP+  LP T+QT  P+F   +SW G  G+     E ++   + D+LI+ GHG G ++ +    + + + +   ++GC S +    GR E +  +  +L  GCP + GLLWDVTDR++D+FT++ L NWL K      +     P   +   +F+    +A +LK L G + IV+G+P+
Sbjct:  543 QLSSFPVPNLLRPICQWLGIYWLGKGDQLQAGRFLSQAIGIGPTTLYLSILSSRIIHLKSSDSQDSVSDRNKKCN----WFPILNRVMTICAPNNFLMENVIQ--MPTCDDNSSLTVRVIQLCLVDEL--SC-KSNLIDKSDGIYHHTISPYGLGARSGGYLLVSRY----IGISGQSLTTFEVETRVMHGFTHSGFKYMDSFDEIQTESLDSMAIEDRANYWRIRYNLDERLENLLTEIRREWFTKDDLDWLFSREKYCRNNEPQNDYNSPSVVIIPDRRLVYLPWEWILWDRNPTS-CTPTMTRSFSLPLVVGHLATQYMPCQNIEANISPNAEHMKLCSFNPERAFYILNPESNLPSTQQTFEPIFHNLSSWTGVIGRIPTLEEVNNGFTNHDLLIFLGHGNGSQFLLHTFNQGLNARSVTLILGCSSGKPRSAGRHEPYTSLFNHLIAGCPFVCGLLWDVTDRDVDRFTLQFLTNWLGKDGSDDGRDAK--PHGTLGQSIFN--ATSACKLKHLVGKSVIVYGIPS 1054          
BLAST of Peptidase C50 domain-containing protein vs. TrEMBL
Match: A0A3P8IW72 (Peptidase C50 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS12759 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 3.272e-56
Identity = 163/530 (30.75%), Postives = 252/530 (47.55%), Query Frame = 3
Query: 1947 QFKHVNVPVLHRAVYQRLALHYLS-SNAGKTAYYLSLSIGMGFRQLYLS--------------ECFMKARNKKSEHAERWTQTLEAAFS-CMENESLMHAKLSELLPA-------NWTVLQFNMIDEIPISCIKSSSLNNVDG--------GCLGARNCAVLLVTKYQNLQIDGEGMKLTT---ETKVLHGFRKTGMQLLDRFEYVKLESTRRLKISDRKAWWSNRHKMDCNLKSLIDQMRSDWFTDSDLKWLM--------DEGSNLIGEPKI-IITDRDLCRIPLESILIRGQANSKCITRMPNIISL---IGHLYQSRFRNTDXXXXXXXXXXXXNL-EINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPT 3395
            Q     VP L R + Q L +++L   +  +   +LS +IG+G   LYLS              +  +  RNKK      W   L    + C  N  LM   +   +P           V+Q  ++DE+  SC KS+ ++  DG          LGAR+   LLV++Y    I   G  LTT   ET+V+HGF  +G + +D F+ ++ ES   + I DR  +W  R+ +D  L++L+ ++R +WFT  DL WL         +E  N    P + II DR L  +P E IL      S C   M    SL   +GHL        +      P      L   NP + FY++NP+  LP T+QT  P+F   +SW G  G+     E ++   + D+LI+ GHG G ++ +    + + + +   ++GC S +    GR E +  +  +L  GCP + GLLWDVTDR++D+FT++ L NWL K      +     P   +   +F+    +A +LK L G + IV+G+P+
Sbjct:  543 QLSSFPVPNLLRPICQWLGIYWLGKGDQLQAGRFLSQAIGIGPTTLYLSILSSRIIHLKSSDSQDSVSDRNKKCN----WFPILNRVMTICAPNNFLMENVIQ--MPTCDDNSSLTVRVIQLCLVDEL--SC-KSNLIDKSDGIYHHTISPYGLGARSGGYLLVSRY----IGISGQSLTTFEVETRVMHGFTHSGFKYMDSFDEIQTESLDSMAIEDRANYWRIRYNLDERLENLLTEIRREWFTKDDLDWLFSREKYCRNNEPQNDYNSPSVVIIPDRRLVYLPWEWILWDRNPTS-CTPTMTRSFSLPLVVGHLATQYMPCQNIEANISPNAEHMKLCSFNPERAFYILNPESNLPSTQQTFEPIFHNLSSWTGVIGRIPTLEEVNNGFTNHDLLIFLGHGNGSQFLLHTFNQGLNARSVTLILGCSSGKPRSAGRHEPYTSLFNHLIAGCPFVCGLLWDVTDRDVDRFTLQFLTNWLGKDGSDDGRDAK--PHGTLGQSIFN--ATSACKLKHLVGKSVIVYGIPS 1054          
BLAST of Peptidase C50 domain-containing protein vs. TrEMBL
Match: A0A095C726 (Separin OS=Schistosoma haematobium OX=6185 GN=MS3_06241 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 5.824e-56
Identity = 159/527 (30.17%), Postives = 251/527 (47.63%), Query Frame = 3
Query: 1947 QFKHVNVPVLHRAVYQRLALHYLS-SNAGKTAYYLSLSIGMGFRQLYLS--------------ECFMKARNKKSEHAERWTQTLEAAFS-CMENESLMHAKLSELLPA-------NWTVLQFNMIDEIPISCIKSSSLNNVDG--------GCLGARNCAVLLVTKYQNLQIDGEGMK-LTTETKVLHGFRKTGMQLLDRFEYVKLESTRRLKISDRKAWWSNRHKMDCNLKSLIDQMRSDWFTDSDLKWLMDEGSNLIGEPK--------IIITDRDLCRIPLESILIRGQANSKCITRMPNIISL---IGHLYQSRFRNTDXXXXXXXXXXXXNL-EINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPT 3395
            Q     VP L R + Q L +++L   +  +   +LS +IG+G   LYLS              +  +  RNKK      W   L    + C  N  LM   +   +P           V+Q  ++DE+  SC KS+ ++  D           LGAR+   LLV++Y  + I G+ ++    ET+V+HGF  +G + +D F+ ++ ES   + I DR  +W  R+ +D  L++L+ ++R +WFT  DL WL         EPK        +II DR L  +P E IL      S C   M    SL   +GHL        +      P      L   NP + FY++NP+  LP T+QT  P+F   +SW G  G+     E ++   + D+LI+ GHG G ++ +    + + + +   ++GC S +    GR E +  +  +L  GCP + GLLWDVTDR++D+FT++ L NWL K      +     P   +   +F+    +A +LK L G + IV+G+P+
Sbjct:  794 QLSSFPVPNLLRPICQWLGIYWLGKGDQLQAGRFLSQAIGIGPTTLYLSILSSRIIHLKSSDSQDSVSDRNKKCN----WFPILNRVMTICAPNNFLMENVIQ--MPTCDDNSSLTVRVIQLCLVDEL--SC-KSNLIDKSDDIYHHTISPYGLGARSGGYLLVSRY--IGISGQSLRTFEVETRVMHGFTHSGFKYMDSFDEIQTESLDSMAIEDRANYWRIRYNLDERLENLLTEIRREWFTKDDLDWLFSREKYCNNEPKNDYNPPSVVIIPDRRLVYLPWEWILWDRNPTS-CTPTMTRSFSLPLVVGHLATQYMPCQNIEANISPNAEHMKLCSFNPERAFYILNPESNLPSTQQTFEPIFHNLSSWTGVIGRIPTLEEVNNGFTNHDLLIFLGHGNGSQFLLHTFNQGLNARSVTLILGCSSGKPRSAGRHEPYTSLFNHLIAGCPFVCGLLWDVTDRDVDRFTLQFLTNWLGKDGSDDGRDAK--PHGTLGQSIFN--ATSACKLKHLVGKSVIVYGIPS 1304          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Cavefish
Match: espl1 (extra spindle pole bodies like 1, separase [Source:NCBI gene;Acc:103046696])

HSP 1 Score: 144.05 bits (362), Expect = 4.316e-34
Identity = 88/273 (32.23%), Postives = 137/273 (50.18%), Query Frame = 3
Query: 2592 LKWLMDEGSNLIG--EPK---IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPT 3395
            LK L    S L G  EP+   ++I D+ L R+P E+I        + ++R+P++ +++GH +  +  N+D               ++P + ++V+NPD  LPETE+     F  + +WQG  G S    +  + +  KD+ IY GHGAG R+   +         +  L GC SA  +V+G  E  G+I+ YL  GCP + G LWDVTDR+ID+FT  LL +WL   +  +                  + + +A  LK + G API +GLP 
Sbjct: 1906 LKLLQKGVSELKGREEPQGHTVLILDKYLQRLPWENISC---LRPRSVSRLPSLQAVLGHGHLQKM-NSDCVLSRG---------VDPQQVYFVLNPDGNLPETEKRFRDWFTSEKTWQGVCGVSPDPDKLQEAITTKDLYIYVGHGAGARFLDAQRVMKGPVQAAALLFGCSSAALSVQGCLEGTGIILSYLIAGCPLVLGNLWDVTDRDIDRFTSALLQSWLSGGSGSSLLQHL-------------STSRDATHLKHMIGAAPIAYGLPV 2152          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Cavefish
Match: espl1 (extra spindle pole bodies like 1, separase [Source:NCBI gene;Acc:103046696])

HSP 1 Score: 144.05 bits (362), Expect = 4.423e-34
Identity = 88/273 (32.23%), Postives = 137/273 (50.18%), Query Frame = 3
Query: 2592 LKWLMDEGSNLIG--EPK---IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPT 3395
            LK L    S L G  EP+   ++I D+ L R+P E+I        + ++R+P++ +++GH +  +  N+D               ++P + ++V+NPD  LPETE+     F  + +WQG  G S    +  + +  KD+ IY GHGAG R+   +         +  L GC SA  +V+G  E  G+I+ YL  GCP + G LWDVTDR+ID+FT  LL +WL   +  +                  + + +A  LK + G API +GLP 
Sbjct: 1947 LKLLQKGVSELKGREEPQGHTVLILDKYLQRLPWENISC---LRPRSVSRLPSLQAVLGHGHLQKM-NSDCVLSRG---------VDPQQVYFVLNPDGNLPETEKRFRDWFTSEKTWQGVCGVSPDPDKLQEAITTKDLYIYVGHGAGARFLDAQRVMKGPVQAAALLFGCSSAALSVQGCLEGTGIILSYLIAGCPLVLGNLWDVTDRDIDRFTSALLQSWLSGGSGSSLLQHL-------------STSRDATHLKHMIGAAPIAYGLPV 2193          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Cavefish
Match: espl1 (extra spindle pole bodies like 1, separase [Source:NCBI gene;Acc:103046696])

HSP 1 Score: 135.576 bits (340), Expect = 1.533e-31
Identity = 90/319 (28.21%), Postives = 148/319 (46.39%), Query Frame = 3
Query: 2490 ISDRKAWWSNRHKMDCNLKSLIDQMRSDWFT-DSDLKWLMDEGSNLI---------GEPKIII-----TDRDLCRIPLESILIRGQANSKCITRMPN--IISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPT 3395
            ++D+  WW  R  +D  +     Q+R +W + D      ++  S +I           P  +I     + + L R+P E+I        + ++R+P+  ++ L+  ++     N+D               ++P + ++V+NPD  LPETE+     F  + +WQG  G S    +  + +  KD+ IY GHGAG R+   +         +  L GC SA  +V+G  E  G+I+ YL  GCP + G LWDVTDR+ID+FT  LL +WL   +  +                  + + +A  LK + G API +GLP 
Sbjct: 1497 VADKVQWWDCRKALDARV-----QVRGEWLSLDQRDHCGVNAASAIIRLNVFSQMAKNPLFLIFFVCVSMQYLQRLPWENI---SCLRPRSVSRLPSLQVLFLLEFIFLYFQMNSDCVLSRG---------VDPQQVYFVLNPDGNLPETEKRFRDWFTSEKTWQGVCGVSPDPDKLQEAITTKDLYIYVGHGAGARFLDAQRVMKGPVQAAALLFGCSSAALSVQGCLEGTGIILSYLIAGCPLVLGNLWDVTDRDIDRFTSALLQSWLSGGSGSSLLQHL-------------STSRDATHLKHMIGAAPIAYGLPV 1785          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003513.1 (pep scaffold:Pmarinus_7.0:GL476336:613530:646893:-1 gene:ENSPMAG00000003160.1 transcript:ENSPMAT00000003513.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 4.275e-33
Identity = 82/256 (32.03%), Postives = 124/256 (48.44%), Query Frame = 3
Query: 2640 IIITDRDLCRIPLESI-LIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQ---LKTLTGNAPIVFGLPT 3395
            ++I D++L ++P E+I L+R  +    +TRMP++  L+     +++  ++            N +++   TFY++NP   L  TE T    F+ +  W+G  GK     +  +VL  KD+ IY GHGAG + F       +       L GC S    + G  EA G+ + Y+  GCP I G LWDVTDR+ID++   LL  WL                AP P        ++A Q   LK L G API++GLP 
Sbjct: 1395 VLILDKNLQKLPWENIPLLRASS----VTRMPSLAFLLASALSTKYVKSNVF----------NSKVDVRNTFYLLNPQANLSSTESTFRDWFESEKDWEGVTGKVPTAEKIQEVLTKKDLYIYAGHGAGAQIFKPHAIPRLDCRAVSLLFGCSSGALAMRGTLEASGIALNYIMAGCPCILGNLWDVTDRDIDRYMEALLRTWLS---------------AP-PGASISEHMVHARQAPRLKFLIGAAPILYGLPV 1620          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Yeast
Match: ESP1 (Separase, a caspase-like cysteine protease; promotes sister chromatid separation by mediating dissociation of the cohesin Scc1p from chromatin; inhibits protein phosphatase 2A-Cdc55p to promote mitotic exit; inhibited by Pds1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003330])

HSP 1 Score: 92.4337 bits (228), Expect = 2.971e-19
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 3
Query: 2856 VINPDDTLPETEQTILPVFKR----QTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLP 3392
            ++NP+  L  TE     +F++    + S Q    +  +      +L + ++ +Y GHG G +Y   +  K  T     FL+GC SA     G+ E  G I  YL  GCP + G LWDVTD++IDKF+ +L     EK        D  L    +      +++     L+ L G AP+++GLP
Sbjct: 1449 ILNPNGDLSRTESKFKGMFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAPSFLLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFSEEL----FEKMGFRCNTDD--LNGNSLSVSYAVSKSRGVCHLRYLNGAAPVIYGLP 1625          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Nematostella
Match: EDO43603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYA6])

HSP 1 Score: 135.576 bits (340), Expect = 5.843e-32
Identity = 76/258 (29.46%), Postives = 125/258 (48.45%), Query Frame = 3
Query: 2634 PKIIITDRDLCRIPLESI-LIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSR 3404
            P I+I  + +  +P E+I ++R       +TRMP++  ++ H  Q   +                  ++P KT++V+NPDD LP T++     F+ +  W+G  G    + +    L   D+ +Y GHG G  +      + +   ++  L+GC S +  VEG  E  GM++ YL  GCP++   LWDVTDR+ID+ T  LL  WL        Q D  L +A         +   A +L  L G +P+V+G+P + +
Sbjct: 1860 PVILILGKGVQHLPWENIPILRDHE----VTRMPSLQFVLSHAQQMMHQPCS---------------VDPEKTYFVLNPDDNLPNTQKLFQKWFEGEPGWRGVTGTKPSQEQYRSALVDNDLFLYLGHGNGRTFLNGSEVQRLNCRSTAILMGCSSGKLIVEGVCEPRGMVLNYLIAGCPAVVANLWDVTDRDIDRLTATLLKTWL--------QRDHSLSLAQALC-----QARKACKLGYLIGASPVVYGIPVYRK 2085          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Medaka
Match: espl1 (extra spindle pole bodies like 1, separase [Source:NCBI gene;Acc:101174584])

HSP 1 Score: 140.198 bits (352), Expect = 6.233e-33
Identity = 87/258 (33.72%), Postives = 125/258 (48.45%), Query Frame = 3
Query: 2631 EPK---IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPT 3395
            EPK   ++I D+ L ++P E + I     ++ ++RMP++ SL+G   Q   ++ DS  V           +NP K FYV++PD  L   +      F  +  WQG  G      +  + +A KD+ IY GHGAG R+    +        +  L GC SA   V G  E  G+++ YL  GCP I G LWDVTDR+ID+FT  LL +WL   +  +                F   +  A  LK L G AP+V+GLP 
Sbjct: 1755 EPKGHVVLILDKFLQKLPWEGMSI---LKTQSVSRMPSLHSLLGLNIQ---KDADSQSVLSSG-------VNPRKVFYVLDPDANLKNAQDRFKDWFCSKPDWQGVCGVPPDSGQLEEAVAIKDLYIYVGHGAGARFLDSHSVLKQRMRAASLLFGCSSAALAVRGNQEGQGILLNYLIAGCPFILGNLWDVTDRDIDRFTKALLESWLSAGSGAS-------------ILEFMASSRQATNLKYLIGAAPVVYGLPV 1986          
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Medaka
Match: espl1 (extra spindle pole bodies like 1, separase [Source:NCBI gene;Acc:101174584])

HSP 1 Score: 139.813 bits (351), Expect = 7.852e-33
Identity = 87/258 (33.72%), Postives = 125/258 (48.45%), Query Frame = 3
Query: 2631 EPK---IIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPT 3395
            EPK   ++I D+ L ++P E + I     ++ ++RMP++ SL+G   Q   ++ DS  V           +NP K FYV++PD  L   +      F  +  WQG  G      +  + +A KD+ IY GHGAG R+    +        +  L GC SA   V G  E  G+++ YL  GCP I G LWDVTDR+ID+FT  LL +WL   +  +                F   +  A  LK L G AP+V+GLP 
Sbjct: 1931 EPKGHVVLILDKFLQKLPWEGMSI---LKTQSVSRMPSLHSLLGLNIQ---KDADSQSVLSSG-------VNPRKVFYVLDPDANLKNAQDRFKDWFCSKPDWQGVCGVPPDSGQLEEAVAIKDLYIYVGHGAGARFLDSHSVLKQRMRAASLLFGCSSAALAVRGNQEGQGILLNYLIAGCPFILGNLWDVTDRDIDRFTKALLESWLSAGSGAS-------------ILEFMASSRQATNLKYLIGAAPVVYGLPV 2162          
BLAST of Peptidase C50 domain-containing protein vs. Planmine SMEST
Match: SMESG000017514.1 (SMESG000017514.1)

HSP 1 Score: 2038.46 bits (5280), Expect = 0.000e+0
Identity = 1060/1129 (93.89%), Postives = 1062/1129 (94.07%), Query Frame = 3
Query:   45 MPLIVDNIKNYFETLKICSAGNNIHNLNSKEEIKDTEVQGLFTDVSVDKALKFINDEYSSLNITRSIVHQGNVKQQLRTLELMMIIYQLHGKFEEEYKCIKIFNKIARQNKDTEEQSLGFLIESFYHLIHDSKSTIPKICIQIREKLVIINQNISGFTTLNVFISXXXXXXXXXXXXXXXLLDKIKQFYVDFQSYFNGNTLESHLVKMYCAQCEFAIKVKAFRSGYRAVNANLFEDGILLRKVSMGSIEYLRKKSSNMNLHSGSYETLRFLWKFINCLLIGLQMIAEYYTLAGIARESKQYQTELFTYSVRYCVPYRTKMAVKLLMHSEFVYMRIPELTIRDSQLTQLKTNQATLNNSIHSNSQRSSLGADVAEYNYPIYHQNEDNLLTASLQNREAAKPHKKDALYITTVTSEKAIHFEECFLSRSTFKTELLDIFDIVKSHIWKIQPTSQSFYDDNEWEMNFIXXXXXXXXXXXXXXINLSTPPSSPIKTTNSXXXXXXXXXXXXXXXXXPIRTRRVGPNPPNKPMIYKKSVKDKQNNSDDAAPIESFQTVYLPGKQRNIKYEDPELPRSLLNHFNKISIKDIPNPIIGTPCNLRFDHFKEYPTLEPKTVVKKARNSKSEQSLIDYLEEHAAQFKHVNVPVLHRAVYQRLALHYLSSNAGKTAYYLSLSIGMGFRQLYLSECFMKARNKKSEHAERWTQTLEAAFSCMENESLMHAKLSELLPANWTVLQFNMIDEIPISCIKSSSLNNVDGGCLGARNCAVLLVTKYQNLQIDGEGMKLTTETKVLHGFRKTGMQLLDRFEYVKLESTRRLKISDRKAWWSNRHKMDCNLKSLIDQMRSDWFTDSDLKWLMDEGSNLIGEPKIIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDXXXXXXXXXXXXNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSREDIQLPKFE 3431
            MPLIVDNIKNYFETLKICSAGNNIHNLNSKEEIKDTEVQGLFTDVSVDKALKFINDEYSSLNITRSIVHQGNVKQQLRTLELMMIIYQLHGKFEEEYKCIKIFNKIARQNKDTEEQSLGFLIESFYHLIHDSKSTIPKICIQIREKLVIINQNISGFTTLNVFISFAKIIF+KIDPDFKILLDKIKQFYVDFQSYFNGNTLESHLVKMYCAQCEFAIKVKAFRSGYRAVNANLFEDGILLRKVSMGSIEYLRKKSSNMNLHSGSYETLRFLWKFINCLLIGLQMIAEYYTLAGIARESKQYQTELFTYSVRYCVPYRTKMAVKLLMHSEFVYMRIPELTIRDSQLTQLKTNQATLNNSIHSNSQRSSLGADVAEYNYPIYHQNEDNLLTASLQNREAAKPHKKDALYITTVTSEKAIHFEECFLSRSTFKTELLDIFDIVKSHIWKIQPTSQSFYDDNEWEMNFIEEDEDNNLSNELVNINLSTPPSSPIKTTNSMNNNNHHHLLNMANMNAPIRTRRVGPNPPNKPMIYKKSVKDKQNNSDDAAPIESFQTVYLPGKQRNIKYEDPELPRSLLNHFNK                            +PKTVVKKARNSKSEQSLIDYLEEHAAQFKHVNVPVLHRAVYQRLALHYLSSNAGKTAYYLSLSIGMGFRQLYLSECFMKARNKKSEHAERWTQTLEAAFSCMENESLMHAKLSELLPANWTVLQFNMIDEIPISCIKSSSLNNVDGGCLGARNCAVLLVTKYQNLQIDGEGMKLTTETKVLHGFRKT                                       SLIDQMRSDWFTDSDLKWLMDEGSNLIGEPKIIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDSSEVPVPRVSRSNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSREDIQLPKFE
Sbjct:    1 MPLIVDNIKNYFETLKICSAGNNIHNLNSKEEIKDTEVQGLFTDVSVDKALKFINDEYSSLNITRSIVHQGNVKQQLRTLELMMIIYQLHGKFEEEYKCIKIFNKIARQNKDTEEQSLGFLIESFYHLIHDSKSTIPKICIQIREKLVIINQNISGFTTLNVFISFAKIIFEKIDPDFKILLDKIKQFYVDFQSYFNGNTLESHLVKMYCAQCEFAIKVKAFRSGYRAVNANLFEDGILLRKVSMGSIEYLRKKSSNMNLHSGSYETLRFLWKFINCLLIGLQMIAEYYTLAGIARESKQYQTELFTYSVRYCVPYRTKMAVKLLMHSEFVYMRIPELTIRDSQLTQLKTNQATLNNSIHSNSQRSSLGADVAEYNYPIYHQNEDNLLTASLQNREAAKPHKKDALYITTVTSEKAIHFEECFLSRSTFKTELLDIFDIVKSHIWKIQPTSQSFYDDNEWEMNFIEEDEDNNLSNELVNINLSTPPSSPIKTTNSMNNNNHHHLLNMANMNAPIRTRRVGPNPPNKPMIYKKSVKDKQNNSDDAAPIESFQTVYLPGKQRNIKYEDPELPRSLLNHFNK----------------------------KPKTVVKKARNSKSEQSLIDYLEEHAAQFKHVNVPVLHRAVYQRLALHYLSSNAGKTAYYLSLSIGMGFRQLYLSECFMKARNKKSEHAERWTQTLEAAFSCMENESLMHAKLSELLPANWTVLQFNMIDEIPISCIKSSSLNNVDGGCLGARNCAVLLVTKYQNLQIDGEGMKLTTETKVLHGFRKT---------------------------------------SLIDQMRSDWFTDSDLKWLMDEGSNLIGEPKIIITDRDLCRIPLESILIRGQANSKCITRMPNIISLIGHLYQSRFRNTDSSEVPVPRVSRSNLEINPLKTFYVINPDDTLPETEQTILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDRTYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWDVTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAVQLKTLTGNAPIVFGLPTWSREDIQLPKFE 1062          
BLAST of Peptidase C50 domain-containing protein vs. Planmine SMEST
Match: SMESG000017512.1 (SMESG000017512.1)

HSP 1 Score: 498.819 bits (1283), Expect = 1.297e-168
Identity = 262/264 (99.24%), Postives = 263/264 (99.62%), Query Frame = 3
Query:   45 MPLIVDNIKNYFETLKICSAGNNIHNLNSKEEIKDTEVQGLFTDVSVDKALKFINDEYSSLNITRSIVHQGNVKQQLRTLELMMIIYQLHGKFEEEYKCIKIFNKIARQNKDTEEQSLGFLIESFYHLIHDSKSTIPKICIQIREKLVIINQNISGFTTLNVFISXXXXXXXXXXXXXXXLLDKIKQFYVDFQSYFNGNTLESHLVKMYCAQCEFAIKVKAFRSGYRAVNANLFEDGILLRKVSMGSIEYLRKKSSNMNLHSGS 836
            MPLIVDNIKNYFETLKICSAGNNIHNLNSKEEIKDTEVQ LFTDVSVDKALKFINDEYSSLNITRSIVHQGNVKQQLRTLELMMIIYQLHGKFEEEYKCIKIFNKIARQNKDTEEQSLGFLIESFYHLIHDSKSTIPKICIQIREKLVIINQNISGFTTLNVFISFAKIIF+KIDPDFKILLDKIKQFYVDFQSYFNGNTLESHLVKMYCAQCEFAIKVKAFRSGYRAVNANLFEDGILLRKVSMGSIEYLRKKSSNMNLHSGS
Sbjct:    1 MPLIVDNIKNYFETLKICSAGNNIHNLNSKEEIKDTEVQRLFTDVSVDKALKFINDEYSSLNITRSIVHQGNVKQQLRTLELMMIIYQLHGKFEEEYKCIKIFNKIARQNKDTEEQSLGFLIESFYHLIHDSKSTIPKICIQIREKLVIINQNISGFTTLNVFISFAKIIFEKIDPDFKILLDKIKQFYVDFQSYFNGNTLESHLVKMYCAQCEFAIKVKAFRSGYRAVNANLFEDGILLRKVSMGSIEYLRKKSSNMNLHSGS 264          
The following BLAST results are available for this feature:
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ESPL15.704e-3230.98extra spindle pole bodies like 1, separase [Source... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sep-19.872e-1928.72Separin homolog sep-1 [Source:UniProtKB/Swiss-Pro... [more]
sep-19.872e-1928.72Separin homolog sep-1 [Source:UniProtKB/Swiss-Pro... [more]
ZK430.59.552e-1431.20pep chromosome:WBcel235:II:4405864:4416553:1 gene:... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sse4.414e-830.83gene:FBgn0035627 transcript:FBtr0077125[more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
espl16.730e-3934.02extra spindle pole bodies like 1, separase [Source... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ESPL19.633e-3430.59extra spindle pole bodies like 1, separase [Source... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Espl17.215e-3231.47extra spindle pole bodies 1, separase [Source:MGI ... [more]
Espl17.215e-3231.47extra spindle pole bodies 1, separase [Source:MGI ... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14674|ESPL1_HUMAN2.739e-3130.98Separin OS=Homo sapiens OX=9606 GN=ESPL1 PE=1 SV=3[more]
sp|P60330|ESPL1_MOUSE5.047e-3131.47Separin OS=Mus musculus OX=10090 GN=Espl1 PE=1 SV=... [more]
sp|P33144|BIMB_EMENI6.007e-2332.28Separin OS=Emericella nidulans (strain FGSC A4 / A... [more]
sp|Q5IBC5|ESP1_ARATH1.615e-2231.10Separase OS=Arabidopsis thaliana OX=3702 GN=ESP1 P... [more]
sp|P18296|CUT1_SCHPO4.854e-1825.00Separin OS=Schizosaccharomyces pombe (strain 972 /... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R6A82.952e-5730.28Separin OS=Fasciola hepatica OX=6192 GN=D915_00711... [more]
A0A504Z5436.541e-5729.91Separin OS=Fasciola gigantica OX=46835 GN=FGIG_056... [more]
A0A183PEH33.020e-5630.75Peptidase C50 domain-containing protein OS=Schisto... [more]
A0A3P8IW723.272e-5630.75Peptidase C50 domain-containing protein OS=Schisto... [more]
A0A095C7265.824e-5630.17Separin OS=Schistosoma haematobium OX=6185 GN=MS3_... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
espl14.316e-3432.23extra spindle pole bodies like 1, separase [Source... [more]
espl14.423e-3432.23extra spindle pole bodies like 1, separase [Source... [more]
espl11.533e-3128.21extra spindle pole bodies like 1, separase [Source... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003513.14.275e-3332.03pep scaffold:Pmarinus_7.0:GL476336:613530:646893:-... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ESP12.971e-1930.60Separase, a caspase-like cysteine protease; promot... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO436035.843e-3229.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
espl16.233e-3333.72extra spindle pole bodies like 1, separase [Source... [more]
espl17.852e-3333.72extra spindle pole bodies like 1, separase [Source... [more]
back to top
BLAST of Peptidase C50 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017514.10.000e+093.89SMESG000017514.1[more]
SMESG000017512.11.297e-16899.24SMESG000017512.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013237 ID=SMED30013237|Name=Peptidase C50 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3473bp
TTTATAAGGCAATTTAAATATATACTTTAATTATAATTTTAGTTATGCCA
CTAATTGTAGATAACATAAAAAATTATTTTGAAACATTAAAAATTTGCTC
AGCCGGTAACAACATTCATAATCTAAACTCTAAAGAAGAAATTAAAGATA
CAGAAGTTCAAGGATTATTTACAGATGTTTCAGTAGATAAGGCTCTTAAA
TTTATTAATGACGAATATTCGTCTTTGAATATTACTAGAAGCATTGTGCA
TCAAGGAAATGTTAAGCAACAGCTCAGAACCCTTGAGCTCATGATGATAA
TTTATCAGTTACATGGAAAATTTGAAGAAGAATACAAATGTATTAAAATC
TTCAACAAAATTGCTAGGCAGAATAAAGATACAGAAGAACAAAGCTTGGG
ATTTTTGATTGAATCATTTTATCATTTAATACATGATTCCAAAAGTACAA
TTCCCAAAATATGTATTCAAATAAGGGAAAAATTAGTAATCATAAATCAG
AATATAAGTGGGTTTACGACCCTAAATGTATTTATATCTTTTGCTAAGAT
AATTTTTGACAAAATAGATCCAGATTTTAAAATTCTTTTGGATAAGATAA
AGCAATTTTATGTCGATTTTCAATCTTATTTTAATGGAAATACACTTGAA
TCACATCTGGTGAAAATGTATTGCGCTCAGTGTGAGTTCGCAATAAAAGT
CAAAGCGTTCAGAAGTGGTTATCGTGCTGTCAATGCTAATTTATTTGAAG
ATGGAATACTATTGAGAAAAGTATCAATGGGTTCCATTGAATATCTCAGA
AAGAAAAGCAGCAATATGAATTTGCATTCTGGATCATATGAGACGCTGCG
GTTTTTATGGAAATTTATTAATTGCTTGCTAATTGGACTGCAAATGATTG
CCGAATATTATACACTAGCTGGAATTGCTCGTGAAAGCAAGCAATATCAA
ACTGAATTATTCACTTATTCAGTGCGATATTGCGTGCCTTATAGAACAAA
AATGGCAGTGAAATTATTGATGCACAGTGAATTTGTGTATATGAGAATCC
CAGAATTGACAATTCGAGATTCCCAATTGACTCAATTGAAAACTAATCAA
GCGACTCTCAATAATTCAATCCATTCCAATTCGCAGCGATCATCACTCGG
AGCCGACGTTGCCGAATACAATTATCCCATATATCATCAAAACGAAGACA
ACCTTTTAACTGCCAGTCTGCAAAATCGGGAGGCAGCGAAACCGCATAAA
AAAGATGCCCTCTACATAACAACAGTTACAAGTGAAAAAGCAATACATTT
TGAAGAGTGCTTTCTATCCCGGTCGACATTCAAAACGGAGCTATTGGACA
TTTTCGATATCGTCAAATCACACATTTGGAAAATTCAACCGACTAGCCAA
TCGTTTTACGATGATAACGAATGGGAAATGAATTTCATCGAAGAAGACGA
GGATAATAATCTGTCGAATGAACTGGTCAATATCAACTTATCGACACCGC
CAAGCTCGCCAATCAAAACAACAAATTCAATGAATAATAATAATCATCAT
CATCTATTGAATATGGCAAATATGAATGCGCCTATTAGAACTCGGCGCGT
TGGACCGAACCCGCCAAATAAACCAATGATTTATAAGAAATCCGTAAAAG
ATAAGCAAAACAATTCCGACGATGCAGCTCCAATCGAGAGCTTTCAAACG
GTTTATCTTCCTGGGAAACAAAGAAATATCAAATATGAAGATCCGGAATT
GCCGAGATCGCTGTTAAATCATTTTAATAAGATATCGATTAAAGATATTC
CTAATCCGATCATTGGAACACCTTGTAATTTACGATTTGATCATTTCAAA
GAGTATCCGACATTAGAACCAAAAACTGTTGTCAAGAAAGCTAGAAATTC
GAAATCCGAGCAGTCGCTTATTGATTATCTGGAGGAGCACGCGGCCCAAT
TCAAGCATGTAAATGTGCCGGTTTTACATCGGGCCGTTTATCAGCGGCTG
GCGTTGCATTACTTATCGAGCAACGCGGGGAAAACCGCATATTATCTATC
GTTGTCAATTGGGATGGGATTTAGGCAGCTCTATTTGTCTGAATGCTTTA
TGAAAGCAAGAAATAAGAAGTCGGAACATGCTGAGCGTTGGACACAAACA
CTTGAGGCCGCCTTTTCATGCATGGAAAATGAATCGCTAATGCATGCTAA
ACTCAGTGAACTTTTACCCGCAAACTGGACAGTTTTGCAATTCAACATGA
TCGATGAAATTCCGATTTCATGCATCAAATCGAGCTCGCTGAATAATGTC
GACGGCGGCTGTTTAGGAGCGAGAAATTGTGCAGTTCTACTCGTGACCAA
ATATCAGAACTTGCAAATCGATGGCGAGGGGATGAAATTGACAACGGAAA
CAAAAGTTCTGCACGGATTCAGAAAAACGGGAATGCAATTATTGGACCGG
TTCGAATATGTGAAACTCGAATCGACACGCAGATTGAAGATCAGTGATAG
AAAAGCCTGGTGGTCTAATCGGCATAAAATGGACTGCAATTTGAAGAGTC
TCATTGATCAGATGCGCAGTGATTGGTTCACAGATTCCGATTTGAAATGG
TTAATGGATGAAGGCAGCAATTTGATTGGAGAACCGAAAATTATCATCAC
AGACAGAGATCTTTGTCGGATACCGCTGGAATCGATATTAATACGGGGAC
AGGCCAATTCCAAGTGCATTACTCGAATGCCGAATATAATCAGTTTGATT
GGTCATTTGTATCAGAGTCGATTCAGAAATACCGATTCTTCGGAAGTTCC
TGTTCCGCGCGTGTCGCGATCTAATCTCGAAATCAATCCACTGAAAACGT
TTTACGTCATTAATCCTGACGACACGCTGCCAGAAACCGAGCAAACCATT
CTGCCGGTATTCAAACGGCAGACAAGCTGGCAAGGCACTGCCGGTAAATC
GGACAAGCGCATTGAGCCCTCGGACGTTCTCGCTCACAAGGACATGTTGA
TATATTGCGGCCATGGCGCAGGAGGCCGCTACTTCATGGACAGGACATAT
AAATCAATTACATCGCCAACGTCAATGTTTCTCATCGGTTGTCAGTCTGC
TCGGTTCACAGTCGAAGGCAGGAGTGAAGCGTTTGGAATGATAATGTATT
ACTTGACCATCGGCTGCCCGTCGATATTCGGGTTACTCTGGGATGTCACT
GATCGTGAGATCGACAAGTTCACAGTGAAATTGCTCTGCAATTGGCTCGA
GAAAGCAAACCATCACACACAACAAACAGACACATATTTGCCGGTTGCTC
CAATGCCCGCTTTTGTGTTTGACAACGAAACTATCAACGCAGTCCAATTG
AAAACCCTGACTGGAAATGCTCCGATCGTATTCGGGCTTCCTACCTGGTC
TAGAGAGGATATTCAACTTCCTAAGTTTGAATAGTGAATTGATATTATTG
TTTTTATAATAACTGAAGGCAGA
back to top

protein sequence of SMED30013237-orf-1

>SMED30013237-orf-1 ID=SMED30013237-orf-1|Name=SMED30013237-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1130bp
MPLIVDNIKNYFETLKICSAGNNIHNLNSKEEIKDTEVQGLFTDVSVDKA
LKFINDEYSSLNITRSIVHQGNVKQQLRTLELMMIIYQLHGKFEEEYKCI
KIFNKIARQNKDTEEQSLGFLIESFYHLIHDSKSTIPKICIQIREKLVII
NQNISGFTTLNVFISFAKIIFDKIDPDFKILLDKIKQFYVDFQSYFNGNT
LESHLVKMYCAQCEFAIKVKAFRSGYRAVNANLFEDGILLRKVSMGSIEY
LRKKSSNMNLHSGSYETLRFLWKFINCLLIGLQMIAEYYTLAGIARESKQ
YQTELFTYSVRYCVPYRTKMAVKLLMHSEFVYMRIPELTIRDSQLTQLKT
NQATLNNSIHSNSQRSSLGADVAEYNYPIYHQNEDNLLTASLQNREAAKP
HKKDALYITTVTSEKAIHFEECFLSRSTFKTELLDIFDIVKSHIWKIQPT
SQSFYDDNEWEMNFIEEDEDNNLSNELVNINLSTPPSSPIKTTNSMNNNN
HHHLLNMANMNAPIRTRRVGPNPPNKPMIYKKSVKDKQNNSDDAAPIESF
QTVYLPGKQRNIKYEDPELPRSLLNHFNKISIKDIPNPIIGTPCNLRFDH
FKEYPTLEPKTVVKKARNSKSEQSLIDYLEEHAAQFKHVNVPVLHRAVYQ
RLALHYLSSNAGKTAYYLSLSIGMGFRQLYLSECFMKARNKKSEHAERWT
QTLEAAFSCMENESLMHAKLSELLPANWTVLQFNMIDEIPISCIKSSSLN
NVDGGCLGARNCAVLLVTKYQNLQIDGEGMKLTTETKVLHGFRKTGMQLL
DRFEYVKLESTRRLKISDRKAWWSNRHKMDCNLKSLIDQMRSDWFTDSDL
KWLMDEGSNLIGEPKIIITDRDLCRIPLESILIRGQANSKCITRMPNIIS
LIGHLYQSRFRNTDSSEVPVPRVSRSNLEINPLKTFYVINPDDTLPETEQ
TILPVFKRQTSWQGTAGKSDKRIEPSDVLAHKDMLIYCGHGAGGRYFMDR
TYKSITSPTSMFLIGCQSARFTVEGRSEAFGMIMYYLTIGCPSIFGLLWD
VTDREIDKFTVKLLCNWLEKANHHTQQTDTYLPVAPMPAFVFDNETINAV
QLKTLTGNAPIVFGLPTWSREDIQLPKFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR005314Peptidase_C50
IPR030397SEPARIN_core_dom
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF03568Peptidase_C50coord: 863..1056
e-value: 1.0E-39
score: 136.8
IPR005314Peptidase C50, separasePANTHERPTHR12792EXTRA SPINDLE POLES 1-RELATEDcoord: 498..845
coord: 866..1117
IPR030397SEPARIN core domainPROSITEPS51700SEPARINcoord: 932..1027
score: 20.913