Ryanodine receptor related

Overview
NameRyanodine receptor related
Smed IDSMED30013228
Length (bp)16157
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ryanodine receptor related (SMED30013228) t-SNE clustered cells

Violin plots show distribution of expression levels for Ryanodine receptor related (SMED30013228) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ryanodine receptor related (SMED30013228) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ryanodine receptor related (SMED30013228) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Ryanodine receptor related vs. Ensembl Human
Match: RYR2 (ryanodine receptor 2 [Source:HGNC Symbol;Acc:HGNC:10484])

HSP 1 Score: 1536.93 bits (3978), Expect = 0.000e+0
Identity = 904/2075 (43.57%), Postives = 1248/2075 (60.14%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQ-GIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA--DLSRIEMHGERRRPTIIND-------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSR-YSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-------AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEK---NLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGL------------YLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEP-ITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQA---SDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+E I         K+A++      +  +   KTL     D E                 E++ D + +G AI+TFYS L+DLLGRCAPE       K  ++R+R+IL+SL+ + DL GV+S+ F +P      T+ +DG     D   M  G  P+HKA++VLFL+RVYGI+  +  L LLE  FL D+RAA  LD  +   +D ALALNRYL  +VLPLLT+ +      E  AS++++ LHT YRLS+  SLTK QR+ +   L+++  QL+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   G  G  G A+EEE  L+ +LF GIFD L++  Y+ ELF  ALPCL+A+  AL PDY     + S  +S +   S+    G                              +F PQPVDTS+I +P  LE  ++++A+H HD W+++ +  G++YG   +D +K  P +  + LLS+ ++  Y  P+ E+LK M+AWGW I+   +   + ++   RR +  +        GY+P   D+  V +++++  MAE +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK++ R+   ++LK+LQ NGY                G     LD PS  I++                        RFAY  L +L+RYV++A   + +    SR    + P+ QE   IKFF KVVLPL+++YF  H+ YF+   S        A N+EK+M  +LFCKL  L+R +++  G+D    V CL  L Q +D R ++K   T  + V+  L  F  N A+DL   ++NL   +F+H +   +     +NY  + LLP+L S+F+H+ +   G DL++ DVQV+CY+IL +LY LGT  S Y +R+         R  LGEC+AA A  FPVAFLE+HL+K+N YSI YN        A  +   +E    N+P+L+ ++EEIV+LAESG +YT+ PHV+EV LPMLCSY+  WW  GPEN  E A         T + ++ +N +LGN+LK+I NN+      WM R+A+ +QPI+      +L  HFLP+ EKLK  A     EE+  +AE +     A  +   +  +   L R+++AFYPLLI++VD +R  W+K+P  + + LF +VAE+F+ WSKS +FKREEQNFV QNEI+++S ++ D     KS+ S++A +D   KK   +  + S  TSL VA +KRLLPIGL++    +QELI  AK R                     K+ + ++ + +++ I L+ + +D    WQ  LYK +       + ++   E  ++RVL +A VL  L             LV+HP    K  W KL+S QRKRAV+ACFRM PL++LPRHR VNLFL  Y   W+  EE     +LIE++ +                         G EP E  EG           T   DPL QLI    RTA+ +     +D LY++YA IM+KSC  E+DDD +E       KS +E+EMEK ++L +Q RL DRGAAEMVL  I   +G    +V  +++LGI++L GGN++VQ +ML +LKEKK +GFF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G     L D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+E M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS ++F  AME  K Y   E E+++ C +++ +  +D+ EF  RFH+PAKDIGFNVAVLLTNL EHMPND RL+  +  A+ ++  F+P+LGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG+KEK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2339 GGNGLLAAMEEAI---------KIAEDPSRDGPSPNSGSSKTL-----DTE-----------------EEEDDTIHMGNAIMTFYSALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMP------TIAKDGNVVEPD---MSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDY-----MESNYVSMMEKQSSMDSEG------------------------------NFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGY------------AVSRGFKDLELDTPS--IEK------------------------RFAYSFLQQLIRYVDEAHQYILEFDGGSRGKGEHFPYEQE---IKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMK---TGLESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQ---------RSALGECLAAFAGAFPVAFLETHLDKHNIYSI-YNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSRWWEHGPENNPERA-----EMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSEAELL---ILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITD----TKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFS------------------LKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNR----TDDTSDPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKP------------------------GAEPPEEDEG-----------TKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEE-----VKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGL---GMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS 4207          

HSP 2 Score: 1186.79 bits (3069), Expect = 0.000e+0
Identity = 632/1335 (47.34%), Postives = 870/1335 (65.17%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYDTN---------------AIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSP-QHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYA----GNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFT 4036
            E+EI FLRTDD V L      H    + CL+A GFG+R CFLE+ S   N PPDLS+C F+L+Q+LSVRALQE++A   + +               A GG  GH+TLLYGHA+LL+H+ S M+L CLSTS SS DKLAFDVGLQE+   EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  NG      V A+FQQTLW+V P+SSG+  + + G + GGDVLRL HG  DECLTVP  +GEH   Q  +V YE GAVS HARSLWRLE ++  WSG  I WG   RLRHVT+G+YLS+    N +  + + +A   STAF  R SK+ K       E D MG+++IK+G++  ++QHV +  WL+Y++    K       +++A++  EGHMDDG ++++ Q EES++A  IR    +F RFI+ LD  + ++ ++S   + +  V   L+DLI +F  P+   EHE KQ +L AL+NRQ+LFQEEG+INL+L  ID+    +     F    G +  E +  + N LY LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  SS+RPN+F+GV E SA Y+KWYYE+ +D  E  VT     LRVGW++ EG+ P+PGG + WG   VGDDLFS+GFDG +LW+G   + + +   Q +L   D+I C LDL+ P I F IN +PV+G F +FNIDG+F+P VS SA + VR + GG HG  ++ PP GY+  +EA+LPKE+L++E    +   ++  Y     G + +     F P PV+T++I LP ++E IR+KLAENIHE+W M KI+ GW YG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +         ++K +KLP ++  ++GY+P P+DL  I L+   E +V++LAEN HN+WA DRI+QGW+YG  ++   +R+P LVPY  +DD  KKSN+ +  E V+TLL Y Y++E P  D +  A   S            R FRA+ T+ V +G+WY+E E +T G MR GW     +   E+GS+ +++AFD   A +W+  +  YG+  Q GDV+GCM+D+ + T+ F+LNGE+++D  G E+AFK+     G++P  S G  Q  ++NFG DV TLKYFT CGLQEGY PF VN +R + +W S+  P  F+ +   +  +EV    G++   P LK+  K FG Q S  ++ F RL +PI+C + F+
Sbjct:    8 EDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGG--GHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSL---HVDAAFQQTLWSVAPISSGS--EAAQGYLIGGDVLRLLHGHMDECLTVP--SGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKN-LLLMDKEKADVKSTAFTFRSSKE-KLDVGVRKEVDGMGTSEIKYGDSVCYIQHVDTGLWLTYQS-VDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIRSTVFLFNRFIRGLDA-LSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLH-VYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC-HGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSP-NQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYK--QERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCS------GTGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLP-QFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFS 1315          

HSP 3 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 407/1105 (36.83%), Postives = 584/1105 (52.85%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK---------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDIS-C-CAEELKRKINIFHRKLMDNCGIEPPE--GLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKN--LSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHT 7717
            YY+SV + PGQ+   +++GW+TS F               +DT     +      T GD K                    +  S+  S  Y++   + ++    +++       G+ IGC +D A+G LTF  N +EL   +QV P T L+PA+F + T+     FELGR +N +P+ AG+ +   +   P    RL +Q L    WSR+ N   K+ + +++E +GW +   + +Q M++HIPEE+R +DILEL E  +LL+FH  TL LY  +C  GNH VA +L +H+DE Q  Y I+N Y+ G LR  ++DLLI +HL S++  +L   NE +VP+    +S  +     +K                     H +P    S S+ P +     +   +              PE   + LK+ +++ L  AV +G+    +P+GG+ E +FVPL+K+   LLIMG+  + D+  IL +++ + FK                            + A    R    +L M L E VKLQ+C LL  LCD Q+RHRIE IV  S+DFV+ +Q++Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF          KDD S C C EE++ ++  FH  LM +CGIE  E   LD N  L     T R R                        +L+L E+    + K   +  + D  K+  L Q+I  T++ WA+ + IE+ +L+R MF LL RQY+ +G +  +L KTY I+  S +D   LL SLG++R LL V++G+ EE L+   L DIMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E+   K      MV  CCRFLCYFCR S QNQK MF+HLSY+LENSS+ LA P++RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+  G+QS   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENAN+VVRLLIRRPEC GPALRG        +    A E  +  +   + +G + N G+S T
Sbjct: 1426 YYYSVRIFPGQEPANVWVGWITSDF-------------HQYDTGFDLDRVRTVTVTLGDEKGK------------------VHESIKRSNCYMVCAGESMSPGQGRNN------NGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFPDENKK---------------------HGLPGIGLSTSLRPRMQFSSPSFVSISNEC------YQYSPEFPLDILKSKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEESDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNF----------KDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDL-----TIRGR------------------------LLSLVEKVTYLKKKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEITFPK------MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEG-----GNGLLAAMEEAIKIAEDPSRDGPSPNSGSSKT 2371          

HSP 4 Score: 559.296 bits (1440), Expect = 2.342e-158
Identity = 284/487 (58.32%), Postives = 366/487 (75.15%), Query Frame = 2
Query: 14603 FEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ-----------KPSSDPEKMNSTDPDD---MEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-EASGSRGWLRKK--------MIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDG-VKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            F  K I     +++ FA+N YN ++ AL +AF INF+LLFY+V             + SS+  K+ S D      +    +L +S  YM    +ILA LH+  +   +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD+LV++T SFP NYWDKFVK+KV +KY E Y  + I  LLGM++ + + S +R   + K        + + D++Y +WK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD YE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD +PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCW+FFP GDCFRKQYE++L
Sbjct: 4480 FWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQL 4966          

HSP 5 Score: 106.686 bits (265), Expect = 1.674e-21
Identity = 61/211 (28.91%), Postives = 106/211 (50.24%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQS--------NGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F P+PV+T+ I +P  +E   +K AE+ H+ W+M K+  GW YG+   D +K  P +  ++ L   E++       E+L+T++A G+ I  E   EG  +          Q+        +GY P+ +D+ N++LS  L  +   +AEN HNIWA  +  +      +E+      P LVPY+ +    K  +R+ + + +K L    Y++
Sbjct: 2701 FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRI--ERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKME------LESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAV 2903          

HSP 6 Score: 105.145 bits (261), Expect = 4.570e-21
Identity = 63/211 (29.86%), Postives = 103/211 (48.82%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-------INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDTS I LP  LE + ++ A+++H+ W +  +E G+ YG  R+D  + HP L+ F  L + ++   ++  +E LK ++A G  +       + H E +   +       +  GY P P DL  + +T     M +KLAENAHN+WA+ +            +    +  LVP+ +L D+ K   +    E ++ L   GY
Sbjct:  856 SLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIS----DEHAEDKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGY 1062          

HSP 7 Score: 75.0998 bits (183), Expect = 4.833e-12
Identity = 35/98 (35.71%), Postives = 62/98 (63.27%), Query Frame = 2
Query: 2990 SFLQSNG-YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            S + S G + PQP+D  NI++   LE  +N+ AE++H+ W+MD++  GW YG + +++ K  P + PY+ + +  K+  R    E++KT+LA+ + IE
Sbjct: 2693 SSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIE 2790          

HSP 8 Score: 66.6254 bits (161), Expect = 2.138e-9
Identity = 26/91 (28.57%), Postives = 58/91 (63.74%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA 9352
            +KP P+D S I+L  S E+++D+ A++ H+ WA + + +G+ YG+ ++  N+ +P L+ + LL    +    + + EA++ ++ +G+ ++A
Sbjct:  976 YKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEA 1066          
BLAST of Ryanodine receptor related vs. Ensembl Human
Match: RYR2 (ryanodine receptor 2 [Source:HGNC Symbol;Acc:HGNC:10484])

HSP 1 Score: 1536.16 bits (3976), Expect = 0.000e+0
Identity = 904/2075 (43.57%), Postives = 1248/2075 (60.14%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQ-GIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA--DLSRIEMHGERRRPTIIND-------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSR-YSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-------AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEK---NLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLY------------LVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEP-ITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQA---SDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+E I         K+A++      +  +   KTL     D E                 E++ D + +G AI+TFYS L+DLLGRCAPE       K  ++R+R+IL+SL+ + DL GV+S+ F +P      T+ +DG     D   M  G  P+HKA++VLFL+RVYGI+  +  L LLE  FL D+RAA  LD  +   +D ALALNRYL  +VLPLLT+ +      E  AS++++ LHT YRLS+  SLTK QR+ +   L+++  QL+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   G  G  G A+EEE  L+ +LF GIFD L++  Y+ ELF  ALPCL+A+  AL PDY     + S  +S +   S+    G                              +F PQPVDTS+I +P  LE  ++++A+H HD W+++ +  G++YG   +D +K  P +  + LLS+ ++  Y  P+ E+LK M+AWGW I+   +   + ++   RR +  +        GY+P   D+  V +++++  MAE +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK++ R+   ++LK+LQ NGY                G     LD PS  I++                        RFAY  L +L+RYV++A   + +    SR    + P+ QE   IKFF KVVLPL+++YF  H+ YF+   S        A N+EK+M  +LFCKL  L+R +++  G+D    V CL  L Q +D R ++K   T  + V+  L  F  N A+DL   ++NL   +F+H +   +     +NY  + LLP+L S+F+H+ +   G DL++ DVQV+CY+IL +LY LGT  S Y +R+         R  LGEC+AA A  FPVAFLE+HL+K+N YSI YN        A  +   +E    N+P+L+ ++EEIV+LAESG +YT+ PHV+EV LPMLCSY+  WW  GPEN  E A         T + ++ +N +LGN+LK+I NN+      WM R+A+ +QPI+      +L  HFLP+ EKLK  A     EE+  +AE +     A  +   +  +   L R+++AFYPLLI++VD +R  W+K+P  + + LF +VAE+F+ WSKS +FKREEQNFV QNEI+++S ++ D     KS+ S++A +D   KK   +  + S  TSL VA +KRLLPIGL++    +QELI  AK R                     K+ + ++ + +++ I L+ + +D    WQ  LYK +       + ++   E  ++RVL +A VL  L             LV+HP    K  W KL+S QRKRAV+ACFRM PL++LPRHR VNLFL  Y   W+  EE     +LIE++ +                         G EP E  EG           T   DPL QLI    RTA+ +     +D LY++YA IM+KSC  E+DDD +E       KS +E+EMEK ++L +Q RL DRGAAEMVL  I   +G    +V  +++LGI++L GGN++VQ +ML +LKEKK +GFF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G     L D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+E M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS ++F  AME  K Y   E E+++ C +++ +  +D+ EF  RFH+PAKDIGFNVAVLLTNL EHMPND RL+  +  A+ ++  F+P+LGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG+KEK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2323 GGNGLLAAMEEAI---------KIAEDPSRDGPSPNSGSSKTL-----DTE-----------------EEEDDTIHMGNAIMTFYSALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMP------TIAKDGNVVEPD---MSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDY-----MESNYVSMMEKQSSMDSEG------------------------------NFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGY------------AVSRGFKDLELDTPS--IEK------------------------RFAYSFLQQLIRYVDEAHQYILEFDGGSRGKGEHFPYEQE---IKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMK---TGLESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQ---------RSALGECLAAFAGAFPVAFLETHLDKHNIYSI-YNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSRWWEHGPENNPERA-----EMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSEAELL---ILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITD----TKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFS------------------LKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNR----TDDTSDPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKP------------------------GAEPPEEDEG-----------TKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEE-----VKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGL---GMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS 4191          

HSP 2 Score: 1172.15 bits (3031), Expect = 0.000e+0
Identity = 625/1326 (47.13%), Postives = 862/1326 (65.01%), Query Frame = 2
Query:  155 DDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYDTN---------------AIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSP-QHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYA----GNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFT 4036
            DD V L      H    + CL+A GFG+R CFLE+ S   N PPDLS+C F+L+Q+LSVRALQE++A   + +               A GG  GH+TLLYGHA+LL+H+ S M+L CLSTS SS DKLAFDVGLQE+   EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  NG      V A+FQQTLW+V P+SSG+  + + G + GGDVLRL HG  DECLTVP  +GEH   Q  +V YE GAVS HARSLWRLE ++  WSG  I WG   RLRHVT+G+YLS+    N +  + + +A   STAF  R SK+ K       E D MG+++IK+G++  ++QHV +  WL+Y++    K       +++A++  EGHMDDG ++++ Q EES++A  IR    +F RFI+ LD  + ++ ++S   + +  V   L+DLI +F  P+   EHE KQ +L AL+NRQ+LFQEEG+INL+L  ID+    +     F    G +  E +  + N LY LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  SS+RPN+F+GV E SA Y+KWYYE+ +D  E  VT     LRVGW++ EG+ P+PGG + WG   VGDDLFS+GFDG +LW+G   + + +   Q +L   D+I C LDL+ P I F IN +PV+G F +FNIDG+F+P VS SA + VR + GG HG  ++ PP GY+  +EA+LPKE+L++E    +   ++  Y     G + +     F P PV+T++I LP ++E IR+KLAENIHE+W M KI+ GW YG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +         ++K +KLP ++  ++GY+P P+DL  I L+   E +V++LAEN HN+WA DRI+QGW+YG  ++   +R+P LVPY  +DD  KKSN+ +  E V+TLL Y Y++E P  D +  A   S            R FRA+ T+ V +G+WY+E E +T G MR GW     +   E+GS+ +++AFD   A +W+  +  YG+  Q GDV+GCM+D+ + T+ F+LNGE+++D  G E+AFK+     G++P  S G  Q  ++NFG DV TLKYFT CGLQEGY PF VN +R + +W S+  P  F+ +   +  +EV    G++   P LK+  K FG Q S  ++ F RL +PI+C + F+
Sbjct:    1 DDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWLFSLKTAQGG--GHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSL---HVDAAFQQTLWSVAPISSGS--EAAQGYLIGGDVLRLLHGHMDECLTVP--SGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKN-LLLMDKEKADVKSTAFTFRSSKE-KLDVGVRKEVDGMGTSEIKYGDSVCYIQHVDTGLWLTYQS-VDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIRSTVFLFNRFIRGLDA-LSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLH-VYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC-HGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSP-NQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYK--QERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCS------GTGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLP-QFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFS 1299          

HSP 3 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 407/1105 (36.83%), Postives = 584/1105 (52.85%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK---------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDIS-C-CAEELKRKINIFHRKLMDNCGIEPPE--GLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKN--LSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHT 7717
            YY+SV + PGQ+   +++GW+TS F               +DT     +      T GD K                    +  S+  S  Y++   + ++    +++       G+ IGC +D A+G LTF  N +EL   +QV P T L+PA+F + T+     FELGR +N +P+ AG+ +   +   P    RL +Q L    WSR+ N   K+ + +++E +GW +   + +Q M++HIPEE+R +DILEL E  +LL+FH  TL LY  +C  GNH VA +L +H+DE Q  Y I+N Y+ G LR  ++DLLI +HL S++  +L   NE +VP+    +S  +     +K                     H +P    S S+ P +     +   +              PE   + LK+ +++ L  AV +G+    +P+GG+ E +FVPL+K+   LLIMG+  + D+  IL +++ + FK                            + A    R    +L M L E VKLQ+C LL  LCD Q+RHRIE IV  S+DFV+ +Q++Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF          KDD S C C EE++ ++  FH  LM +CGIE  E   LD N  L     T R R                        +L+L E+    + K   +  + D  K+  L Q+I  T++ WA+ + IE+ +L+R MF LL RQY+ +G +  +L KTY I+  S +D   LL SLG++R LL V++G+ EE L+   L DIMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E+   K      MV  CCRFLCYFCR S QNQK MF+HLSY+LENSS+ LA P++RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+  G+QS   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENAN+VVRLLIRRPEC GPALRG        +    A E  +  +   + +G + N G+S T
Sbjct: 1410 YYYSVRIFPGQEPANVWVGWITSDF-------------HQYDTGFDLDRVRTVTVTLGDEKGK------------------VHESIKRSNCYMVCAGESMSPGQGRNN------NGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFPDENKK---------------------HGLPGIGLSTSLRPRMQFSSPSFVSISNEC------YQYSPEFPLDILKSKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEESDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNF----------KDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDL-----TIRGR------------------------LLSLVEKVTYLKKKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEITFPK------MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEG-----GNGLLAAMEEAIKIAEDPSRDGPSPNSGSSKT 2355          

HSP 4 Score: 558.91 bits (1439), Expect = 2.950e-158
Identity = 284/487 (58.32%), Postives = 366/487 (75.15%), Query Frame = 2
Query: 14603 FEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ-----------KPSSDPEKMNSTDPDD---MEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-EASGSRGWLRKK--------MIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDG-VKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            F  K I     +++ FA+N YN ++ AL +AF INF+LLFY+V             + SS+  K+ S D      +    +L +S  YM    +ILA LH+  +   +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD+LV++T SFP NYWDKFVK+KV +KY E Y  + I  LLGM++ + + S +R   + K        + + D++Y +WK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD YE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD +PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCW+FFP GDCFRKQYE++L
Sbjct: 4463 FWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQL 4949          

HSP 5 Score: 106.686 bits (265), Expect = 1.774e-21
Identity = 61/211 (28.91%), Postives = 106/211 (50.24%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQS--------NGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F P+PV+T+ I +P  +E   +K AE+ H+ W+M K+  GW YG+   D +K  P +  ++ L   E++       E+L+T++A G+ I  E   EG  +          Q+        +GY P+ +D+ N++LS  L  +   +AEN HNIWA  +  +      +E+      P LVPY+ +    K  +R+ + + +K L    Y++
Sbjct: 2685 FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRI--ERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKME------LESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAV 2887          

HSP 6 Score: 105.145 bits (261), Expect = 4.885e-21
Identity = 63/211 (29.86%), Postives = 103/211 (48.82%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-------INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDTS I LP  LE + ++ A+++H+ W +  +E G+ YG  R+D  + HP L+ F  L + ++   ++  +E LK ++A G  +       + H E +   +       +  GY P P DL  + +T     M +KLAENAHN+WA+ +            +    +  LVP+ +L D+ K   +    E ++ L   GY
Sbjct:  840 SLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIS----DEHAEDKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGY 1046          

HSP 7 Score: 75.0998 bits (183), Expect = 4.872e-12
Identity = 35/98 (35.71%), Postives = 62/98 (63.27%), Query Frame = 2
Query: 2990 SFLQSNG-YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            S + S G + PQP+D  NI++   LE  +N+ AE++H+ W+MD++  GW YG + +++ K  P + PY+ + +  K+  R    E++KT+LA+ + IE
Sbjct: 2677 SSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIE 2774          

HSP 8 Score: 66.6254 bits (161), Expect = 2.247e-9
Identity = 26/91 (28.57%), Postives = 58/91 (63.74%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA 9352
            +KP P+D S I+L  S E+++D+ A++ H+ WA + + +G+ YG+ ++  N+ +P L+ + LL    +    + + EA++ ++ +G+ ++A
Sbjct:  960 YKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEA 1050          
BLAST of Ryanodine receptor related vs. Ensembl Human
Match: RYR3 (ryanodine receptor 3 [Source:HGNC Symbol;Acc:HGNC:10485])

HSP 1 Score: 1483 bits (3838), Expect = 0.000e+0
Identity = 892/2068 (43.13%), Postives = 1243/2068 (60.11%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGER-----RRPTIINDG--YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRP--SSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQ-------SMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLA-----AGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+  I +S    L   +Q  +  VS  ++                               E++ + V +G AI++FYS L+DLLGRCAPE     T K  ++R+R+IL+SLV  EDL G++S+   LP      ++N+DG     D   M     P+HKA +VLFL+RVYGI+D    L LLE  FL D+RA+  LD  S   ++ ALALNRY+ ++VLPLLT+ +      E   S++++TL T YRLS+ RSLTK QR+ + + L+A+   L+P M+ +LLR+L+ DVP L     +PL+LLT  Y++C  YY   +G    G+A EEE  LT +LF GIFD+L+   YDP+LF  ALPCL+AI  AL PDY         +I++                        E+Q+ V+A       D +F P+P++T +  LP  LE ++ ++A+H HD WA +  + G+ YG++ ++  KTHP +  F  L++ ++  Y  P  E+LK M+A GWT++       +  +R     R  +  N G  Y+P P DL  V +++E+  M E +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK + R+   +L K+LQ NG                 G     LD                           SS   RFAY  L K+L+YV+ A   +  +    SS  +   P  QE   IKFF KV+LPLV++YF +H  YF+            A ++EK+M A LFCKL +L+R +++  G D    V CL  L Q +D R ++K  S   + V+  L  FF N A+DL    +NL + +F+H +  ++  + ++NY  + LLP+L S+F+HV++   G DLL+GDVQ++CY IL +LY LGT  + Y +R+         RP LGEC+A++A   PVAFLE  LN+ N  S+    T       R ILG      ++  ++P L+ +++EI DLAESG +YTE PHVIEV LPMLC+YL  WW RGPEN+  +          T VT++ ++ +LGN+LK+I NN+    A WM RIA+  QPI+  A  ++L  HF+P  EKLK  A++  +EEE  Q +     +        L+ +  +L R+++AFYP+LI+YVD +R+ W+K P  D+D LF +VAE+F++W KS +FKREEQNFV QNEI++L+ +  D    +KS+ S+S   D   KK   R    S  TSL VA +K++LPIGL+M    +QELI  AK R         RDT            D ++ E+L+N + L+E+ DD    WQ  LYK + K     S E  + E  ++RV  ++  +  L  V+ P    K  W KL+S QRKRAV+ACFRM PL++LPRHR +NLFL  Y+  W+  EE     +L++++ +S K  E  E                                        PDPL Q+I    R A+ + S   DD LY SY+ +M+KSC   +D+++DE +     K+ +E+EMEK + L +Q RL +RGAAEMVL  I   +G ++ +V E+++LGI++L GGN  VQ +ML +LKEKK  GFF S+SGLMQ CSVLDL+ FER NKAEGL         +   +G   L + EFT  LFRFLQLLCEGHN  FQ++LR+Q GNTTTVN+II TVDYLLRLQESI DFYW+Y+GKD ID +G+ N  KA+ + KQIF +LTEYIQGPC+GNQ +LAHSRLWDA+ GFL +FA+MQ KLS+D  Q+ELL+E + L ++M++MLLS+LEGNVVNG IGKQMVDTLVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS KEF+ AME QK Y   EI++++ C +++ +   ++ +F DRFH+PAKDIGFNVAVLLTNL EHMPND+RL+ L+  A+ ++  FEPYLGRIEI G + +IERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG++EK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2236 GGNGLLAAMQGAIKISENPALDLPSQGYKREVSTGDD-------------------------------EEEEEIVHMGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLP------SLNKDGSVSEPD---MAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLPSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYL------DTRITAT----------------------LEKQISVDA-------DGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNG------------IIVSRGMKDMELD--------------------------ASSMEKRFAYKFLKKILKYVDSAQEFIAHLEAIVSSGKTEKSPRDQE---IKFFAKVLLPLVDQYFTSHCLYFLSSPLKPLSSSGYASHKEKEMVAGLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTVMKSGS---ELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQ---------RPALGECLASLAAAIPVAFLEPTLNRYNPLSVFNTKTPR----ERSILGMPDTVEDMCPDIPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPST-----GPCCTKVTSEHLSLILGNILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEE--QLKADGKGDTQEAELLILD-EFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGD----SKSKMSKSGGQDQERKKTKRRGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSH------RDT------------DEEVREHLRNNLHLQEKSDDPAVKWQLNLYKDVLK-----SEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEEEEEEET----------------------------------EKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDK----EKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQIS 4098          

HSP 2 Score: 1129.78 bits (2921), Expect = 0.000e+0
Identity = 606/1343 (45.12%), Postives = 874/1343 (65.08%), Query Frame = 2
Query:  137 ISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSG--HKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEED--SMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTT 4114
            I FLRT+D V L  +   H    +FCL+A G G+R CFLE  S  +  PPDL +C F+L+Q+LSVRALQE++A   +    G   G  H+TLLYGHAVLL+H+ S M+L+CL+TS S  DKLAFDVGL+E A  EACWWT+HPA+KQRSEGEKVRIGDDLILVSVSSERYLHL+  NG  IQ  V ASF QTLW V P  SG+  ++  G + GG V+RLFHG DECLT+P S  ++  QH  + YE G   + ARSLWR+E ++  WSG  I WG   RLRH+T+G YL+++     +    R+++   STAF  R SK+ K+     H+ D   MG  +IK+G++  F+QH++S  W++Y+A +  K       +++ ++  EGHMDDG T+ + Q EES++A  IR   ++F++F+          + ++   + + EV++ L+DLI +F  P  +  HE KQ KL +L+NRQ+LF+EEG++ L+L  ID+    +     F     E+    + ++ N LY LLAA+IRGNR NCAQF+  + +DW+  +L+  +S+ G+L+VLHC+LT+S EALN+I + HI+ +I LLDK GR+ +VL +LCSLC+   G AVR NQ LI DNLLP R+LLLQTRL++  +S+RPN+F+GV E SA Y+KWY+E+ ID ++  +T     LRVGW+++ G+ P+PGG +GWG   VGDDL+S+GFDG +LW+G  P+ + ++  Q +L   D++ C LDL VP I F IN +PV+G F +FN DG+F+P +S SA V VR + GG HG  ++ PP GY+  +EALLPKE++RLEP   +      I    G ++      FIP PV+T+++ LP ++E IRD+LAENIHE+W M KI+ GWT+G+ RDD  + HPCL  F +LP  E+ +++ ++ ETL+T++ALG  I +  P+    LK +KLP +++ SNGY+P PLDL ++ L    E LV++LAEN HN+WA DRIKQGW+YG  ++   KR+P LVPY  +D+  KKSNR +  E V+T + Y Y+IE    ++++ AV       ++     IR FR + ++ V SGKWY+E E++T G MR GW         E+G++ Q++ F+     +W+  SG +G+  QPGDV+GCM++L D ++ F+LNGEL++   G E+AF +   + G+VP    G  Q  ++N G D  T K++T CGLQEG+ PF VNM+R V +W+S+  P  FV++ K++  +EV    G++   P LK+  K FG Q S  +M + RL +P++C   F+     +  A  +  R+Q+  I   TT
Sbjct:   12 IQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIPPDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYLTCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSVSNG-NIQ--VDASFMQTLWNVHPTCSGSSIEE--GYLLGGHVVRLFHGHDECLTIP-STDQNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTEDQGLILQ-DRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIASGLWVTYKA-QDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQFVS------GNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLN-VYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFS--NNLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDILCSLCLC-NGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPRAVASI-NQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMSFSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGTTQFLSQASFIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAV-------EKVSIDKIRFFRVERSYAVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGRTWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGRMNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPT-FVNVPKDHPHIEVMRIDGTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQK--RKQMQEILSHTT 1325          

HSP 3 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 395/1090 (36.24%), Postives = 575/1090 (52.75%), Query Frame = 2
Query: 4415 QTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLR-RPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPA-----LRMPRVT-------------------RSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
             +S + S   D++      Q++E  L     Q Y+++ +  GQD   +++GWVT  + L          ++ FD      K+     T GD +                    +  SV  S  Y++   D++ +         + +  + IGC +D A G L+F  N +EL   +QV P T ++PA+F++PT+     FELG+ +N +P+ A + R   +   P    RL +Q +Q   WSR+ N+  K+   +++E  GW +   E +QMMA+HIPEE+RC+DILEL E   L+RFH  TL LY  +C  GN  VA +L +H+D +Q FY I N YL G LR+ F+DLLI++HL S    KL  +NE ++P+  + ++ R+     ++                     H +P       + P          + GE+ +         PEI  E L+  +L  L  AV   GA I +P+GGS E  FVP+LK++  LL+MG+   +D+  IL ++D + F    A          VT                   + +L   L ESVKLQ+C LL  LCD +L+HR+E IV   + +VS +Q +Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF              +C C EE++ ++  FH  L+ +CG+       + E   +   T  +  L  L   I  P      P+  +      E R       C  T        L ++I  T+I WA+   I++ +L+R MF+LL RQY+++GE+  +L+KTY IS+ S  D   LL +LG++R LL V++G+ EE+L+ N L DIMNNKVF+QHPNL R L +HETVM++MV+                                      L  + S  A P               +MV  CCRFLCYFCR S QNQK MFEHLSY+LENSS+ LA PS+RG+ PLDVA SS+MDNNELAL++ E  LEKV  YL+  G+QS   LL+KGYPD+GW+P+EGER+L FLRF V+VN E +EENA++VV+LLIRRPEC GPALRG
Sbjct: 1297 HSSFSHSPCLDSEAFQKRKQMQE-ILSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLY---------SEKFDL----NKNCTVTVTLGDERGR------------------VHESVKRSNCYMVWGGDIVAS----SQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPNTKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFRSEEKNPVPQCPPRLDVQTIQPVLWSRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYHTLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLASAKERKLMMKNEYIIPITSTTRNIRLFPDESKR---------------------HGLPGVGLRTCLKPGFRFSTPCFVVTGEDHQ------KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDDDDVRQILLLIDPSVFGEHSAGTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLPESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTARKTKEFRSPPQEQINMLLNFQLGE----------NCPCPEEIREELYDFHEDLLLHCGVP------LEEEEEEEEDTSWTGKLCALVYKIKGP------PKPEKEQPTEEEER-------CPTT--------LKELISQTMICWAQEDQIQDSELVRMMFNLLRRQYDSIGELLQALRKTYTISHTSVSDTINLLAALGQIRSLLSVRMGKEEELLMINGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVN-------------------------------------VLGTEKSQIAFP---------------KMVASCCRFLCYFCRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALSLEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIRRPECFGPALRG 2234          

HSP 4 Score: 561.992 bits (1447), Expect = 3.427e-159
Identity = 281/473 (59.41%), Postives = 364/473 (76.96%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSS----DPEKMNSTDPDDMEE----FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQ------PSEASGSRGWLRKKMIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIK-DNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            T ++   A+N YN +  AL +AF INF+LLFY+V ++P      D   + ++  D+ EE    F +L +S  YM    + LA +H+  +L  ++ YYCLKVPLV+FKREKEI+R LEF+G++ITEQP++D++K  WD+LV++TPSFP NYWDKFVK+KV NKY + Y    I  LLG+++      P E + +       +++W    D++Y IWK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K ++D   DMKC +M+TC++FH++ G+RAGGGIGDEIE P GDPYE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQV+EDME+KCFICGIG +YFD  PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4395 TKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKNALDFSPVEETKAEA---ASLVSWLSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 4864          

HSP 5 Score: 116.316 bits (290), Expect = 2.190e-24
Identity = 81/258 (31.40%), Postives = 126/258 (48.84%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEG-------SRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTL----LAYNYSIETPPTDVSEMAVSNSFNILKR--KGSSAIRTFRAQSTWKVTSGK 3403
            F P+P+ T    LP  +E I  K AE+ H+ WA  K   GW YG + D+  KTHP +  F+ L   E++     A E+L+T++A+G+T+      E         +L+++   N   Q N Y P PLDL N+ LS  L+ +V  +AEN HNIWA  +  +  S G   +      P LVPY+ +    K  +R+ + +  K L    +  +  ++    D S M    ++  LK+  K   + + F A     V+SGK
Sbjct: 2598 FDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQAN---QGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGSH------PLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSRGMKDMELDASSMEKRFAYKFLKKILKYVDSAQEFIAHLEAIVSSGK 2846          

HSP 6 Score: 103.605 bits (257), Expect = 1.266e-20
Identity = 60/205 (29.27%), Postives = 105/205 (51.22%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDTS + LP  LE + D+ A+++H+ W +  +E G+ +G  R+D  + HP L+ F  L + ++   ++   E LK ++A G  I       + DL ++++     +  ++++GY P P DL  V +      + +KLAENAHN+WA+ +     + G         +  LVP+ +L ++ K   R    E ++     GY
Sbjct:  849 FIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKL----PKNYMMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGY 1049          

HSP 7 Score: 63.5438 bits (153), Expect = 1.834e-8
Identity = 26/92 (28.26%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP P+D S ++L    E L+D+ A++ H+ WA + +++G+ YG+ ++  NK +P L+ + LL +  +    + + EA++  + +G+ I+
Sbjct:  961 NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIE 1052          
BLAST of Ryanodine receptor related vs. Ensembl Human
Match: RYR3 (ryanodine receptor 3 [Source:HGNC Symbol;Acc:HGNC:10485])

HSP 1 Score: 1481.85 bits (3835), Expect = 0.000e+0
Identity = 891/2069 (43.06%), Postives = 1242/2069 (60.03%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGER-----RRPTIINDG--YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRP--SSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQ-------SMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSN-NKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLA-----AGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+  I +S    L   +Q  +  V+ D+                                E++ + V +G AI++FYS L+DLLGRCAPE     T K  ++R+R+IL+SLV  EDL G++S+   LP      ++N+DG     D   M     P+HKA +VLFL+RVYGI+D    L LLE  FL D+RA+  LD  S   ++ ALALNRY+ ++VLPLLT+ +      E   S++++TL T YRLS+ RSLTK QR+ + + L+A+   L+P M+ +LLR+L+ DVP L     +PL+LLT  Y++C  YY   +G    G+A EEE  LT +LF GIFD+L+   YDP+LF  ALPCL+AI  AL PDY         +I++                        E+Q+ V+A       D +F P+P++T +  LP  LE ++ ++A+H HD WA +  + G+ YG++ ++  KTHP +  F  L++ ++  Y  P  E+LK M+A GWT++       +  +R     R  +  N G  Y+P P DL  V +++E+  M E +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK + R+   +L K+LQ NG                 G     LD                           SS   RFAY  L K+L+YV+ A   +  +    SS  +   P  QE   IKFF KV+LPLV++YF +H  YF+            A ++EK+M A LFCKL +L+R +++  G D    V CL  L Q +D R ++K  S   + V+  L  FF N A+DL    +NL + +F+H +  ++  + ++NY  + LLP+L S+F+HV++   G DLL+GDVQ++CY IL +LY LGT  + Y +R+         RP LGEC+A++A   PVAFLE  LN+ N  S+    T       R ILG      ++  ++P L+ +++EI DLAESG +YTE PHVIEV LPMLC+YL  WW RGPEN+  +          T VT++ ++ +LGN+LK+I NN+    A WM RIA+  QPI+  A  ++L  HF+P  EKLK  A++  +EEE  Q +     +        L+ +  +L R+++AFYP+LI+YVD +R+ W+K P  D+D LF +VAE+F++W KS +FKREEQNFV QNEI++L+ +  D  S  +K+   +S   D   KK   R    S  TSL VA +K++LPIGL+M    +QELI  AK R         RDT            D ++ E+L+N + L+E+ DD    WQ  LYK + K     S E  + E  ++RV  ++  +  L  V+ P    K  W KL+S QRKRAV+ACFRM PL++LPRHR +NLFL  Y+  W+  EE     +L++++ +S K  E  E                                        PDPL Q+I    R A+ + S   DD LY SY+ +M+KSC   +D+++DE +     K+ +E+EMEK + L +Q RL +RGAAEMVL  I   +G ++ +V E+++LGI++L GGN  VQ +ML +LKEKK  GFF S+SGLMQ CSVLDL+ FER NKAEGL         +   +G   L + EFT  LFRFLQLLCEGHN  FQ++LR+Q GNTTTVN+II TVDYLLRLQESI DFYW+Y+GKD ID +G+ N  KA+ + KQIF +LTEYIQGPC+GNQ +LAHSRLWDA+ GFL +FA+MQ KLS+D  Q+ELL+E + L ++M++MLLS+LEGNVVNG IGKQMVDTLVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS KEF+ AME QK Y   EI++++ C +++ +   ++ +F DRFH+PAKDIGFNVAVLLTNL EHMPND+RL+ L+  A+ ++  FEPYLGRIEI G + +IERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG++EK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2236 GGNGLLAAMQGAIKISENPALDLPSQGYKREVTGDD--------------------------------EEEEEIVHMGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLP------SLNKDGSVSEPD---MAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLPSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYL------DTRITAT----------------------LEKQISVDA-------DGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNG------------IIVSRGMKDMELD--------------------------ASSMEKRFAYKFLKKILKYVDSAQEFIAHLEAIVSSGKTEKSPRDQE---IKFFAKVLLPLVDQYFTSHCLYFLSSPLKPLSSSGYASHKEKEMVAGLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTVMKSGS---ELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQ---------RPALGECLASLAAAIPVAFLEPTLNRYNPLSVFNTKTPR----ERSILGMPDTVEDMCPDIPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPST-----GPCCTKVTSEHLSLILGNILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEE--QLKADGKGDTQEAELLILD-EFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSH------RDT------------DEEVREHLRNNLHLQEKSDDPAVKWQLNLYKDVLK-----SEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEEEEEEET----------------------------------EKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDK----EKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQIS 4102          

HSP 2 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 606/1343 (45.12%), Postives = 874/1343 (65.08%), Query Frame = 2
Query:  137 ISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSG--HKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEED--SMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTT 4114
            I FLRT+D V L  +   H    +FCL+A G G+R CFLE  S  +  PPDL +C F+L+Q+LSVRALQE++A   +    G   G  H+TLLYGHAVLL+H+ S M+L+CL+TS S  DKLAFDVGL+E A  EACWWT+HPA+KQRSEGEKVRIGDDLILVSVSSERYLHL+  NG  IQ  V ASF QTLW V P  SG+  ++  G + GG V+RLFHG DECLT+P S  ++  QH  + YE G   + ARSLWR+E ++  WSG  I WG   RLRH+T+G YL+++     +    R+++   STAF  R SK+ K+     H+ D   MG  +IK+G++  F+QH++S  W++Y+A +  K       +++ ++  EGHMDDG T+ + Q EES++A  IR   ++F++F+          + ++   + + EV++ L+DLI +F  P  +  HE KQ KL +L+NRQ+LF+EEG++ L+L  ID+    +     F     E+    + ++ N LY LLAA+IRGNR NCAQF+  + +DW+  +L+  +S+ G+L+VLHC+LT+S EALN+I + HI+ +I LLDK GR+ +VL +LCSLC+   G AVR NQ LI DNLLP R+LLLQTRL++  +S+RPN+F+GV E SA Y+KWY+E+ ID ++  +T     LRVGW+++ G+ P+PGG +GWG   VGDDL+S+GFDG +LW+G  P+ + ++  Q +L   D++ C LDL VP I F IN +PV+G F +FN DG+F+P +S SA V VR + GG HG  ++ PP GY+  +EALLPKE++RLEP   +      I    G ++      FIP PV+T+++ LP ++E IRD+LAENIHE+W M KI+ GWT+G+ RDD  + HPCL  F +LP  E+ +++ ++ ETL+T++ALG  I +  P+    LK +KLP +++ SNGY+P PLDL ++ L    E LV++LAEN HN+WA DRIKQGW+YG  ++   KR+P LVPY  +D+  KKSNR +  E V+T + Y Y+IE    ++++ AV       ++     IR FR + ++ V SGKWY+E E++T G MR GW         E+G++ Q++ F+     +W+  SG +G+  QPGDV+GCM++L D ++ F+LNGEL++   G E+AF +   + G+VP    G  Q  ++N G D  T K++T CGLQEG+ PF VNM+R V +W+S+  P  FV++ K++  +EV    G++   P LK+  K FG Q S  +M + RL +P++C   F+     +  A  +  R+Q+  I   TT
Sbjct:   12 IQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIPPDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYLTCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSVSNG-NIQ--VDASFMQTLWNVHPTCSGSSIEE--GYLLGGHVVRLFHGHDECLTIP-STDQNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTEDQGLILQ-DRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIASGLWVTYKA-QDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQFVS------GNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLN-VYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFS--NNLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDILCSLCLC-NGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPRAVASI-NQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMSFSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGTTQFLSQASFIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAV-------EKVSIDKIRFFRVERSYAVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGRTWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGRMNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPT-FVNVPKDHPHIEVMRIDGTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQK--RKQMQEILSHTT 1325          

HSP 3 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 395/1090 (36.24%), Postives = 575/1090 (52.75%), Query Frame = 2
Query: 4415 QTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLR-RPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPA-----LRMPRVT-------------------RSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
             +S + S   D++      Q++E  L     Q Y+++ +  GQD   +++GWVT  + L          ++ FD      K+     T GD +                    +  SV  S  Y++   D++ +         + +  + IGC +D A G L+F  N +EL   +QV P T ++PA+F++PT+     FELG+ +N +P+ A + R   +   P    RL +Q +Q   WSR+ N+  K+   +++E  GW +   E +QMMA+HIPEE+RC+DILEL E   L+RFH  TL LY  +C  GN  VA +L +H+D +Q FY I N YL G LR+ F+DLLI++HL S    KL  +NE ++P+  + ++ R+     ++                     H +P       + P          + GE+ +         PEI  E L+  +L  L  AV   GA I +P+GGS E  FVP+LK++  LL+MG+   +D+  IL ++D + F    A          VT                   + +L   L ESVKLQ+C LL  LCD +L+HR+E IV   + +VS +Q +Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF              +C C EE++ ++  FH  L+ +CG+       + E   +   T  +  L  L   I  P      P+  +      E R       C  T        L ++I  T+I WA+   I++ +L+R MF+LL RQY+++GE+  +L+KTY IS+ S  D   LL +LG++R LL V++G+ EE+L+ N L DIMNNKVF+QHPNL R L +HETVM++MV+                                      L  + S  A P               +MV  CCRFLCYFCR S QNQK MFEHLSY+LENSS+ LA PS+RG+ PLDVA SS+MDNNELAL++ E  LEKV  YL+  G+QS   LL+KGYPD+GW+P+EGER+L FLRF V+VN E +EENA++VV+LLIRRPEC GPALRG
Sbjct: 1297 HSSFSHSPCLDSEAFQKRKQMQE-ILSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLY---------SEKFDL----NKNCTVTVTLGDERGR------------------VHESVKRSNCYMVWGGDIVAS----SQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPNTKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFRSEEKNPVPQCPPRLDVQTIQPVLWSRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYHTLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLASAKERKLMMKNEYIIPITSTTRNIRLFPDESKR---------------------HGLPGVGLRTCLKPGFRFSTPCFVVTGEDHQ------KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDDDDVRQILLLIDPSVFGEHSAGTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLPESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTARKTKEFRSPPQEQINMLLNFQLGE----------NCPCPEEIREELYDFHEDLLLHCGVP------LEEEEEEEEDTSWTGKLCALVYKIKGP------PKPEKEQPTEEEER-------CPTT--------LKELISQTMICWAQEDQIQDSELVRMMFNLLRRQYDSIGELLQALRKTYTISHTSVSDTINLLAALGQIRSLLSVRMGKEEELLMINGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVN-------------------------------------VLGTEKSQIAFP---------------KMVASCCRFLCYFCRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALSLEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIRRPECFGPALRG 2234          

HSP 4 Score: 561.992 bits (1447), Expect = 3.489e-159
Identity = 281/473 (59.41%), Postives = 364/473 (76.96%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSS----DPEKMNSTDPDDMEE----FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQ------PSEASGSRGWLRKKMIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIK-DNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            T ++   A+N YN +  AL +AF INF+LLFY+V ++P      D   + ++  D+ EE    F +L +S  YM    + LA +H+  +L  ++ YYCLKVPLV+FKREKEI+R LEF+G++ITEQP++D++K  WD+LV++TPSFP NYWDKFVK+KV NKY + Y    I  LLG+++      P E + +       +++W    D++Y IWK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K ++D   DMKC +M+TC++FH++ G+RAGGGIGDEIE P GDPYE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQV+EDME+KCFICGIG +YFD  PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4399 TKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKNALDFSPVEETKAEA---ASLVSWLSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 4868          

HSP 5 Score: 116.316 bits (290), Expect = 2.209e-24
Identity = 81/258 (31.40%), Postives = 126/258 (48.84%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEG-------SRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTL----LAYNYSIETPPTDVSEMAVSNSFNILKR--KGSSAIRTFRAQSTWKVTSGK 3403
            F P+P+ T    LP  +E I  K AE+ H+ WA  K   GW YG + D+  KTHP +  F+ L   E++     A E+L+T++A+G+T+      E         +L+++   N   Q N Y P PLDL N+ LS  L+ +V  +AEN HNIWA  +  +  S G   +      P LVPY+ +    K  +R+ + +  K L    +  +  ++    D S M    ++  LK+  K   + + F A     V+SGK
Sbjct: 2597 FDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQAN---QGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGSH------PLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSRGMKDMELDASSMEKRFAYKFLKKILKYVDSAQEFIAHLEAIVSSGK 2845          

HSP 6 Score: 103.605 bits (257), Expect = 1.266e-20
Identity = 60/205 (29.27%), Postives = 105/205 (51.22%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDTS + LP  LE + D+ A+++H+ W +  +E G+ +G  R+D  + HP L+ F  L + ++   ++   E LK ++A G  I       + DL ++++     +  ++++GY P P DL  V +      + +KLAENAHN+WA+ +     + G         +  LVP+ +L ++ K   R    E ++     GY
Sbjct:  849 FIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKL----PKNYMMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGY 1049          

HSP 7 Score: 63.5438 bits (153), Expect = 1.849e-8
Identity = 26/92 (28.26%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP P+D S ++L    E L+D+ A++ H+ WA + +++G+ YG+ ++  NK +P L+ + LL +  +    + + EA++  + +G+ I+
Sbjct:  961 NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIE 1052          
BLAST of Ryanodine receptor related vs. Ensembl Human
Match: RYR3 (ryanodine receptor 3 [Source:HGNC Symbol;Acc:HGNC:10485])

HSP 1 Score: 1480.69 bits (3832), Expect = 0.000e+0
Identity = 891/2069 (43.06%), Postives = 1242/2069 (60.03%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGER-----RRPTIINDG--YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRP--SSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQ-------SMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSN-NKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLA-----AGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+  I +S    L   +Q  +  VS  ++                               E++ + V +G AI++FYS L+DLLGRCAPE     T K  ++R+R+IL+SLV  EDL G++S+   LP      ++N+DG     D   M     P+HKA +VLFL+RVYGI+D    L LLE  FL D+RA+  LD  S   ++ ALALNRY+ ++VLPLLT+ +      E   S++++TL T YRLS+ RSLTK QR+ + + L+A+   L+P M+ +LLR+L+ DVP L     +PL+LLT  Y++C  YY   +G    G+A EEE  LT +LF GIFD+L+   YDP+LF  ALPCL+AI  AL PDY         +I++                        E+Q+ V+A       D +F P+P++T +  LP  LE ++ ++A+H HD WA +  + G+ YG++ ++  KTHP +  F  L++ ++  Y  P  E+LK M+A GWT++       +  +R     R  +  N G  Y+P P DL  V +++E+  M E +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK + R+   +L K+LQ NG                 G     LD                           SS   RFAY  L K+L+YV+ A   +  +    SS  +   P  QE   IKFF KV+LPLV++YF +H  YF+            A ++EK+M A LFCKL +L+R +++  G D    V CL  L Q +D R ++K  S   + V+  L  FF N A+DL    +NL + +F+H +  ++  + ++NY  + LLP+L S+F+HV++   G DLL+GDVQ++CY IL +LY LGT  + Y +R+         RP LGEC+A++A   PVAFLE  LN+ N  S+    T       R ILG      ++  ++P L+ +++EI DLAESG +YTE PHVIEV LPMLC+YL  WW RGPEN+  +          T VT++ ++ +LGN+LK+I NN+    A WM RIA+  QPI+  A  ++L  HF+P  EKLK  A++  +EEE  Q +     +        L+ +  +L R+++AFYP+LI+YVD +R+ W+K P  D+D LF +VAE+F++W KS +FKREEQNFV QNEI++L+ +  D  S  +K+   +S   D   KK   R    S  TSL VA +K++LPIGL+M    +QELI  AK R         RDT            D ++ E+L+N + L+E+ DD    WQ  LYK + K     S E  + E  ++RV  ++  +  L  V+ P    K  W KL+S QRKRAV+ACFRM PL++LPRHR +NLFL  Y+  W+  EE     +L++++ +S K  E  E                                        PDPL Q+I    R A+ + S   DD LY SY+ +M+KSC   +D+++DE +     K+ +E+EMEK + L +Q RL +RGAAEMVL  I   +G ++ +V E+++LGI++L GGN  VQ +ML +LKEKK  GFF S+SGLMQ CSVLDL+ FER NKAEGL         +   +G   L + EFT  LFRFLQLLCEGHN  FQ++LR+Q GNTTTVN+II TVDYLLRLQESI DFYW+Y+GKD ID +G+ N  KA+ + KQIF +LTEYIQGPC+GNQ +LAHSRLWDA+ GFL +FA+MQ KLS+D  Q+ELL+E + L ++M++MLLS+LEGNVVNG IGKQMVDTLVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS KEF+ AME QK Y   EI++++ C +++ +   ++ +F DRFH+PAKDIGFNVAVLLTNL EHMPND+RL+ L+  A+ ++  FEPYLGRIEI G + +IERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG++EK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2236 GGNGLLAAMQGAIKISENPALDLPSQGYKREVSTGDD-------------------------------EEEEEIVHMGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLP------SLNKDGSVSEPD---MAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLPSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYL------DTRITAT----------------------LEKQISVDA-------DGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNG------------IIVSRGMKDMELD--------------------------ASSMEKRFAYKFLKKILKYVDSAQEFIAHLEAIVSSGKTEKSPRDQE---IKFFAKVLLPLVDQYFTSHCLYFLSSPLKPLSSSGYASHKEKEMVAGLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTVMKSGS---ELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQ---------RPALGECLASLAAAIPVAFLEPTLNRYNPLSVFNTKTPR----ERSILGMPDTVEDMCPDIPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPST-----GPCCTKVTSEHLSLILGNILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEE--QLKADGKGDTQEAELLILD-EFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSH------RDT------------DEEVREHLRNNLHLQEKSDDPAVKWQLNLYKDVLK-----SEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEEEEEEET----------------------------------EKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDK----EKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQIS 4103          

HSP 2 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 606/1343 (45.12%), Postives = 874/1343 (65.08%), Query Frame = 2
Query:  137 ISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSG--HKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEED--SMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTT 4114
            I FLRT+D V L  +   H    +FCL+A G G+R CFLE  S  +  PPDL +C F+L+Q+LSVRALQE++A   +    G   G  H+TLLYGHAVLL+H+ S M+L+CL+TS S  DKLAFDVGL+E A  EACWWT+HPA+KQRSEGEKVRIGDDLILVSVSSERYLHL+  NG  IQ  V ASF QTLW V P  SG+  ++  G + GG V+RLFHG DECLT+P S  ++  QH  + YE G   + ARSLWR+E ++  WSG  I WG   RLRH+T+G YL+++     +    R+++   STAF  R SK+ K+     H+ D   MG  +IK+G++  F+QH++S  W++Y+A +  K       +++ ++  EGHMDDG T+ + Q EES++A  IR   ++F++F+          + ++   + + EV++ L+DLI +F  P  +  HE KQ KL +L+NRQ+LF+EEG++ L+L  ID+    +     F     E+    + ++ N LY LLAA+IRGNR NCAQF+  + +DW+  +L+  +S+ G+L+VLHC+LT+S EALN+I + HI+ +I LLDK GR+ +VL +LCSLC+   G AVR NQ LI DNLLP R+LLLQTRL++  +S+RPN+F+GV E SA Y+KWY+E+ ID ++  +T     LRVGW+++ G+ P+PGG +GWG   VGDDL+S+GFDG +LW+G  P+ + ++  Q +L   D++ C LDL VP I F IN +PV+G F +FN DG+F+P +S SA V VR + GG HG  ++ PP GY+  +EALLPKE++RLEP   +      I    G ++      FIP PV+T+++ LP ++E IRD+LAENIHE+W M KI+ GWT+G+ RDD  + HPCL  F +LP  E+ +++ ++ ETL+T++ALG  I +  P+    LK +KLP +++ SNGY+P PLDL ++ L    E LV++LAEN HN+WA DRIKQGW+YG  ++   KR+P LVPY  +D+  KKSNR +  E V+T + Y Y+IE    ++++ AV       ++     IR FR + ++ V SGKWY+E E++T G MR GW         E+G++ Q++ F+     +W+  SG +G+  QPGDV+GCM++L D ++ F+LNGEL++   G E+AF +   + G+VP    G  Q  ++N G D  T K++T CGLQEG+ PF VNM+R V +W+S+  P  FV++ K++  +EV    G++   P LK+  K FG Q S  +M + RL +P++C   F+     +  A  +  R+Q+  I   TT
Sbjct:   12 IQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIPPDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYLTCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSVSNG-NIQ--VDASFMQTLWNVHPTCSGSSIEE--GYLLGGHVVRLFHGHDECLTIP-STDQNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTEDQGLILQ-DRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIASGLWVTYKA-QDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQFVS------GNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLN-VYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFS--NNLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDILCSLCLC-NGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPRAVASI-NQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMSFSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGTTQFLSQASFIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAV-------EKVSIDKIRFFRVERSYAVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGRTWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGRMNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPT-FVNVPKDHPHIEVMRIDGTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQK--RKQMQEILSHTT 1325          

HSP 3 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 395/1090 (36.24%), Postives = 575/1090 (52.75%), Query Frame = 2
Query: 4415 QTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLR-RPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPA-----LRMPRVT-------------------RSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
             +S + S   D++      Q++E  L     Q Y+++ +  GQD   +++GWVT  + L          ++ FD      K+     T GD +                    +  SV  S  Y++   D++ +         + +  + IGC +D A G L+F  N +EL   +QV P T ++PA+F++PT+     FELG+ +N +P+ A + R   +   P    RL +Q +Q   WSR+ N+  K+   +++E  GW +   E +QMMA+HIPEE+RC+DILEL E   L+RFH  TL LY  +C  GN  VA +L +H+D +Q FY I N YL G LR+ F+DLLI++HL S    KL  +NE ++P+  + ++ R+     ++                     H +P       + P          + GE+ +         PEI  E L+  +L  L  AV   GA I +P+GGS E  FVP+LK++  LL+MG+   +D+  IL ++D + F    A          VT                   + +L   L ESVKLQ+C LL  LCD +L+HR+E IV   + +VS +Q +Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF              +C C EE++ ++  FH  L+ +CG+       + E   +   T  +  L  L   I  P      P+  +      E R       C  T        L ++I  T+I WA+   I++ +L+R MF+LL RQY+++GE+  +L+KTY IS+ S  D   LL +LG++R LL V++G+ EE+L+ N L DIMNNKVF+QHPNL R L +HETVM++MV+                                      L  + S  A P               +MV  CCRFLCYFCR S QNQK MFEHLSY+LENSS+ LA PS+RG+ PLDVA SS+MDNNELAL++ E  LEKV  YL+  G+QS   LL+KGYPD+GW+P+EGER+L FLRF V+VN E +EENA++VV+LLIRRPEC GPALRG
Sbjct: 1297 HSSFSHSPCLDSEAFQKRKQMQE-ILSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLY---------SEKFDL----NKNCTVTVTLGDERGR------------------VHESVKRSNCYMVWGGDIVAS----SQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPNTKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFRSEEKNPVPQCPPRLDVQTIQPVLWSRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYHTLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLASAKERKLMMKNEYIIPITSTTRNIRLFPDESKR---------------------HGLPGVGLRTCLKPGFRFSTPCFVVTGEDHQ------KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDDDDVRQILLLIDPSVFGEHSAGTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLPESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTARKTKEFRSPPQEQINMLLNFQLGE----------NCPCPEEIREELYDFHEDLLLHCGVP------LEEEEEEEEDTSWTGKLCALVYKIKGP------PKPEKEQPTEEEER-------CPTT--------LKELISQTMICWAQEDQIQDSELVRMMFNLLRRQYDSIGELLQALRKTYTISHTSVSDTINLLAALGQIRSLLSVRMGKEEELLMINGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVN-------------------------------------VLGTEKSQIAFP---------------KMVASCCRFLCYFCRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALSLEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIRRPECFGPALRG 2234          

HSP 4 Score: 561.992 bits (1447), Expect = 3.346e-159
Identity = 281/473 (59.41%), Postives = 364/473 (76.96%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSS----DPEKMNSTDPDDMEE----FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQ------PSEASGSRGWLRKKMIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIK-DNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            T ++   A+N YN +  AL +AF INF+LLFY+V ++P      D   + ++  D+ EE    F +L +S  YM    + LA +H+  +L  ++ YYCLKVPLV+FKREKEI+R LEF+G++ITEQP++D++K  WD+LV++TPSFP NYWDKFVK+KV NKY + Y    I  LLG+++      P E + +       +++W    D++Y IWK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K ++D   DMKC +M+TC++FH++ G+RAGGGIGDEIE P GDPYE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQV+EDME+KCFICGIG +YFD  PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4400 TKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKNALDFSPVEETKAEA---ASLVSWLSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 4869          

HSP 5 Score: 116.316 bits (290), Expect = 2.190e-24
Identity = 81/258 (31.40%), Postives = 126/258 (48.84%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEG-------SRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTL----LAYNYSIETPPTDVSEMAVSNSFNILKR--KGSSAIRTFRAQSTWKVTSGK 3403
            F P+P+ T    LP  +E I  K AE+ H+ WA  K   GW YG + D+  KTHP +  F+ L   E++     A E+L+T++A+G+T+      E         +L+++   N   Q N Y P PLDL N+ LS  L+ +V  +AEN HNIWA  +  +  S G   +      P LVPY+ +    K  +R+ + +  K L    +  +  ++    D S M    ++  LK+  K   + + F A     V+SGK
Sbjct: 2598 FDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRENEKLRSVSQAN---QGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGSH------PLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSRGMKDMELDASSMEKRFAYKFLKKILKYVDSAQEFIAHLEAIVSSGK 2846          

HSP 6 Score: 103.605 bits (257), Expect = 1.266e-20
Identity = 60/205 (29.27%), Postives = 105/205 (51.22%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDTS + LP  LE + D+ A+++H+ W +  +E G+ +G  R+D  + HP L+ F  L + ++   ++   E LK ++A G  I       + DL ++++     +  ++++GY P P DL  V +      + +KLAENAHN+WA+ +     + G         +  LVP+ +L ++ K   R    E ++     GY
Sbjct:  849 FIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKL----PKNYMMSNGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGY 1049          

HSP 7 Score: 63.5438 bits (153), Expect = 1.834e-8
Identity = 26/92 (28.26%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP P+D S ++L    E L+D+ A++ H+ WA + +++G+ YG+ ++  NK +P L+ + LL +  +    + + EA++  + +G+ I+
Sbjct:  961 NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIE 1052          
BLAST of Ryanodine receptor related vs. Ensembl Celegans
Match: unc-68 (pep chromosome:WBcel235:V:6901697:6924961:-1 gene:WBGene00006801.1 transcript:K11C4.5p.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-68)

HSP 1 Score: 2208.34 bits (5721), Expect = 0.000e+0
Identity = 1287/3167 (40.64%), Postives = 1851/3167 (58.45%), Query Frame = 2
Query: 4502 MDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFD----TRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRA-TPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQT-ESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKD--------DISCC--AEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILP---APQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESV-VPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWT---IDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-----AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLT-MERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLE-EEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS------DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVV-NEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            +D+YY+ + + PGQD  Q+++GWVT+ +            N +FD     R  +      H T  DS +S +        C                 Y++NV+++L       D+      G  IGC +D + G L+F++ S +  I F++ P   L+PA FV PTA E   FELGR + T P+ A M +   ++  P    RL ++ ++  +W+RV N   +   LKL+EVRGWS+L  + V++M+V+IPE+D+ LDILE+ E P +L FH +TL LY  +  +GNH VA +L  H+DE+Q  Y I++HYL G +R  F DLLI +HL SH+  +     E V+PL   LQ   V +   +                       + P  T ES S+   + S+ V   +  E+   + P     P +++E LK   ++ L +A +       + IGG   N F PL K+ D LL++G++   ++  +L ++    F            + +  + L E VK+QL  +L  LCDIQLR+RIE +V  +  FV  +Q+DQ +RY+EIKQ+D+P +  AK TKEFRCPP++QM     F        EE+D        D+  C  AE L++++  F   L+   G    EG   ++L                   +   EEG  +  F + ++ +    P+ E  + ++       +N  ++I   L  WA++ FIE+  LIR MF LL RQY+ + EI++++ +TYV   +++ DVT  L  L ++R LL VQ    EE +LK  LW +MNN++FFQHP+L R L+VHE VM +M++ LT                                    A Q ++    +E  E  K      +EMVV C RFLCYFCRTS QNQK MFEHLS++L+N++MLLARPSLRG+ PLDVAYSS MDNNELALA++E++L+KVAVYLSR G+Q N EL++KGYPDIGWDPVEGER++DFLRF VW+NGE +EENANLV+RLLIRRPECLG AL+G               E   +FSA       +E+I            SHP++ ++         GLL                             ENP   T P   A+ ED                     Y+DLGAA L FYS LVDLL +CAP+       K  SLR RAIL+SL+S++DL  +L+LRF +P   AP +E T             G  PGLLP HK SV+LFL+RVYGI   +    +LE +FL D+RAAT++D   + +SD ALALNRYL NSVLPLLT HSH+  + E  +++L+ TLHT YR++R +SLTK QR+ VSDFLVA+T++L P M+ KLL+K+I D+ ++   +V VPLRL+T  Y+RCG YY S      G+A+E+EK+L+  LF  IFD L   PYDPELF KALPC+TAIG A+SPDY+    L  ++        A                                    + P+ VD S   +   LE + + FA+H HDSWA   +EKG+V+G   +  N THP L  F LL   ++  Y E   E LKA++AW ++   +D D +           T I++ + P P DL  + + K+M++ AEK+AE++H IWA+    D+++ GG +   LVP+++LTD E+ + R   +E+LK+LQY+GY                      ++ P D       Q Q  +  + GE  +TS E  RFAY LL KL+ Y+EQA + ++ ++PS   +R   F +E +D+KFF KVVLPL+  YF AHKNYF+   S+     A N+EK+M A LFC+L +LLR K  A G    I+V+CLQGL QA+D+R +VK++S   D VR  LL FF NCADDL   +  L    ++S ++G   +   S  + + +++PVL +MF H+++ + G DLL+ D+Q ACYKIL++LY +   SS  + R+ I+ E  +HRP LG+C+AA A  FPVAFLE   NK+NK+S+L   + + S++ +E+L  L  ++P+L+ ++ ++  +A +   Y++ P+V +V LP++CSY+  W+S GP+   +   +       T+V+   IN +   +LK+IRN++   +APW+ R+      I+ N T + + E  LP+AE+L+  + +A KEEE         +      E  + +    LVR+ +AF+P+L+KY DLHR  W+K PT +TD ++  VA IF IWS+S HFKREE N+V Q E D  +    D  +   + A R        K+   +  K     S+ +AC+KRLLP+GL++FGGRE +++Q++K++                   IQKE +  I E++K  +++  + D      WQ  LY+KIGK++     E +S++ +I+++  + +V   L+  +HP   L  +WKK++S+QRKRAV+ACFRM+PL+ +PRHRG+N FL A+  +W+  E+    +LI ++    ++ E   I              +G     +SE   E         T PDPL QLI   +R A  + +      +DSLY+ +A +M+KS   E++D +D  EG+    + +EQ      +  EQ  L+ RGAA M L+ +    G    +V ++++LGI LL GGN  +Q  ++ +L+ KK + FF S++GLM +CSVL+L+ FER  KAEGL  G         NL DA+FTC LFRFLQL CEGHNL FQ+YLR+Q G+TT+VN+I CTVDYLLRLQES+MDFYWHY+ K+ ID  GK   ++AI++  Q+F TLTE IQGPCVGNQ+ LA+SRLWDAI+GF F+FAHM +KL K+  QLELLREF+ LQK+M++++LSMLEGNV+NG IGKQMVD LVES  +VE ILKF D+FL++KD+T+S+AF  FD N+DGWIS KEF+ AME QKMY  E+I Y+MMC D NNDGKVD+ EFT+RFH+PA+DIGFN+AVLL NL EH+ ND RLE+++ KA+ ++E F+P+LGRIEI G S R+E++YFEI++S ++QW K QI+DSK SFL +V+ ++GGD+ KLE+F+NFCEDTI+EMQH+  IS
Sbjct: 1551 VDEYYYGIRIFPGQDPSQVWVGWVTTQYHYY---------NVNFDGSQGVRKCRFSEADHHGTTVDSVQSQN--------C-----------------YMVNVSELL---ATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPTATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSES----------------------RYPQITGESVSMLSQMASEPVKKHVSREDEMKLLP-----PSVDFEALKKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDEN--YETGTTQKGLTQLELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQM-----FRLLMCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIG-NVKEGDSDDQL------------------ALIESEEGSWVDSFARIVVKV--PPPVLEEGMEMQKKG---TQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILT------------------------------------AQQGTVEHEGDELKE--KAPIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLSRCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKG---------------EGQGLFSAFKEAIALSEDIRLLEND------SHPSLLSS---------GLL----------------------------GENP---TYPSKDAEGED---------------------YIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAILRSLISLDDLGQILALRFTIPNLAAPSIEDT-------------GPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH--YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGA------------------------------------WIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYH---------------------VNCPKDE------QSQNDRLKSEGE--RTSVE-KRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNS---DIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAK-SQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEE------HMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKK------KRREGQIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKF------------------IQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDE-MSQDAVIEKIFNMGQVSAILHTTEHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIME---------EGVPIVASSEDTKEKE-------TNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQ---ALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAIS 4366          

HSP 2 Score: 1280 bits (3311), Expect = 0.000e+0
Identity = 662/1372 (48.25%), Postives = 927/1372 (67.57%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSV------GHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVME-EQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENV-VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVE--NNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDID--KENSKVEVQL--HTG-SVPTLKLISKIF-----GVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILE-QMPSYPGTLNRNLTK 4177
            +E+ +++   D VCLS V      G   S+R CL   GFG+R C LEN+S ++ PPD+++C+  +D ALS+RALQE+++   D  +  G  GHKTLLYGHAV LKH  S M+L+CLS+ SS DKLAFDVG+QE    EACWWT+HPA+KQRSEGEKVR+GDD+ILVSV++ERYLH+    G      VIASF QTLW +  VSSG++R +++G +FG DVLRLFHG DECLT+P +  EH PQH  V+YE GA  + ARSLWR+ELI+ KW G  + W    R++H+TSGRYL V    N V   H+ +A    TAF + Q+KD KK   +E EE+ MG+A I++GET  F+QHV +  WLSY+  EV K+G+GKVEEK+AV L +GHMDD +T     +EESKSA  IR+C+SV  +F++ +D   +E  Q +  ++++L+EV++ +EDLI++F +PN +++ E KQ  L ALR+RQDLFQEEG++N++L TIDKF+   +   DF   +GE+    ++Q+S YLYLL+AAMI+GN  NCAQFA   R+DW+F RL +PQSAEG+LDVL+CVLT+S EALN+I + HIR +I LL+K GRDP+VL VL SLC G  G AVR +Q LI   LLP +DLLLQT + D  SS+ PN+ +GV E SA ++KWY+E  ++ IE +T     LR+GW+N+ GF PFPG     G   VGDD +S+GFDG++++ GGK +R    V   +L  GD+IGC +DLT+P I+F++N   + G F+ FNIDG F+P +S SAKVS R I GG  GRLRYGPP G+SA+ EA+     L++  C SFG+L K+I++G      N+  FIP P++ +  QL ++   +  K AEN+HE+WAM+KI+ GW+YG+ R + ++ HPCLT FE LP  E+++++ LA  T++TI ALGY +  E P    RL+ ++L  +F Q NGY+P PLD   I L + L+ L   LA NTHNIWA ++IK+GW++G  E  +   KRSPHLVPYE+VD+ IK++NR+++ E ++ L  +   +E P  +  E+A      +  RK ++  RT+RA++T+ V  GKWY+E E+LT G+M+ GW+ +      ++G++ +SYAFD     KW+  +  YGK  + GDV+GC LDL D+TI+FSLNGEL++DP G E+AF N+ C  G VP  + G GQ  +LNFG   ++LK+FT CGLQEGY PFCVNM R +P+W++++ P  F DI   K  S +EV     TG S P LK++ K+        +K++ME+++L LP+KC D F       ++   E +RRQL   + P +Q ++ + + P  P   + N  K
Sbjct:   10 DEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVATERYLHMAYSKGYM----VIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPENWSEH-PQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGV--LDNSVQLYHKEKADFDLTAFVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQDLFQEEGVLNMILDTIDKFS-QMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEG-NGMAVRSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSYGFDGKSMYFGGKSRR----VGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQGRLRYGPPTGFSAVVEAV--NGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPP--CRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFGIFLEPPAHEHDEVAEK---ELRARKDNT--RTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLP-RFEDISTLKSGSILEVSRIPATGNSPPCLKILQKVTISEGGPSEKAKMEYIKLSLPVKCNDTFV------KNKDKETIRRQLQEYK-PRSQSVVSQIRAPGIPKEFDDNKEK 1351          

HSP 3 Score: 440.654 bits (1132), Expect = 7.596e-123
Identity = 238/472 (50.42%), Postives = 323/472 (68.43%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDD--MEEFIILNDSVAYMG------LLFKIL---AGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTD-----DNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIAWDIQYLIWKW-GVIFTDNAFLYLGLYFVTSLIGNF-NYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK--DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            I+++ A+N    +   L LAFFIN +LLF+ V+   + + E  +  D D+  +E   I      Y+       +L +IL   + LH S + ++L+++Y LK+PL+ FKREKEI+R L F+G WITE+ ++     D    + D++V+S  SFP  YWDKFV++K R+K+ +Q D   + ++LG  + S  S           ++D +Y  W W GVI T+  FLY   Y + S  G F + FF+A HL+DV +SF  L+ ILQSVTHN +QL+LT+M+T V++YLYTVIAFNFFRKFY+++ +  +  D KCHNMLTCF++H + G+RAGGGIGDE+ESP GD  E  R+ +DI+FFFFVI+ILLAI+QGLIIDAFGELRDQ E   E +ES CFIC IGKE FD++P GFE H  KEHNFANY++FL H++NK +TEYTGQETYV E Y  R WDFFPVG+CF KQYE++L
Sbjct: 4607 ILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGEEKMSTDS-----------SYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQL 5067          

HSP 4 Score: 93.2041 bits (230), Expect = 7.834e-18
Identity = 56/200 (28.00%), Postives = 97/200 (48.50%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVH--------QMLVPFEILTDKEKSRYRKLTNELLKYLQYNG 9652
            F P P+D S  +L +    +  ++A++LH+ WA+  +E G+ YG TR++ ++ HP L  F+ L + ++   I   +  +K + A G+ +  +     +   R  P     +GY P P D   + +  E+  + E LA N HNIWA+ K     + G   H          LVP+E + ++ K   R+   E ++ LQ  G
Sbjct:  851 FIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFG 1050          

HSP 5 Score: 85.1149 bits (209), Expect = 1.913e-15
Identity = 56/221 (25.34%), Postives = 104/221 (47.06%), Query Frame = 2
Query: 2642 NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSE 3304
            N   +E   +IPR V+ +  ++   +E + +  AE+ H+ WA +K+++GW +G      N THP L  F  L   E+ F      E L+ ++A  Y+          R    +  +    SN + P+P+DL +++L   +     ++AE++H IWA   +    + G          P LVP++ + D  ++ +R  + E +K L  + Y +  P  + S+
Sbjct: 2826 NKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKG-----GFMPIP-LVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQ 3039          

HSP 6 Score: 57.3806 bits (137), Expect = 4.440e-7
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 2870 RQFDVTLAYETLRTIVALGYTI--NYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMA 3310
            R +D  L  + L  + A+G  I  +Y + S    ++  +      +   + P+ +D+    ++  LE +    AE+ H+ WA  ++++GW +G + + A    P L P+  + D  K   ++   E +K L+A+NYS E    D ++ A
Sbjct: 2790 RPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRRE----EEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRA 2934          
BLAST of Ryanodine receptor related vs. Ensembl Celegans
Match: unc-68 (pep chromosome:WBcel235:V:6901697:6929038:-1 gene:WBGene00006801.1 transcript:K11C4.5h.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-68)

HSP 1 Score: 2207.56 bits (5719), Expect = 0.000e+0
Identity = 1285/3167 (40.57%), Postives = 1851/3167 (58.45%), Query Frame = 2
Query: 4502 MDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFD----TRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRA-TPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQT-ESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKD--------DISCC--AEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILP---APQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESV-VPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWT---IDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-----AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLT-MERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLE-EEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS------DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVV-NEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            +D+YY+ + + PGQD  Q+++GWVT+ +            N +FD     R  +      H T  DS +S +        C                 Y++NV+++L       D+      G  IGC +D + G L+F++ S +  I F++ P   L+PA FV PTA E   FELGR + T P+ A M +   ++  P    RL ++ ++  +W+RV N   +   LKL+EVRGWS+L  + V++M+V+IPE+D+ LDILE+ E P +L FH +TL LY  +  +GNH VA +L  H+DE+Q  Y I++HYL G +R  F DLLI +HL SH+  +     E V+PL   LQ   V +   +                       + P  T ES S+   + S+ V   +  E+   + P     P +++E LK   ++ L +A +       + IGG   N F PL K+ D LL++G++   ++  +L ++    F            + +  + L E VK+QL  +L  LCDIQLR+RIE +V  +  FV  +Q+DQ +RY+EIKQ+D+P +  AK TKEFRCPP++QM     F        EE+D        D+  C  AE L++++  F   L+   G    EG   ++L                   +   EEG  +  F + ++ +    P+ E  + ++       +N  ++I   L  WA++ FIE+  LIR MF LL RQY+ + EI++++ +TYV   +++ DVT  L  L ++R LL VQ    EE +LK  LW +MNN++FFQHP+L R L+VHE VM +M++ LT                                    A Q ++    +E  E  K      +EMVV C RFLCYFCRTS QNQK MFEHLS++L+N++MLLARPSLRG+ PLDVAYSS MDNNELALA++E++L+KVAVYLSR G+Q N EL++KGYPDIGWDPVEGER++DFLRF VW+NGE +EENANLV+RLLIRRPECLG AL+G               E   +FSA       +E+I            SHP++ ++         GLL                             ENP   T P   A+ ED                     Y+DLGAA L FYS LVDLL +CAP+       K  SLR RAIL+SL+S++DL  +L+LRF +P   AP +E T             G  PGLLP HK SV+LFL+RVYGI   +    +LE +FL D+RAAT++D   + +SD ALALNRYL NSVLPLLT HSH+  + E  +++L+ TLHT YR++R +SLTK QR+ VSDFLVA+T++L P M+ KLL+K+I D+ ++   +V VPLRL+T  Y+RCG YY S      G+A+E+EK+L+  LF  IFD L   PYDPELF KALPC+TAIG A+SPDY+    L  ++        A                                    + P+ VD S   +   LE + + FA+H HDSWA   +EKG+V+G   +  N THP L  F LL   ++  Y E   E LKA++AW ++   +D D +           T I++ + P P DL  + + K+M++ AEK+AE++H IWA+    D+++ GG +   LVP+++LTD E+ + R   +E+LK+LQY+GY                      ++ P D       Q Q  +  + GE  +TS E  RFAY LL KL+ Y+EQA + ++ ++PS   +R   F +E +D+KFF KVVLPL+  YF AHKNYF+   S+     A N+EK+M A LFC+L +LLR K  A G    I+V+CLQGL QA+D+R +VK++S   D VR  LL FF NCADDL   +  L    ++S ++G   +   S  + + +++PVL +MF H+++ + G DLL+ D+Q ACYKIL++LY +   SS  + R+ I+ E  +HRP LG+C+AA A  FPVAFLE   NK+NK+S+L   + + S++ +E+L  L  ++P+L+ ++ ++  +A +   Y++ P+V +V LP++CSY+  W+S GP+   +   +       T+V+   IN +   +LK+IRN++   +APW+ R+      I+ N T + + E  LP+AE+L+  + +A KEEE         +      E  + +    LVR+ +AF+P+L+KY DLHR  W+K PT +TD ++  VA IF IWS+S HFKREE N+V Q E D  +    D  +   + A R        K+   +  K     S+ +AC+KRLLP+GL++FGGRE +++Q++K++                   IQKE +  I E++K  +++  + D      WQ  LY+KIGK++     E +S++ +I+++  + +V   L+  +HP   L  +WKK++S+QRKRAV+ACFRM+PL+ +PRHRG+N FL A+  +W+  E+    +LI ++    ++ E   I     E   +    +  + +E                T PDPL QLI   +R A  + +      +DSLY+ +A +M+KS   E++D +D  EG+    + +EQ      +  EQ  L+ RGAA M L+ +    G    +V ++++LGI LL GGN  +Q  ++ +L+ KK + FF S++GLM +CSVL+L+ FER  KAEGL  G         NL DA+FTC LFRFLQL CEGHNL FQ+YLR+Q G+TT+VN+I CTVDYLLRLQES+MDFYWHY+ K+ ID  GK   ++AI++  Q+F TLTE IQGPCVGNQ+ LA+SRLWDAI+GF F+FAHM +KL K+  QLELLREF+ LQK+M++++LSMLEGNV+NG IGKQMVD LVES  +VE ILKF D+FL++KD+T+S+AF  FD N+DGWIS KEF+ AME QKMY  E+I Y+MMC D NNDGKVD+ EFT+RFH+PA+DIGFN+AVLL NL EH+ ND RLE+++ KA+ ++E F+P+LGRIEI G S R+E++YFEI++S ++QW K QI+DSK SFL +V+ ++GGD+ KLE+F+NFCEDTI+EMQH+  IS
Sbjct: 1553 VDEYYYGIRIFPGQDPSQVWVGWVTTQYHYY---------NVNFDGSQGVRKCRFSEADHHGTTVDSVQSQN--------C-----------------YMVNVSELL---ATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPTATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSES----------------------RYPQITGESVSMLSQMASEPVKKHVSREDEMKLLP-----PSVDFEALKKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDEN--YETGTTQKGLTQLELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQM-----FRLLMCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIG-NVKEGDSDDQL------------------ALIESEEGSWVDSFARIVVKV--PPPVLEEGMEMQKKG---TQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILT------------------------------------AQQGTVEHEGDELKE--KAPIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLSRCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKG---------------EGQGLFSAFKEAIALSEDIRLLEND------SHPSLLSS---------GLL----------------------------GENP---TYPSKDAEGED---------------------YIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAILRSLISLDDLGQILALRFTIPNLAAPSIEDT-------------GPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH--YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGA------------------------------------WIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYH---------------------VNCPKDE------QSQNDRLKSEGE--RTSVE-KRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNS---DIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAK-SQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEE------HMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKK------KRREGQIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKF------------------IQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDE-MSQDAVIEKIFNMGQVSAILHTTEHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEDTKEKE----------------TNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQ---ALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAIS 4368          

HSP 2 Score: 1290.02 bits (3337), Expect = 0.000e+0
Identity = 666/1373 (48.51%), Postives = 931/1373 (67.81%), Query Frame = 2
Query:  125 DEEEISFLRTDDHVCLSSV------GHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVME-EQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENV-VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVE--NNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDID--KENSKVEVQL--HTG-SVPTLKLISKIF-----GVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILE-QMPSYPGTLNRNLTK 4177
            +++++SFLRT D VCLS V      G   S+R CL   GFG+R C LEN+S ++ PPD+++C+  +D ALS+RALQE+++   D  +  G  GHKTLLYGHAV LKH  S M+L+CLS+ SS DKLAFDVG+QE    EACWWT+HPA+KQRSEGEKVR+GDD+ILVSV++ERYLH+    G      VIASF QTLW +  VSSG++R +++G +FG DVLRLFHG DECLT+P +  EH PQH  V+YE GA  + ARSLWR+ELI+ KW G  + W    R++H+TSGRYL V    N V   H+ +A    TAF + Q+KD KK   +E EE+ MG+A I++GET  F+QHV +  WLSY+  EV K+G+GKVEEK+AV L +GHMDD +T     +EESKSA  IR+C+SV  +F++ +D   +E  Q +  ++++L+EV++ +EDLI++F +PN +++ E KQ  L ALR+RQDLFQEEG++N++L TIDKF+   +   DF   +GE+    ++Q+S YLYLL+AAMI+GN  NCAQFA   R+DW+F RL +PQSAEG+LDVL+CVLT+S EALN+I + HIR +I LL+K GRDP+VL VL SLC G  G AVR +Q LI   LLP +DLLLQT + D  SS+ PN+ +GV E SA ++KWY+E  ++ IE +T     LR+GW+N+ GF PFPG     G   VGDD +S+GFDG++++ GGK +R    V   +L  GD+IGC +DLT+P I+F++N   + G F+ FNIDG F+P +S SAKVS R I GG  GRLRYGPP G+SA+ EA+     L++  C SFG+L K+I++G      N+  FIP P++ +  QL ++   +  K AEN+HE+WAM+KI+ GW+YG+ R + ++ HPCLT FE LP  E+++++ LA  T++TI ALGY +  E P    RL+ ++L  +F Q NGY+P PLD   I L + L+ L   LA NTHNIWA ++IK+GW++G  E  +   KRSPHLVPYE+VD+ IK++NR+++ E ++ L  +   +E P  +  E+A      +  RK ++  RT+RA++T+ V  GKWY+E E+LT G+M+ GW+ +      ++G++ +SYAFD     KW+  +  YGK  + GDV+GC LDL D+TI+FSLNGEL++DP G E+AF N+ C  G VP  + G GQ  +LNFG   ++LK+FT CGLQEGY PFCVNM R +P+W++++ P  F DI   K  S +EV     TG S P LK++ K+        +K++ME+++L LP+KC D F       ++   E +RRQL   + P +Q ++ + + P  P   + N  K
Sbjct:   11 EQDDVSFLRTGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVATERYLHMAYSKGYM----VIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPENWSEH-PQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGV--LDNSVQLYHKEKADFDLTAFVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQDLFQEEGVLNMILDTIDKFS-QMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEG-NGMAVRSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSYGFDGKSMYFGGKSRR----VGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQGRLRYGPPTGFSAVVEAV--NGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPP--CRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFGIFLEPPAHEHDEVAEK---ELRARKDNT--RTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLP-RFEDISTLKSGSILEVSRIPATGNSPPCLKILQKVTISEGGPSEKAKMEYIKLSLPVKCNDTFV------KNKDKETIRRQLQEYK-PRSQSVVSQIRAPGIPKEFDDNKEK 1353          

HSP 3 Score: 440.654 bits (1132), Expect = 7.165e-123
Identity = 238/472 (50.42%), Postives = 323/472 (68.43%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDD--MEEFIILNDSVAYMG------LLFKIL---AGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTD-----DNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIAWDIQYLIWKW-GVIFTDNAFLYLGLYFVTSLIGNF-NYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK--DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            I+++ A+N    +   L LAFFIN +LLF+ V+   + + E  +  D D+  +E   I      Y+       +L +IL   + LH S + ++L+++Y LK+PL+ FKREKEI+R L F+G WITE+ ++     D    + D++V+S  SFP  YWDKFV++K R+K+ +Q D   + ++LG  + S  S           ++D +Y  W W GVI T+  FLY   Y + S  G F + FF+A HL+DV +SF  L+ ILQSVTHN +QL+LT+M+T V++YLYTVIAFNFFRKFY+++ +  +  D KCHNMLTCF++H + G+RAGGGIGDE+ESP GD  E  R+ +DI+FFFFVI+ILLAI+QGLIIDAFGELRDQ E   E +ES CFIC IGKE FD++P GFE H  KEHNFANY++FL H++NK +TEYTGQETYV E Y  R WDFFPVG+CF KQYE++L
Sbjct: 4609 ILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGEEKMSTDS-----------SYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQL 5069          

HSP 4 Score: 92.8189 bits (229), Expect = 8.590e-18
Identity = 56/200 (28.00%), Postives = 97/200 (48.50%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVH--------QMLVPFEILTDKEKSRYRKLTNELLKYLQYNG 9652
            F P P+D S  +L +    +  ++A++LH+ WA+  +E G+ YG TR++ ++ HP L  F+ L + ++   I   +  +K + A G+ +  +     +   R  P     +GY P P D   + +  E+  + E LA N HNIWA+ K     + G   H          LVP+E + ++ K   R+   E ++ LQ  G
Sbjct:  853 FIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFG 1052          

HSP 5 Score: 85.1149 bits (209), Expect = 2.046e-15
Identity = 56/221 (25.34%), Postives = 104/221 (47.06%), Query Frame = 2
Query: 2642 NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSE 3304
            N   +E   +IPR V+ +  ++   +E + +  AE+ H+ WA +K+++GW +G      N THP L  F  L   E+ F      E L+ ++A  Y+          R    +  +    SN + P+P+DL +++L   +     ++AE++H IWA   +    + G          P LVP++ + D  ++ +R  + E +K L  + Y +  P  + S+
Sbjct: 2828 NKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKG-----GFMPIP-LVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQ 3041          

HSP 6 Score: 57.3806 bits (137), Expect = 4.669e-7
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 2870 RQFDVTLAYETLRTIVALGYTI--NYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMA 3310
            R +D  L  + L  + A+G  I  +Y + S    ++  +      +   + P+ +D+    ++  LE +    AE+ H+ WA  ++++GW +G + + A    P L P+  + D  K   ++   E +K L+A+NYS E    D ++ A
Sbjct: 2792 RPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRRE----EEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRA 2936          
BLAST of Ryanodine receptor related vs. Ensembl Celegans
Match: unc-68 (pep chromosome:WBcel235:V:6901697:6924961:-1 gene:WBGene00006801.1 transcript:K11C4.5n.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-68)

HSP 1 Score: 2206.02 bits (5715), Expect = 0.000e+0
Identity = 1289/3177 (40.57%), Postives = 1857/3177 (58.45%), Query Frame = 2
Query: 4502 MDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFD----TRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRA-TPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQT-ESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKD--------DISCC--AEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILP---APQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESV-VPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWT---IDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-----AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLT-MERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSA----NNDSIGKKF------LARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLE-EEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS------DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVV-NEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            +D+YY+ + + PGQD  Q+++GWVT+ +            N +FD     R  +      H T  DS +S +        C                 Y++NV+++L       D+      G  IGC +D + G L+F++ S +  I F++ P   L+PA FV PTA E   FELGR + T P+ A M +   ++  P    RL ++ ++  +W+RV N   +   LKL+EVRGWS+L  + V++M+V+IPE+D+ LDILE+ E P +L FH +TL LY  +  +GNH VA +L  H+DE+Q  Y I++HYL G +R  F DLLI +HL SH+  +     E V+PL   LQ   V +   +                       + P  T ES S+   + S+ V   +  E+   + P     P +++E LK   ++ L +A +       + IGG   N F PL K+ D LL++G++   ++  +L ++    F            + +  + L E VK+QL  +L  LCDIQLR+RIE +V  +  FV  +Q+DQ +RY+EIKQ+D+P +  AK TKEFRCPP++QM     F        EE+D        D+  C  AE L++++  F   L+   G    EG   ++L                   +   EEG  +  F + ++ +    P+ E  + ++       +N  ++I   L  WA++ FIE+  LIR MF LL RQY+ + EI++++ +TYV   +++ DVT  L  L ++R LL VQ    EE +LK  LW +MNN++FFQHP+L R L+VHE VM +M++ LT                                    A Q ++    +E  E  K      +EMVV C RFLCYFCRTS QNQK MFEHLS++L+N++MLLARPSLRG+ PLDVAYSS MDNNELALA++E++L+KVAVYLSR G+Q N EL++KGYPDIGWDPVEGER++DFLRF VW+NGE +EENANLV+RLLIRRPECLG AL+G               E   +FSA       +E+I            SHP++ ++         GLL                             ENP   T P   A+ ED                     Y+DLGAA L FYS LVDLL +CAP+       K  SLR RAIL+SL+S++DL  +L+LRF +P   AP +E T             G  PGLLP HK SV+LFL+RVYGI   +    +LE +FL D+RAAT++D   + +SD ALALNRYL NSVLPLLT HSH+  + E  +++L+ TLHT YR++R +SLTK QR+ VSDFLVA+T++L P M+ KLL+K+I D+ ++   +V VPLRL+T  Y+RCG YY S      G+A+E+EK+L+  LF  IFD L   PYDPELF KALPC+TAIG A+SPDY+    L  ++        A                                    + P+ VD S   +   LE + + FA+H HDSWA   +EKG+V+G   +  N THP L  F LL   ++  Y E   E LKA++AW ++   +D D +           T I++ + P P DL  + + K+M++ AEK+AE++H IWA+    D+++ GG +   LVP+++LTD E+ + R   +E+LK+LQY+GY                      ++ P D       Q Q  +  + GE  +TS E  RFAY LL KL+ Y+EQA + ++ ++PS   +R   F +E +D+KFF KVVLPL+  YF AHKNYF+   S+     A N+EK+M A LFC+L +LLR K  A G    I+V+CLQGL QA+D+R +VK++S   D VR  LL FF NCADDL   +  L    ++S ++G   +   S  + + +++PVL +MF H+++ + G DLL+ D+Q ACYKIL++LY +   SS  + R+ I+ E  +HRP LG+C+AA A  FPVAFLE   NK+NK+S+L   + + S++ +E+L  L  ++P+L+ ++ ++  +A +   Y++ P+V +V LP++CSY+  W+S GP+   +   +       T+V+   IN +   +LK+IRN++   +APW+ R+      I+ N T + + E  LP+AE+L+  + +A KEEE         +      E  + +    LVR+ +AF+P+L+KY DLHR  W+K PT +TD ++  VA IF IWS+S HFKREE N+V Q E D  +    D  +   + A R        D + + F      + +K K ++  S+ +AC+KRLLP+GL++FGGRE +++Q++K++                   IQKE +  I E++K  +++  + D      WQ  LY+KIGK++     E +S++ +I+++  + +V   L+  +HP   L  +WKK++S+QRKRAV+ACFRM+PL+ +PRHRG+N FL A+  +W+  E+    +LI ++    ++ E   I              +G     +SE   E         T PDPL QLI   +R A  + +      +DSLY+ +A +M+KS   E++D +D  EG+    + +EQ      +  EQ  L+ RGAA M L+ +    G    +V ++++LGI LL GGN  +Q  ++ +L+ KK + FF S++GLM +CSVL+L+ FER  KAEGL  G         NL DA+FTC LFRFLQL CEGHNL FQ+YLR+Q G+TT+VN+I CTVDYLLRLQES+MDFYWHY+ K+ ID  GK   ++AI++  Q+F TLTE IQGPCVGNQ+ LA+SRLWDAI+GF F+FAHM +KL K+  QLELLREF+ LQK+M++++LSMLEGNV+NG IGKQMVD LVES  +VE ILKF D+FL++KD+T+S+AF  FD N+DGWIS KEF+ AME QKMY  E+I Y+MMC D NNDGKVD+ EFT+RFH+PA+DIGFN+AVLL NL EH+ ND RLE+++ KA+ ++E F+P+LGRIEI G S R+E++YFEI++S ++QW K QI+DSK SFL +V+ ++GGD+ KLE+F+NFCEDTI+EMQH+  IS
Sbjct: 1551 VDEYYYGIRIFPGQDPSQVWVGWVTTQYHYY---------NVNFDGSQGVRKCRFSEADHHGTTVDSVQSQN--------C-----------------YMVNVSELL---ATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPTATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSES----------------------RYPQITGESVSMLSQMASEPVKKHVSREDEMKLLP-----PSVDFEALKKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDEN--YETGTTQKGLTQLELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQM-----FRLLMCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIG-NVKEGDSDDQL------------------ALIESEEGSWVDSFARIVVKV--PPPVLEEGMEMQKKG---TQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILT------------------------------------AQQGTVEHEGDELKE--KAPIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLSRCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKG---------------EGQGLFSAFKEAIALSEDIRLLEND------SHPSLLSS---------GLL----------------------------GENP---TYPSKDAEGED---------------------YIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAILRSLISLDDLGQILALRFTIPNLAAPSIEDT-------------GPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH--YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGA------------------------------------WIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYH---------------------VNCPKDE------QSQNDRLKSEGE--RTSVE-KRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNS---DIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAK-SQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEE------HMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKKKRREGQDKMKEYFDRNGRPIIKKDKHAA--SIVIACLKRLLPVGLNVFGGRELDIVQQSKEKF------------------IQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDE-MSQDAVIEKIFNMGQVSAILHTTEHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIME---------EGVPIVASSEDTKEKE-------TNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQ---ALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAIS 4380          

HSP 2 Score: 1280 bits (3311), Expect = 0.000e+0
Identity = 662/1372 (48.25%), Postives = 927/1372 (67.57%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSV------GHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVME-EQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENV-VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVE--NNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDID--KENSKVEVQL--HTG-SVPTLKLISKIF-----GVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILE-QMPSYPGTLNRNLTK 4177
            +E+ +++   D VCLS V      G   S+R CL   GFG+R C LEN+S ++ PPD+++C+  +D ALS+RALQE+++   D  +  G  GHKTLLYGHAV LKH  S M+L+CLS+ SS DKLAFDVG+QE    EACWWT+HPA+KQRSEGEKVR+GDD+ILVSV++ERYLH+    G      VIASF QTLW +  VSSG++R +++G +FG DVLRLFHG DECLT+P +  EH PQH  V+YE GA  + ARSLWR+ELI+ KW G  + W    R++H+TSGRYL V    N V   H+ +A    TAF + Q+KD KK   +E EE+ MG+A I++GET  F+QHV +  WLSY+  EV K+G+GKVEEK+AV L +GHMDD +T     +EESKSA  IR+C+SV  +F++ +D   +E  Q +  ++++L+EV++ +EDLI++F +PN +++ E KQ  L ALR+RQDLFQEEG++N++L TIDKF+   +   DF   +GE+    ++Q+S YLYLL+AAMI+GN  NCAQFA   R+DW+F RL +PQSAEG+LDVL+CVLT+S EALN+I + HIR +I LL+K GRDP+VL VL SLC G  G AVR +Q LI   LLP +DLLLQT + D  SS+ PN+ +GV E SA ++KWY+E  ++ IE +T     LR+GW+N+ GF PFPG     G   VGDD +S+GFDG++++ GGK +R    V   +L  GD+IGC +DLT+P I+F++N   + G F+ FNIDG F+P +S SAKVS R I GG  GRLRYGPP G+SA+ EA+     L++  C SFG+L K+I++G      N+  FIP P++ +  QL ++   +  K AEN+HE+WAM+KI+ GW+YG+ R + ++ HPCLT FE LP  E+++++ LA  T++TI ALGY +  E P    RL+ ++L  +F Q NGY+P PLD   I L + L+ L   LA NTHNIWA ++IK+GW++G  E  +   KRSPHLVPYE+VD+ IK++NR+++ E ++ L  +   +E P  +  E+A      +  RK ++  RT+RA++T+ V  GKWY+E E+LT G+M+ GW+ +      ++G++ +SYAFD     KW+  +  YGK  + GDV+GC LDL D+TI+FSLNGEL++DP G E+AF N+ C  G VP  + G GQ  +LNFG   ++LK+FT CGLQEGY PFCVNM R +P+W++++ P  F DI   K  S +EV     TG S P LK++ K+        +K++ME+++L LP+KC D F       ++   E +RRQL   + P +Q ++ + + P  P   + N  K
Sbjct:   10 DEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVATERYLHMAYSKGYM----VIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPENWSEH-PQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGV--LDNSVQLYHKEKADFDLTAFVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQDLFQEEGVLNMILDTIDKFS-QMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEG-NGMAVRSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSYGFDGKSMYFGGKSRR----VGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQGRLRYGPPTGFSAVVEAV--NGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPP--CRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFGIFLEPPAHEHDEVAEK---ELRARKDNT--RTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLP-RFEDISTLKSGSILEVSRIPATGNSPPCLKILQKVTISEGGPSEKAKMEYIKLSLPVKCNDTFV------KNKDKETIRRQLQEYK-PRSQSVVSQIRAPGIPKEFDDNKEK 1351          

HSP 3 Score: 440.654 bits (1132), Expect = 7.937e-123
Identity = 238/472 (50.42%), Postives = 323/472 (68.43%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDD--MEEFIILNDSVAYMG------LLFKIL---AGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTD-----DNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIAWDIQYLIWKW-GVIFTDNAFLYLGLYFVTSLIGNF-NYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK--DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            I+++ A+N    +   L LAFFIN +LLF+ V+   + + E  +  D D+  +E   I      Y+       +L +IL   + LH S + ++L+++Y LK+PL+ FKREKEI+R L F+G WITE+ ++     D    + D++V+S  SFP  YWDKFV++K R+K+ +Q D   + ++LG  + S  S           ++D +Y  W W GVI T+  FLY   Y + S  G F + FF+A HL+DV +SF  L+ ILQSVTHN +QL+LT+M+T V++YLYTVIAFNFFRKFY+++ +  +  D KCHNMLTCF++H + G+RAGGGIGDE+ESP GD  E  R+ +DI+FFFFVI+ILLAI+QGLIIDAFGELRDQ E   E +ES CFIC IGKE FD++P GFE H  KEHNFANY++FL H++NK +TEYTGQETYV E Y  R WDFFPVG+CF KQYE++L
Sbjct: 4621 ILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGEEKMSTDS-----------SYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQL 5081          

HSP 4 Score: 92.8189 bits (229), Expect = 8.240e-18
Identity = 56/200 (28.00%), Postives = 97/200 (48.50%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVH--------QMLVPFEILTDKEKSRYRKLTNELLKYLQYNG 9652
            F P P+D S  +L +    +  ++A++LH+ WA+  +E G+ YG TR++ ++ HP L  F+ L + ++   I   +  +K + A G+ +  +     +   R  P     +GY P P D   + +  E+  + E LA N HNIWA+ K     + G   H          LVP+E + ++ K   R+   E ++ LQ  G
Sbjct:  851 FIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFG 1050          

HSP 5 Score: 85.1149 bits (209), Expect = 2.029e-15
Identity = 56/221 (25.34%), Postives = 104/221 (47.06%), Query Frame = 2
Query: 2642 NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSE 3304
            N   +E   +IPR V+ +  ++   +E + +  AE+ H+ WA +K+++GW +G      N THP L  F  L   E+ F      E L+ ++A  Y+          R    +  +    SN + P+P+DL +++L   +     ++AE++H IWA   +    + G          P LVP++ + D  ++ +R  + E +K L  + Y +  P  + S+
Sbjct: 2826 NKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKG-----GFMPIP-LVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQ 3039          

HSP 6 Score: 57.3806 bits (137), Expect = 4.478e-7
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 2870 RQFDVTLAYETLRTIVALGYTI--NYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMA 3310
            R +D  L  + L  + A+G  I  +Y + S    ++  +      +   + P+ +D+    ++  LE +    AE+ H+ WA  ++++GW +G + + A    P L P+  + D  K   ++   E +K L+A+NYS E    D ++ A
Sbjct: 2790 RPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRRE----EEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRA 2934          
BLAST of Ryanodine receptor related vs. Ensembl Celegans
Match: unc-68 (pep chromosome:WBcel235:V:6901697:6929038:-1 gene:WBGene00006801.1 transcript:K11C4.5f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-68)

HSP 1 Score: 2206.02 bits (5715), Expect = 0.000e+0
Identity = 1287/3177 (40.51%), Postives = 1857/3177 (58.45%), Query Frame = 2
Query: 4502 MDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFD----TRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRA-TPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQT-ESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKD--------DISCC--AEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILP---APQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESV-VPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWT---IDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-----AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLT-MERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSA----NNDSIGKKF------LARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLE-EEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS------DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVV-NEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            +D+YY+ + + PGQD  Q+++GWVT+ +            N +FD     R  +      H T  DS +S +        C                 Y++NV+++L       D+      G  IGC +D + G L+F++ S +  I F++ P   L+PA FV PTA E   FELGR + T P+ A M +   ++  P    RL ++ ++  +W+RV N   +   LKL+EVRGWS+L  + V++M+V+IPE+D+ LDILE+ E P +L FH +TL LY  +  +GNH VA +L  H+DE+Q  Y I++HYL G +R  F DLLI +HL SH+  +     E V+PL   LQ   V +   +                       + P  T ES S+   + S+ V   +  E+   + P     P +++E LK   ++ L +A +       + IGG   N F PL K+ D LL++G++   ++  +L ++    F            + +  + L E VK+QL  +L  LCDIQLR+RIE +V  +  FV  +Q+DQ +RY+EIKQ+D+P +  AK TKEFRCPP++QM     F        EE+D        D+  C  AE L++++  F   L+   G    EG   ++L                   +   EEG  +  F + ++ +    P+ E  + ++       +N  ++I   L  WA++ FIE+  LIR MF LL RQY+ + EI++++ +TYV   +++ DVT  L  L ++R LL VQ    EE +LK  LW +MNN++FFQHP+L R L+VHE VM +M++ LT                                    A Q ++    +E  E  K      +EMVV C RFLCYFCRTS QNQK MFEHLS++L+N++MLLARPSLRG+ PLDVAYSS MDNNELALA++E++L+KVAVYLSR G+Q N EL++KGYPDIGWDPVEGER++DFLRF VW+NGE +EENANLV+RLLIRRPECLG AL+G               E   +FSA       +E+I            SHP++ ++         GLL                             ENP   T P   A+ ED                     Y+DLGAA L FYS LVDLL +CAP+       K  SLR RAIL+SL+S++DL  +L+LRF +P   AP +E T             G  PGLLP HK SV+LFL+RVYGI   +    +LE +FL D+RAAT++D   + +SD ALALNRYL NSVLPLLT HSH+  + E  +++L+ TLHT YR++R +SLTK QR+ VSDFLVA+T++L P M+ KLL+K+I D+ ++   +V VPLRL+T  Y+RCG YY S      G+A+E+EK+L+  LF  IFD L   PYDPELF KALPC+TAIG A+SPDY+    L  ++        A                                    + P+ VD S   +   LE + + FA+H HDSWA   +EKG+V+G   +  N THP L  F LL   ++  Y E   E LKA++AW ++   +D D +           T I++ + P P DL  + + K+M++ AEK+AE++H IWA+    D+++ GG +   LVP+++LTD E+ + R   +E+LK+LQY+GY                      ++ P D       Q Q  +  + GE  +TS E  RFAY LL KL+ Y+EQA + ++ ++PS   +R   F +E +D+KFF KVVLPL+  YF AHKNYF+   S+     A N+EK+M A LFC+L +LLR K  A G    I+V+CLQGL QA+D+R +VK++S   D VR  LL FF NCADDL   +  L    ++S ++G   +   S  + + +++PVL +MF H+++ + G DLL+ D+Q ACYKIL++LY +   SS  + R+ I+ E  +HRP LG+C+AA A  FPVAFLE   NK+NK+S+L   + + S++ +E+L  L  ++P+L+ ++ ++  +A +   Y++ P+V +V LP++CSY+  W+S GP+   +   +       T+V+   IN +   +LK+IRN++   +APW+ R+      I+ N T + + E  LP+AE+L+  + +A KEEE         +      E  + +    LVR+ +AF+P+L+KY DLHR  W+K PT +TD ++  VA IF IWS+S HFKREE N+V Q E D  +    D  +   + A R        D + + F      + +K K ++  S+ +AC+KRLLP+GL++FGGRE +++Q++K++                   IQKE +  I E++K  +++  + D      WQ  LY+KIGK++     E +S++ +I+++  + +V   L+  +HP   L  +WKK++S+QRKRAV+ACFRM+PL+ +PRHRG+N FL A+  +W+  E+    +LI ++    ++ E   I     E   +    +  + +E                T PDPL QLI   +R A  + +      +DSLY+ +A +M+KS   E++D +D  EG+    + +EQ      +  EQ  L+ RGAA M L+ +    G    +V ++++LGI LL GGN  +Q  ++ +L+ KK + FF S++GLM +CSVL+L+ FER  KAEGL  G         NL DA+FTC LFRFLQL CEGHNL FQ+YLR+Q G+TT+VN+I CTVDYLLRLQES+MDFYWHY+ K+ ID  GK   ++AI++  Q+F TLTE IQGPCVGNQ+ LA+SRLWDAI+GF F+FAHM +KL K+  QLELLREF+ LQK+M++++LSMLEGNV+NG IGKQMVD LVES  +VE ILKF D+FL++KD+T+S+AF  FD N+DGWIS KEF+ AME QKMY  E+I Y+MMC D NNDGKVD+ EFT+RFH+PA+DIGFN+AVLL NL EH+ ND RLE+++ KA+ ++E F+P+LGRIEI G S R+E++YFEI++S ++QW K QI+DSK SFL +V+ ++GGD+ KLE+F+NFCEDTI+EMQH+  IS
Sbjct: 1553 VDEYYYGIRIFPGQDPSQVWVGWVTTQYHYY---------NVNFDGSQGVRKCRFSEADHHGTTVDSVQSQN--------C-----------------YMVNVSELL---ATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPTATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSES----------------------RYPQITGESVSMLSQMASEPVKKHVSREDEMKLLP-----PSVDFEALKKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDEN--YETGTTQKGLTQLELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQM-----FRLLMCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIG-NVKEGDSDDQL------------------ALIESEEGSWVDSFARIVVKV--PPPVLEEGMEMQKKG---TQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILT------------------------------------AQQGTVEHEGDELKE--KAPIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLSRCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKG---------------EGQGLFSAFKEAIALSEDIRLLEND------SHPSLLSS---------GLL----------------------------GENP---TYPSKDAEGED---------------------YIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAILRSLISLDDLGQILALRFTIPNLAAPSIEDT-------------GPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH--YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGA------------------------------------WIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYH---------------------VNCPKDE------QSQNDRLKSEGE--RTSVE-KRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNS---DIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAK-SQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEE------HMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKKKRREGQDKMKEYFDRNGRPIIKKDKHAA--SIVIACLKRLLPVGLNVFGGRELDIVQQSKEKF------------------IQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDE-MSQDAVIEKIFNMGQVSAILHTTEHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEDTKEKE----------------TNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQ---ALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAIS 4382          

HSP 2 Score: 1290.02 bits (3337), Expect = 0.000e+0
Identity = 666/1373 (48.51%), Postives = 931/1373 (67.81%), Query Frame = 2
Query:  125 DEEEISFLRTDDHVCLSSV------GHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVME-EQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENV-VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVE--NNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDID--KENSKVEVQL--HTG-SVPTLKLISKIF-----GVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILE-QMPSYPGTLNRNLTK 4177
            +++++SFLRT D VCLS V      G   S+R CL   GFG+R C LEN+S ++ PPD+++C+  +D ALS+RALQE+++   D  +  G  GHKTLLYGHAV LKH  S M+L+CLS+ SS DKLAFDVG+QE    EACWWT+HPA+KQRSEGEKVR+GDD+ILVSV++ERYLH+    G      VIASF QTLW +  VSSG++R +++G +FG DVLRLFHG DECLT+P +  EH PQH  V+YE GA  + ARSLWR+ELI+ KW G  + W    R++H+TSGRYL V    N V   H+ +A    TAF + Q+KD KK   +E EE+ MG+A I++GET  F+QHV +  WLSY+  EV K+G+GKVEEK+AV L +GHMDD +T     +EESKSA  IR+C+SV  +F++ +D   +E  Q +  ++++L+EV++ +EDLI++F +PN +++ E KQ  L ALR+RQDLFQEEG++N++L TIDKF+   +   DF   +GE+    ++Q+S YLYLL+AAMI+GN  NCAQFA   R+DW+F RL +PQSAEG+LDVL+CVLT+S EALN+I + HIR +I LL+K GRDP+VL VL SLC G  G AVR +Q LI   LLP +DLLLQT + D  SS+ PN+ +GV E SA ++KWY+E  ++ IE +T     LR+GW+N+ GF PFPG     G   VGDD +S+GFDG++++ GGK +R    V   +L  GD+IGC +DLT+P I+F++N   + G F+ FNIDG F+P +S SAKVS R I GG  GRLRYGPP G+SA+ EA+     L++  C SFG+L K+I++G      N+  FIP P++ +  QL ++   +  K AEN+HE+WAM+KI+ GW+YG+ R + ++ HPCLT FE LP  E+++++ LA  T++TI ALGY +  E P    RL+ ++L  +F Q NGY+P PLD   I L + L+ L   LA NTHNIWA ++IK+GW++G  E  +   KRSPHLVPYE+VD+ IK++NR+++ E ++ L  +   +E P  +  E+A      +  RK ++  RT+RA++T+ V  GKWY+E E+LT G+M+ GW+ +      ++G++ +SYAFD     KW+  +  YGK  + GDV+GC LDL D+TI+FSLNGEL++DP G E+AF N+ C  G VP  + G GQ  +LNFG   ++LK+FT CGLQEGY PFCVNM R +P+W++++ P  F DI   K  S +EV     TG S P LK++ K+        +K++ME+++L LP+KC D F       ++   E +RRQL   + P +Q ++ + + P  P   + N  K
Sbjct:   11 EQDDVSFLRTGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVATERYLHMAYSKGYM----VIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPENWSEH-PQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGV--LDNSVQLYHKEKADFDLTAFVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQDLFQEEGVLNMILDTIDKFS-QMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEG-NGMAVRSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSYGFDGKSMYFGGKSRR----VGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQGRLRYGPPTGFSAVVEAV--NGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPP--CRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFGIFLEPPAHEHDEVAEK---ELRARKDNT--RTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLP-RFEDISTLKSGSILEVSRIPATGNSPPCLKILQKVTISEGGPSEKAKMEYIKLSLPVKCNDTFV------KNKDKETIRRQLQEYK-PRSQSVVSQIRAPGIPKEFDDNKEK 1353          

HSP 3 Score: 440.654 bits (1132), Expect = 7.119e-123
Identity = 238/472 (50.42%), Postives = 323/472 (68.43%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDD--MEEFIILNDSVAYMG------LLFKIL---AGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTD-----DNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIAWDIQYLIWKW-GVIFTDNAFLYLGLYFVTSLIGNF-NYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK--DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            I+++ A+N    +   L LAFFIN +LLF+ V+   + + E  +  D D+  +E   I      Y+       +L +IL   + LH S + ++L+++Y LK+PL+ FKREKEI+R L F+G WITE+ ++     D    + D++V+S  SFP  YWDKFV++K R+K+ +Q D   + ++LG  + S  S           ++D +Y  W W GVI T+  FLY   Y + S  G F + FF+A HL+DV +SF  L+ ILQSVTHN +QL+LT+M+T V++YLYTVIAFNFFRKFY+++ +  +  D KCHNMLTCF++H + G+RAGGGIGDE+ESP GD  E  R+ +DI+FFFFVI+ILLAI+QGLIIDAFGELRDQ E   E +ES CFIC IGKE FD++P GFE H  KEHNFANY++FL H++NK +TEYTGQETYV E Y  R WDFFPVG+CF KQYE++L
Sbjct: 4623 ILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGEEKMSTDS-----------SYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQL 5083          

HSP 4 Score: 93.2041 bits (230), Expect = 8.036e-18
Identity = 56/200 (28.00%), Postives = 97/200 (48.50%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVH--------QMLVPFEILTDKEKSRYRKLTNELLKYLQYNG 9652
            F P P+D S  +L +    +  ++A++LH+ WA+  +E G+ YG TR++ ++ HP L  F+ L + ++   I   +  +K + A G+ +  +     +   R  P     +GY P P D   + +  E+  + E LA N HNIWA+ K     + G   H          LVP+E + ++ K   R+   E ++ LQ  G
Sbjct:  853 FIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFG 1052          

HSP 5 Score: 85.1149 bits (209), Expect = 2.012e-15
Identity = 56/221 (25.34%), Postives = 104/221 (47.06%), Query Frame = 2
Query: 2642 NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSE 3304
            N   +E   +IPR V+ +  ++   +E + +  AE+ H+ WA +K+++GW +G      N THP L  F  L   E+ F      E L+ ++A  Y+          R    +  +    SN + P+P+DL +++L   +     ++AE++H IWA   +    + G          P LVP++ + D  ++ +R  + E +K L  + Y +  P  + S+
Sbjct: 2828 NKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKG-----GFMPIP-LVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQ 3041          

HSP 6 Score: 57.3806 bits (137), Expect = 4.516e-7
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 2870 RQFDVTLAYETLRTIVALGYTI--NYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMA 3310
            R +D  L  + L  + A+G  I  +Y + S    ++  +      +   + P+ +D+    ++  LE +    AE+ H+ WA  ++++GW +G + + A    P L P+  + D  K   ++   E +K L+A+NYS E    D ++ A
Sbjct: 2792 RPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRRE----EEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRA 2936          
BLAST of Ryanodine receptor related vs. Ensembl Celegans
Match: unc-68 (pep chromosome:WBcel235:V:6901697:6924961:-1 gene:WBGene00006801.1 transcript:K11C4.5l.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-68)

HSP 1 Score: 2161.34 bits (5599), Expect = 0.000e+0
Identity = 1273/3167 (40.20%), Postives = 1836/3167 (57.97%), Query Frame = 2
Query: 4502 MDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFD----TRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRA-TPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQT-ESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKD--------DISCC--AEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILP---APQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESV-VPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWT---IDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-----AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLT-MERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLE-EEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS------DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVV-NEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            +D+YY+ + + PGQD  Q+++GWVT+ +            N +FD     R  +      H T  DS +S +        C                 Y++NV+++L       D+      G  IGC +D + G L+F++ S +  I F++ P   L+PA FV PTA E   FELGR + T P+ A M +   ++  P    RL ++ ++  +W+RV N   +   LKL+EVRGWS+L  + V++M+V+IPE+D+ LDILE+ E P +L FH +TL LY  +  +GNH VA +L  H+DE+Q  Y I++HYL G +R  F DLLI +HL SH+  +     E V+PL   LQ   V +   +                       + P  T ES S+   + S+ V   +  E+   + P     P +++E LK   ++ L +A +       + IGG   N F PL K+ D LL++G++   ++  +L ++    F            + +  + L E VK+QL  +L  LCDIQLR+RIE +V  +  FV  +Q+DQ +RY+EIKQ+D+P +  AK TKEFRCPP++QM     F        EE+D        D+  C  AE L++++  F   L+   G    EG   ++L                   +   EEG  +  F + ++ +    P+ E  + ++       +N  ++I   L  WA++ FIE+  LIR MF LL RQY+ + EI++++ +TYV   +++ DVT  L  L ++R LL VQ    EE +LK  LW +MNN++FFQHP+L R L+VHE VM +M++ LT                                    A Q ++    +E  E  K      +EMVV C RFLCYFCRTS QNQK MFEHLS++L+N++MLLARPSLRG+ PLDVAYSS MDNNELALA++E++L+KVAVYLSR G+Q N EL++KGYPDIGWDPVEGER++DFLRF VW+NGE +EENANLV+RLLIRRPECLG AL+G               E   +FSA       +E+I            SHP++ ++         GLL                             ENP   T P   A+ ED                     Y+DLGAA L FYS LVDLL +CAP+       K  SLR RAIL+SL+S++DL  +L+LRF +P   AP +E T             G  PGLLP HK SV+LFL+RVYGI   +    +LE +FL D+RAAT++D   + +SD ALALNRYL NSVLPLLT HSH+  + E  +++L+ TLHT YR++R +SLTK QR+ VSDFLVA+T++L P M+ KLL+K+I D+ ++   +V VPLRL+T  Y+RCG YY S      G+A+E+EK+L+  LF  IFD L   PYDPELF KALPC+TAIG A+SPDY+    L  ++        A                                    + P+ VD S   +   LE + + FA+H HDSWA   +EKG+V+G   +  N THP L  F LL   ++  Y E   E LKA++AW ++   +D D +           T I++ + P P DL  + + K+M++ AEK+AE++H IWA+    D+++ GG +   LVP+++LTD E+ + R   +E+LK+LQY+GY                      ++ P D       Q Q  +  + GE  +TS E  RFAY LL KL+ Y+EQA + ++ ++PS   +R   F +E +D+KFF KVVLPL+  YF AHKNYF+   S+     A N+EK+M A LFC+L +LLR K  A G    I+V+CLQGL QA+D+R +VK++S   D VR  LL FF NCADDL   +  L    ++S ++G   +   S  + + +++PVL +MF H+++ + G DLL+ D+Q ACYKIL++LY +   SS  + R+ I+ E  +HRP LG+C+AA A  FPVAFLE   NK+NK+S+L   + + S++ +E+L  L  ++P+L+ ++ ++  +A +   Y++ P+V +V LP++CSY+  W+S GP+   +   +       T+V+   IN +   +LK+IRN++   +APW+ R+      I+ N T + + E  LP+AE+L+  + +A KEEE         +      E  + +    LVR+ +AF+P+L+KY DLHR  W+K PT +TD ++  VA IF IWS+S HFKREE N+V Q E D  +    D  +   + A R        K+   +  K     S+ +AC+KRLLP+GL++FGGRE +++Q++K++                   IQKE +  I E++K  +++  + D      WQ  LY+KIGK++     E +S++ +I+++  + +V   L+ +       +  WKK+++ QRKR  ++      L+    HRG+N FL A+  +W+  E+    +LI ++    ++ E   I              +G     +SE   E         T PDPL QLI   +R A  + +      +DSLY+ +A +M+KS   E++D +D  EG+    + +EQ      +  EQ  L+ RGAA M L+ +    G    +V ++++LGI LL GGN  +Q  ++ +L+ KK + FF S++GLM +CSVL+L+ FER  KAEGL  G         NL DA+FTC LFRFLQL CEGHNL FQ+YLR+Q G+TT+VN+I CTVDYLLRLQES+MDFYWHY+ K+ ID  GK   ++AI++  Q+F TLTE IQGPCVGNQ+ LA+SRLWDAI+GF F+FAHM +KL K+  QLELLREF+ LQK+M++++LSMLEGNV+NG IGKQMVD LVES  +VE ILKF D+FL++KD+T+S+AF  FD N+DGWIS KEF+ AME QKMY  E+I Y+MMC D NNDGKVD+ EFT+RFH+PA+DIGFN+AVLL NL EH+ ND RLE+++ KA+ ++E F+P+LGRIEI G S R+E++YFEI++S ++QW K QI+DSK SFL +V+ ++GGD+ KLE+F+NFCEDTI+EMQH+  IS
Sbjct: 1551 VDEYYYGIRIFPGQDPSQVWVGWVTTQYHYY---------NVNFDGSQGVRKCRFSEADHHGTTVDSVQSQN--------C-----------------YMVNVSELL---ATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPTATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSES----------------------RYPQITGESVSMLSQMASEPVKKHVSREDEMKLLP-----PSVDFEALKKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDEN--YETGTTQKGLTQLELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQM-----FRLLMCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIG-NVKEGDSDDQL------------------ALIESEEGSWVDSFARIVVKV--PPPVLEEGMEMQKKG---TQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILT------------------------------------AQQGTVEHEGDELKE--KAPIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLSRCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKG---------------EGQGLFSAFKEAIALSEDIRLLEND------SHPSLLSS---------GLL----------------------------GENP---TYPSKDAEGED---------------------YIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAILRSLISLDDLGQILALRFTIPNLAAPSIEDT-------------GPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH--YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGA------------------------------------WIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYH---------------------VNCPKDE------QSQNDRLKSEGE--RTSVE-KRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNS---DIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAK-SQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEE------HMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKK------KRREGQIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKF------------------IQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDE-MSQDAVIEKIFNMGQVSAILHTMTSRME-KEDIWKKVLTLQRKRMAISLITASHLYKTELHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIME---------EGVPIVASSEDTKEKE-------TNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQ---ALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAIS 4365          

HSP 2 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 662/1372 (48.25%), Postives = 927/1372 (67.57%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSV------GHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVME-EQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENV-VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVE--NNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDID--KENSKVEVQL--HTG-SVPTLKLISKIF-----GVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILE-QMPSYPGTLNRNLTK 4177
            +E+ +++   D VCLS V      G   S+R CL   GFG+R C LEN+S ++ PPD+++C+  +D ALS+RALQE+++   D  +  G  GHKTLLYGHAV LKH  S M+L+CLS+ SS DKLAFDVG+QE    EACWWT+HPA+KQRSEGEKVR+GDD+ILVSV++ERYLH+    G      VIASF QTLW +  VSSG++R +++G +FG DVLRLFHG DECLT+P +  EH PQH  V+YE GA  + ARSLWR+ELI+ KW G  + W    R++H+TSGRYL V    N V   H+ +A    TAF + Q+KD KK   +E EE+ MG+A I++GET  F+QHV +  WLSY+  EV K+G+GKVEEK+AV L +GHMDD +T     +EESKSA  IR+C+SV  +F++ +D   +E  Q +  ++++L+EV++ +EDLI++F +PN +++ E KQ  L ALR+RQDLFQEEG++N++L TIDKF+   +   DF   +GE+    ++Q+S YLYLL+AAMI+GN  NCAQFA   R+DW+F RL +PQSAEG+LDVL+CVLT+S EALN+I + HIR +I LL+K GRDP+VL VL SLC G  G AVR +Q LI   LLP +DLLLQT + D  SS+ PN+ +GV E SA ++KWY+E  ++ IE +T     LR+GW+N+ GF PFPG     G   VGDD +S+GFDG++++ GGK +R    V   +L  GD+IGC +DLT+P I+F++N   + G F+ FNIDG F+P +S SAKVS R I GG  GRLRYGPP G+SA+ EA+     L++  C SFG+L K+I++G      N+  FIP P++ +  QL ++   +  K AEN+HE+WAM+KI+ GW+YG+ R + ++ HPCLT FE LP  E+++++ LA  T++TI ALGY +  E P    RL+ ++L  +F Q NGY+P PLD   I L + L+ L   LA NTHNIWA ++IK+GW++G  E  +   KRSPHLVPYE+VD+ IK++NR+++ E ++ L  +   +E P  +  E+A      +  RK ++  RT+RA++T+ V  GKWY+E E+LT G+M+ GW+ +      ++G++ +SYAFD     KW+  +  YGK  + GDV+GC LDL D+TI+FSLNGEL++DP G E+AF N+ C  G VP  + G GQ  +LNFG   ++LK+FT CGLQEGY PFCVNM R +P+W++++ P  F DI   K  S +EV     TG S P LK++ K+        +K++ME+++L LP+KC D F       ++   E +RRQL   + P +Q ++ + + P  P   + N  K
Sbjct:   10 DEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVATERYLHMAYSKGYM----VIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPENWSEH-PQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGV--LDNSVQLYHKEKADFDLTAFVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQDLFQEEGVLNMILDTIDKFS-QMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEG-NGMAVRSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSYGFDGKSMYFGGKSRR----VGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQGRLRYGPPTGFSAVVEAV--NGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPP--CRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFGIFLEPPAHEHDEVAEK---ELRARKDNT--RTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLP-RFEDISTLKSGSILEVSRIPATGNSPPCLKILQKVTISEGGPSEKAKMEYIKLSLPVKCNDTFV------KNKDKETIRRQLQEYK-PRSQSVVSQIRAPGIPKEFDDNKEK 1351          

HSP 3 Score: 441.039 bits (1133), Expect = 5.712e-123
Identity = 238/472 (50.42%), Postives = 323/472 (68.43%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDD--MEEFIILNDSVAYMG------LLFKIL---AGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTD-----DNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIAWDIQYLIWKW-GVIFTDNAFLYLGLYFVTSLIGNF-NYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK--DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            I+++ A+N    +   L LAFFIN +LLF+ V+   + + E  +  D D+  +E   I      Y+       +L +IL   + LH S + ++L+++Y LK+PL+ FKREKEI+R L F+G WITE+ ++     D    + D++V+S  SFP  YWDKFV++K R+K+ +Q D   + ++LG  + S  S           ++D +Y  W W GVI T+  FLY   Y + S  G F + FF+A HL+DV +SF  L+ ILQSVTHN +QL+LT+M+T V++YLYTVIAFNFFRKFY+++ +  +  D KCHNMLTCF++H + G+RAGGGIGDE+ESP GD  E  R+ +DI+FFFFVI+ILLAI+QGLIIDAFGELRDQ E   E +ES CFIC IGKE FD++P GFE H  KEHNFANY++FL H++NK +TEYTGQETYV E Y  R WDFFPVG+CF KQYE++L
Sbjct: 4606 ILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGEEKMSTDS-----------SYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQL 5066          

HSP 4 Score: 92.8189 bits (229), Expect = 8.590e-18
Identity = 56/200 (28.00%), Postives = 97/200 (48.50%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVH--------QMLVPFEILTDKEKSRYRKLTNELLKYLQYNG 9652
            F P P+D S  +L +    +  ++A++LH+ WA+  +E G+ YG TR++ ++ HP L  F+ L + ++   I   +  +K + A G+ +  +     +   R  P     +GY P P D   + +  E+  + E LA N HNIWA+ K     + G   H          LVP+E + ++ K   R+   E ++ LQ  G
Sbjct:  851 FIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAENIRALQLFG 1050          

HSP 5 Score: 85.1149 bits (209), Expect = 1.881e-15
Identity = 56/221 (25.34%), Postives = 104/221 (47.06%), Query Frame = 2
Query: 2642 NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSE 3304
            N   +E   +IPR V+ +  ++   +E + +  AE+ H+ WA +K+++GW +G      N THP L  F  L   E+ F      E L+ ++A  Y+          R    +  +    SN + P+P+DL +++L   +     ++AE++H IWA   +    + G          P LVP++ + D  ++ +R  + E +K L  + Y +  P  + S+
Sbjct: 2826 NKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISN-FAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKG-----GFMPIP-LVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQ 3039          

HSP 6 Score: 57.3806 bits (137), Expect = 4.515e-7
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 2870 RQFDVTLAYETLRTIVALGYTI--NYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMA 3310
            R +D  L  + L  + A+G  I  +Y + S    ++  +      +   + P+ +D+    ++  LE +    AE+ H+ WA  ++++GW +G + + A    P L P+  + D  K   ++   E +K L+A+NYS E    D ++ A
Sbjct: 2790 RPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRRE----EEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRA 2934          
BLAST of Ryanodine receptor related vs. Ensembl Fly
Match: RyR (gene:FBgn0011286 transcript:FBtr0088637)

HSP 1 Score: 2061.96 bits (5341), Expect = 0.000e+0
Identity = 1137/2589 (43.92%), Postives = 1602/2589 (61.88%), Query Frame = 2
Query:  125 DEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSL--SKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAM--GEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEG--VLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVV-QQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNS-FLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATK-WNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCD-MGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIF-GVQKSEMEFLRLGLPIKCKDHFTTKSLQER------HASIELMRRQLDPIQVPT-TQDLILEQM----------------------------------PSYPGTLNRNLT------KNLQNM--SSSTLDINKKGKKM----RLGKNPFK--KNRSRDASPDIVAGTT---------TKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGML-RRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDM--CPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTR-SILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNC---GIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFER-RPIEES-KLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRA 7624
            +++++SFLRT+D V LS    G  +R CL+A GFG+R CFLEN++ +N PPDLS CVF+++QALSVRALQE+V         G  SGH+TLLYG+A+LL+H  S+M+L+CLSTSSS DKL+FDVGLQE +  EACWWTVHPA+KQRSEGEKVR+GDDLILVSV++ERYLH T +N ++I   V ASF  T W+V P  +G  R K +G VFGGDVLR FHG DECLT+P + G  + Q+  V+YE G V + ARSLWRLEL +TKW+GGFI W    R+RH+T+GRYL V+ S NE+  V + +A  ++T F +RQ KDD+K   E+ + + +GS  IK+G+TTV +QH  ++ WLSY++YE KK+GVGKVEEKQA++  EG MDD    ++ Q+EESK+A  IR+C+S+FT+FI  L E +   +R S+   K+NL+E++ CLEDLI++F +P  D EHE KQ +  ALRNRQDLFQEEG++NL+L  IDK        + F+ +   G++  + +D +S YLY LLAA+I+GN  NCAQFA  +R++W+F RL S  S+EG  +LDVLHCVL DS EALN++ D HI+++I LL+K GRDP+VL VLCSLC+G  G AVR +Q  I D LLP ++LLLQT LVD  +S+RPN+F+G  + S+ YQKWY+E+ +D IE  T+    LR+GW+N  G+ P+PGG + WG   VGDDL+SFGFDG  LWTGG+   + + + ++P +  GD+IG  +DL+VP+I F  N   V+G FRDFN+DGMF+P +S S+K+S R +FGG HGRL++ PP G+SA+ + L+P++ L L+PCF FGNL K++ AG    +++  F+P+PV+T  + LP+ V+ I++KLAENIHEMWA+ KI+ GW++G++RDD ++ HPCLT FE+LP  E+++D  LA +TL+TI++LGY I  + P   +R++ ++LPN  F+Q NGY+P PLDL  ++L+  LE LV+QLAENTHN+WA +RI+QGW+YG  E++   RSPHLVPY KVD++IKK+NR T+ ETV+TLL Y Y ++ P  + +E  ++ +    +R   +  RT+R +  + VTSGKWY+E E+LT G MR GW   D   G  +GS   S+AFD  +  K +   S  +GK C PGD++G  LDL D TI+FSLNGEL+MD +G E  F +++ + +G+VP  + G GQ A+L +G DV +LK+FT CGLQEGY PFCVNM RPV  WY+++ P      +  + +++V    G     P LK+    F  ++K+  EFLRL LP+ C   F ++  + R      +    LMR      Q+   TQ   ++ M                                  P   G+L RN+T        L  M  S+S LD+N  G++M    + G++PFK    +SRD S + +   T         T +   +V          T  L+      + +   G   ++ S +          ++ +   ++L+++Y++ V + PGQD   +++GWVT+ + L                                S+E N   V   ++  +E+D  +    +D     +  AD L N   QD  GK  SQG+ +GCF+D ATG + F    ++    + + P T L+PA+FV+ T++E    ELGRT  TLP+ A +L    +   P    RLK+Q L+   W+RV N   ++H LKL++VRGWS+L E+ V M+A+HIPEEDRC+DILEL E  +LL FH  +L LY  +C   N+  A +L  H+D+ Q  Y I++ Y+ G LR  F+DLLIA+HLESH+      +NE + PL   L+         + Y + +      S + E       +  Q     I P +I+   T  M   + E I P +D    P+   E ++   ++ L +AV        +PIG + EN+F+PL+K+ D LL++G++   D+  +L ++D  T+            R  +L M + E  KLQ+C+LLH L D QLRHR+E I+  S+DFV ++Q DQLRRY+EIKQSDLPS+V AK TKEFRCPP +QM  IL F         +  D   C  EL+ ++  FH  LM       ++ P+G++   +                       EE ++ P  +  I N     + +EE  K   E  K    +   +V+  T+++WA+ + IEN  L+REMFSLL RQY+ +GE+  +L+KTYVI+ +++DDV ++   L ++R LL VQ+ + EE L++  LW ++NN  FFQHP+L R L VHE VM +M++TL R     +D                                  P   E       K+ D   EMVV CCRFLCYFCRT  QNQK MF+H  ++L+N+++LLARPSLRG+ PLDVAYSSLM+N ELALA+RE  LEK+AVYLSR G+QSN EL+ KGYPD+GWDPVEGER+LDFLR+ VWVNGE +EENANLV+RLLIRRPECLGPALRG    + RA
Sbjct:    9 EQDDVSFLRTEDMVTLSCTATG--ERVCLAAEGFGNRHCFLENIADKNVPPDLSQCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKENEQSI---VNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAGQN-IVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDS-NELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITAL-ETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEEGVLNLILEAIDKIN--IITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVG-NGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGSSMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFDGAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDFNLDGMFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLAKNVLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPP--ARIRPVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEA----QRLKFAGFRTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNEEKVYGGVSESFGKQCGPGDIVGVFLDLADHTISFSLNGELLMDALGGETTFADVTAEGVGFVPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWDEIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMMRGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFSKKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQ-GPKQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLH-------------------------------SREFNKNKVRRGSV-YIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLALHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELK---------ELYSDEEMQHSLRSLVTE------SVRPQLRMTEITPPVIA---TSSMPSVSSEPI-PDIDQLYSPKFPLEVVRQFVMEALKDAVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREGKDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFK----NLEPDDQDNCTCGLELRGRLGDFHDSLMQKVSLNALQEPDGVEGTAI-----------------------EEVKTGP--ITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSD---------------------------------APTQSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRA 2466          

HSP 2 Score: 1734.15 bits (4490), Expect = 0.000e+0
Identity = 958/2103 (45.55%), Postives = 1341/2103 (63.77%), Query Frame = 2
Query: 7964 NF-HNLPP-EDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSST-GMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSL-APGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMH--GERRR---PTI---INDG----YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFN------EEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSY--------TSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKIGKAKFVDSSESVSK-------------EIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS----DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTK----SLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITS----------LLNWTNVKHSWKFLRSVSVKDIVVGVFR 14077
            NF H LP  E+D DY+D GAAIL FY  LVDLLGRCAP+    +  K+ SLR RAIL+SLV +EDL+GVLSL+F         T+++    E K K+ MP GLLP +K S+VLFLERVYGI+  + F RLLE+AFL D+R AT+LD     +SD ALA+NRY+GNS+LPLL KHS +  E E  AS+L+ TLHT YRLS+ R LTKGQRE VSDFLVALT Q+QP M+ KLLRKL +DV  L+  + V LRLLT  + RC  YY ST G    G +++EEK+LT  LFS IFD+L+ + YDPELF KALPCL AIGCAL PDYS            +  ++ +   G+ + AP  P                       + P P+DT+++ L N L SL+ +F++H HD+WA   +E G+ YG  R+D ++ HP L  +++LS+ ++ +Y +PV E LK ++A GWT++     + ++  G  RR   P I    N+G    YNP+P D+  + +++EM +MAE+LAEN+H+IWA+ K  +++  GG +H  LVP+++LTDKEK + R+ + E LKY+QY GY+                     L +PS           K      G  ++ + E  RF+Y LL KL++Y+++A + ++ ++PS+ +SR   F   T DIKFF KVVLPL+E+YF  H+NYF+   +   N      +EK+M A++FCKL +LLR +L+A G D+ I+VRCLQ LV+ ID R + K      +F+R  +L FF   +DDL   + NL   ++SHL+GT  + + SL Y++ V+LPVL +MFDH++  + G DLL+ ++QVA YKIL ALY LGT  +   DR+ +  E  RHRP LG C+ A +  FPVAFLE HLNK+N+YS+L N   ++SLEA++I+ ++E  +PNL+ I+ E+    ES   Y +APH+I+V LP+LC+YLP WWS+GP+N+   +        VT VTA  +N +L NVLK+I+ NI + +APWMTRIA  TQ I+ N +  +L + FLP+AE++K        +E+  +   KS ++  +++E +L +   +LVR++++FYPLLIKYVDL R  W+K    + + L+  VAEIF IWSKS +F +EEQNF+  NEID+++LIMP   +  +S  S  A   ++G K   +K               SL VAC+KRLLP+GL++F GREQEL+Q  K R +                  +K  + D+ E+ +N + L ++ D   ++ WQ  LY K+GK +     +++ K             +  + R++ +AKVL GL+++DHP    K  ++ ++S QRKRAV+ACFR   LHSLPRHR  N+F  +Y   WL  E      ++E++T++ +D E                    K  +E  E DS+           PDPL+QL+T   R AM + S    +D LY+SYA I +KS   E+++  DE  G+ G +    S+ EQEMEK ++L  Q RLS+RG AEMVLL I   +G+ + +V  ++ LGI++L GGN  +Q  ML  LKEKK +GFF SI+GLM  CSVLDLD FER  KAEGL  G      G  N++DAEFTC LFRF+QL CEGHNL +Q+YLR+QAGNTTTVN++ICTVDYLLRLQESIMDFYWHY+ K+ ID AGK N  KAI++  Q+F TLTE IQGPC  NQ ALAHSRLWDA+ GFLF+F+HMQDKLSK   Q++LL+E + LQK+M+ M+LSMLEGNVVNG IGKQMVDTLVES++NVE+ILK+FD+FL++ D+  S +F   D+  +GW++ K+FR  MEQ K Y PEE+++++ C + N++GK+D+  F + FH+P+K+IGFN+AVLLTNL EHMPN+ RL R +  A  ++  FEP+LGRIEI G S RIERVYFEI+ S+I+QWEKPQI++SKR+F +S+V EGGDKEKLE+FVNFCED I+EM H+  +    +G   ++         + +            +IT+          +L+  N+KH    +++ S+ +++VG F+
Sbjct: 2495 NFTHPLPEGEEDEDYIDTGAAILNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKF---------TLSQTAPGEEKPKSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYS------------LSKNTDEDYYGRQMGAPDQP----------------------QYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYK---------------------LHKPS-----------KGGAVEEGGATQAAVEL-RFSYSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTK---NCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALGSCLGAYSSCFPVAFLEPHLNKHNQYSLL-NRIADHSLEAQDIMVKMESCMPNLETILAEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNH-----VTMVTADHMNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPT--ATRRSAISEGA--PAVGGKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYL------------------KKMPEYDVIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARSYYEQWLQEENVGQEVMVEDLTQTFEDSE--------------------KSKKEGEETDSK-----------PDPLTQLVTTFCRGAMTERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGS-EGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFFK 4458          

HSP 3 Score: 576.244 bits (1484), Expect = 9.283e-164
Identity = 313/500 (62.60%), Postives = 369/500 (73.80%), Query Frame = 2
Query: 14609 MKKIDTGTYI---ISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ------------------------------KPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            + +ID   Y    +S  A+N YN K  ALVLAF INFMLLFY+V                                  S D    +    D++ E + +++   YM  + +I A LHS  +L+MLIAYY LKVPL +FKREKEI+R LEFEG++I EQP DD+ K+HWDKLV+S  SFP NYWDKFVKKKVR KYSE YDF+ I NLLGM       Q SE +G    + K ++  D +Y +WK GV FTDNAFLY   YF  S++GNFN FFFA HLLDVA+ FKTLRTILQSVTHNGKQLVLTVML ++I+Y+YTVIAFNFFRKFYI++ D   D KCH+MLTCFVFHL+ G+RAGGGIGDEI  PDGD YE YRI+FDITFFFFVI+ILLAIIQGLIIDAFGELRDQLE VK++MES CFICG+GK++FD +PHGF+ HV+KEHN ANYM+FLMH+INKPDTEYTGQETYVW +YQQR WDFFPVGDCFRKQYE+EL
Sbjct: 4625 VHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETG----IFKYIMNIDWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGDCFRKQYEDEL 5120          

HSP 4 Score: 121.709 bits (304), Expect = 2.547e-26
Identity = 70/242 (28.93%), Postives = 125/242 (51.65%), Query Frame = 2
Query: 2591 LEPCFSFG-NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYE-----MPSEGSRLKTIKLPNSFLQSNG----YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETP 3286
            L P +S   N ++  Y       +   ++P P++TN + L N + ++  K +E+ H+ WA ++++ GWTYG  R D ++ HP L  +  L   ER+       E L+ ++A+G+T+ +      +   GS  +  K   +  Q+ G    Y P P+D+ N++LS  ++ +  +LAEN+H+IWA  + ++    G V +      P LVPY+ + D  KK +R+ S E +K +    Y +  P
Sbjct: 2804 LPPDYSLSKNTDEDYYGRQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIH------PQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKP 3039          

HSP 5 Score: 103.99 bits (258), Expect = 4.665e-21
Identity = 62/206 (30.10%), Postives = 110/206 (53.40%), Query Frame = 2
Query: 9071 DDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGW--TIDADLSRIEMHGERRRPTII---NDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            D  F P+PVDT+ + LP+S++ + ++ A+++H+ WAL  +E G+ +G  R+D ++ HP L  F+ L   ++    +  ++ LK +I+ G+  T+D   +RI      R P  I    +GY P P DL  V +T ++ ++ ++LAEN HN+WA+ +     + G            LVP+  + +  K   R   +E ++ L   GY
Sbjct:  851 DTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIR---PVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGY 1053          

HSP 6 Score: 68.9366 bits (167), Expect = 2.182e-10
Identity = 30/97 (30.93%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 3011 YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVS 3301
            Y P P+D  N+ L + L +LV + +E+ H+ WA  R++ GW+YG + ++  ++ P L PY  + +  ++  R    E +K LLA  +++E    +V+
Sbjct: 2831 YMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVA 2927          

HSP 7 Score: 62.3882 bits (150), Expect = 1.721e-8
Identity = 25/90 (27.78%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            +KP P+D S + L   LE L+DQ A++ H+ WA E +++G+ YG+  +  N   P+L+ +  + +  +    +   E ++ ++ +G+ +D
Sbjct:  967 YKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLD 1056          
BLAST of Ryanodine receptor related vs. Ensembl Fly
Match: RyR (gene:FBgn0011286 transcript:FBtr0304572)

HSP 1 Score: 2061.19 bits (5339), Expect = 0.000e+0
Identity = 1137/2589 (43.92%), Postives = 1602/2589 (61.88%), Query Frame = 2
Query:  125 DEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSL--SKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAM--GEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEG--VLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVV-QQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNS-FLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATK-WNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCD-MGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIF-GVQKSEMEFLRLGLPIKCKDHFTTKSLQER------HASIELMRRQLDPIQVPT-TQDLILEQM----------------------------------PSYPGTLNRNLT------KNLQNM--SSSTLDINKKGKKM----RLGKNPFK--KNRSRDASPDIVAGTT---------TKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGML-RRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDM--CPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTR-SILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNC---GIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFER-RPIEES-KLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRA 7624
            +++++SFLRT+D V LS    G  +R CL+A GFG+R CFLEN++ +N PPDLS CVF+++QALSVRALQE+V         G  SGH+TLLYG+A+LL+H  S+M+L+CLSTSSS DKL+FDVGLQE +  EACWWTVHPA+KQRSEGEKVR+GDDLILVSV++ERYLH T +N ++I   V ASF  T W+V P  +G  R K +G VFGGDVLR FHG DECLT+P + G  + Q+  V+YE G V + ARSLWRLEL +TKW+GGFI W    R+RH+T+GRYL V+ S NE+  V + +A  ++T F +RQ KDD+K   E+ + + +GS  IK+G+TTV +QH  ++ WLSY++YE KK+GVGKVEEKQA++  EG MDD    ++ Q+EESK+A  IR+C+S+FT+FI  L E +   +R S+   K+NL+E++ CLEDLI++F +P  D EHE KQ +  ALRNRQDLFQEEG++NL+L  IDK        + F+ +   G++  + +D +S YLY LLAA+I+GN  NCAQFA  +R++W+F RL S  S+EG  +LDVLHCVL DS EALN++ D HI+++I LL+K GRDP+VL VLCSLC+G  G AVR +Q  I D LLP ++LLLQT LVD  +S+RPN+F+G  + S+ YQKWY+E+ +D IE  T+    LR+GW+N  G+ P+PGG + WG   VGDDL+SFGFDG  LWTGG+   + + + ++P +  GD+IG  +DL+VP+I F  N   V+G FRDFN+DGMF+P +S S+K+S R +FGG HGRL++ PP G+SA+ + L+P++ L L+PCF FGNL K++ AG    +++  F+P+PV+T  + LP+ V+ I++KLAENIHEMWA+ KI+ GW++G++RDD ++ HPCLT FE+LP  E+++D  LA +TL+TI++LGY I  + P   +R++ ++LPN  F+Q NGY+P PLDL  ++L+  LE LV+QLAENTHN+WA +RI+QGW+YG  E++   RSPHLVPY KVD++IKK+NR T+ ETV+TLL Y Y ++ P  + +E  ++ +    +R   +  RT+R +  + VTSGKWY+E E+LT G MR GW   D   G  +GS   S+AFD  +  K +   S  +GK C PGD++G  LDL D TI+FSLNGEL+MD +G E  F +++ + +G+VP  + G GQ A+L +G DV +LK+FT CGLQEGY PFCVNM RPV  WY+++ P      +  + +++V    G     P LK+    F  ++K+  EFLRL LP+ C   F ++  + R      +    LMR      Q+   TQ   ++ M                                  P   G+L RN+T        L  M  S+S LD+N  G++M    + G++PFK    +SRD S + +   T         T +   +V          T  L+      + +   G   ++ S +          ++ +   ++L+++Y++ V + PGQD   +++GWVT+ + L                                S+E N   V   ++  +E+D  +    +D     +  AD L N   QD  GK  SQG+ +GCF+D ATG + F    ++    + + P T L+PA+FV+ T++E    ELGRT  TLP+ A +L    +   P    RLK+Q L+   W+RV N   ++H LKL++VRGWS+L E+ V M+A+HIPEEDRC+DILEL E  +LL FH  +L LY  +C   N+  A +L  H+D+ Q  Y I++ Y+ G LR  F+DLLIA+HLESH+      +NE + PL   L+         + Y + +      S + E       +  Q     I P +I+   T  M   + E I P +D    P+   E ++   ++ L +AV        +PIG + EN+F+PL+K+ D LL++G++   D+  +L ++D  T+            R  +L M + E  KLQ+C+LLH L D QLRHR+E I+  S+DFV ++Q DQLRRY+EIKQSDLPS+V AK TKEFRCPP +QM  IL F         +  D   C  EL+ ++  FH  LM       ++ P+G++   +                       EE ++ P  +  I N     + +EE  K   E  K    +   +V+  T+++WA+ + IEN  L+REMFSLL RQY+ +GE+  +L+KTYVI+ +++DDV ++   L ++R LL VQ+ + EE L++  LW ++NN  FFQHP+L R L VHE VM +M++TL R     +D                                  P   E       K+ D   EMVV CCRFLCYFCRT  QNQK MF+H  ++L+N+++LLARPSLRG+ PLDVAYSSLM+N ELALA+RE  LEK+AVYLSR G+QSN EL+ KGYPD+GWDPVEGER+LDFLR+ VWVNGE +EENANLV+RLLIRRPECLGPALRG    + RA
Sbjct:    9 EQDDVSFLRTEDMVTLSCTATG--ERVCLAAEGFGNRHCFLENIADKNVPPDLSQCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKENEQSI---VNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAGQN-IVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDS-NELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITAL-ETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEEGVLNLILEAIDKIN--IITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVG-NGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGSSMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFDGAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDFNLDGMFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLAKNVLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPP--ARIRPVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEA----QRLKFAGFRTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNEEKVYGGVSESFGKQCGPGDIVGVFLDLADHTISFSLNGELLMDALGGETTFADVTAEGVGFVPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWDEIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMMRGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFSKKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQ-GPKQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLH-------------------------------SREFNKNKVRRGSV-YIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLALHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELK---------ELYSDEEMQHSLRSLVTE------SVRPQLRMTEITPPVIA---TSSMPSVSSEPI-PDIDQLYSPKFPLEVVRQFVMEALKDAVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREGKDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFK----NLEPDDQDNCTCGLELRGRLGDFHDSLMQKVSLNALQEPDGVEGTAI-----------------------EEVKTGP--ITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSD---------------------------------APTQSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRA 2466          

HSP 2 Score: 1690.63 bits (4377), Expect = 0.000e+0
Identity = 947/2111 (44.86%), Postives = 1331/2111 (63.05%), Query Frame = 2
Query: 7964 NF-HNLPP-EDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSST-GMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSL-APGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMH--GERRR---PTI---INDG----YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFN------EEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSY--------TSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKIGKAKFVDSSESVSK-------------EIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS----DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTK----SLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAE--------GLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITS----------LLNWTNVKHSWKFLRSVSVKDIVVGVFR 14077
            NF H LP  E+D DY+D GAAIL FY  LVDLLGRCAP+    +  K+ SLR RAIL+SLV +EDL+GVLSL+F         T+++    E K K+ MP GLLP +K S+VLFLERVYGI+  + F RLLE+AFL D+R AT+LD     +SD ALA+NRY+GNS+LPLL KHS +  E E  AS+L+ TLHT YRLS+ R LTKGQRE VSDFLVALT Q+QP M+ KLLRKL +DV  L+  + V LRLLT  + RC  YY ST G    G +++EEK+LT  LFS IFD+L+ + YDPELF KALPCL AIGCAL PDYS            +  ++ +   G+ + AP  P                       + P P+DT+++ L N L SL+ +F++H HD+WA   +E G+ YG  R+D ++ HP L  +++LS+ ++ +Y +PV E LK ++A GWT++     + ++  G  RR   P I    N+G    YNP+P D+  + +++EM +MAE+LAEN+H+IWA+ K  +++  GG +H  LVP+++LTDKEK + R+ + E LKY+QY GY+                     L +PS           K      G  ++ + E  RF+Y LL KL++Y+++A + ++ ++PS+ +SR   F   T DIKFF KVVLPL+E+YF  H+NYF+   +   N      +EK+M A++FCKL +LLR +L+A G D+ I+VRCLQ LV+ ID R + K      +F+R  +L FF   +DDL   + NL   ++SHL+GT  + + SL Y++ V+LPVL +MFDH++  + G DLL+ ++QVA YKIL ALY LGT  +   DR+ +  E  RHRP LG C+ A +  FPVAFLE HLNK+N+YS+L N   ++SLEA++I+ ++E  +PNL+ I+ E+    ES   Y +APH+I+V LP+LC+YLP WWS+GP+N+   +        VT VTA  +N +L NVLK+I+ NI + +APWMTRIA  TQ I+ N +  +L + FLP+AE++K        +E+  +   KS ++  +++E +L +   +LVR++++FYPLLIKYVDL R  W+K    + + L+  VAEIF IWSKS +F +EEQNF+  NEID+++LIMP   +  +S  S  A   ++G K   +K               SL VAC+KRLLP+GL++F GREQEL+Q  K R +                  +K  + D+ E+ +N + L ++ D   ++ WQ  LY K+GK +     +++ K             +  + R++ +AKVL GL++     +  K  W   IS  R++AV++  R   L+ + RHR  N+F  +Y   WL  E      ++E++T++ +D E                    K  +E  E DS+           PDPL+QL+T   R AM + S    +D LY+SYA I +KS   E+++  DE  G+ G +    S+ EQEMEK ++L  Q RLS+RG AEMVLL I   +G+ + +V  ++ LGI++L GGN  +Q  ML  LKEKK +GFF SI+GLM  CSVLDLD FER  KAE        GL  G      G  N++DAEFTC LFRF+QL CEGHNL +Q+YLR+QAGNTTTVN++ICTVDYLLRLQESIMDFYWHY+ K+ ID AGK N  KAI++  Q+F TLTE IQGPC  NQ ALAHSRLWDA+ GFLF+F+HMQDKLSK   Q++LL+E + LQK+M+ M+LSMLEGNVVNG IGKQMVDTLVES++NVE+ILK+FD+FL++ D+  S +F   D+  +GW++ K+FR  MEQ K Y PEE+++++ C + N++GK+D+  F + FH+P+K+IGFN+AVLLTNL EHMPN+ RL R +  A  ++  FEP+LGRIEI G S RIERVYFEI+ S+I+QWEKPQI++SKR+F +S+V EGGDKEKLE+FVNFCED I+EM H+  +    +G   ++         + +            +IT+          +L+  N+KH    +++ S+ +++VG F+
Sbjct: 2495 NFTHPLPEGEEDEDYIDTGAAILNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKF---------TLSQTAPGEEKPKSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYS------------LSKNTDEDYYGRQMGAPDQP----------------------QYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYK---------------------LHKPS-----------KGGAVEEGGATQAAVEL-RFSYSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTK---NCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALGSCLGAYSSCFPVAFLEPHLNKHNQYSLL-NRIADHSLEAQDIMVKMESCMPNLETILAEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNH-----VTMVTADHMNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPT--ATRRSAISEGA--PAVGGKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYL------------------KKMPEYDVIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDRIVAMAKVLFGLHMAASSKNRSK-RWGSKISVARRQAVISSLRAKHLYRMSRHRACNIFARSYYEQWLQEENVGQEVMVEDLTQTFEDSE--------------------KSKKEGEETDSK-----------PDPLTQLVTTFCRGAMTERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEEYIPSAGAGLGVGS-EGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFFK 4465          

HSP 3 Score: 575.859 bits (1483), Expect = 1.081e-163
Identity = 313/500 (62.60%), Postives = 369/500 (73.80%), Query Frame = 2
Query: 14609 MKKIDTGTYI---ISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ------------------------------KPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            + +ID   Y    +S  A+N YN K  ALVLAF INFMLLFY+V                                  S D    +    D++ E + +++   YM  + +I A LHS  +L+MLIAYY LKVPL +FKREKEI+R LEFEG++I EQP DD+ K+HWDKLV+S  SFP NYWDKFVKKKVR KYSE YDF+ I NLLGM       Q SE +G    + K ++  D +Y +WK GV FTDNAFLY   YF  S++GNFN FFFA HLLDVA+ FKTLRTILQSVTHNGKQLVLTVML ++I+Y+YTVIAFNFFRKFYI++ D   D KCH+MLTCFVFHL+ G+RAGGGIGDEI  PDGD YE YRI+FDITFFFFVI+ILLAIIQGLIIDAFGELRDQLE VK++MES CFICG+GK++FD +PHGF+ HV+KEHN ANYM+FLMH+INKPDTEYTGQETYVW +YQQR WDFFPVGDCFRKQYE+EL
Sbjct: 4632 VHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETG----IFKYIMNIDWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGDCFRKQYEDEL 5127          

HSP 4 Score: 121.324 bits (303), Expect = 2.591e-26
Identity = 70/242 (28.93%), Postives = 125/242 (51.65%), Query Frame = 2
Query: 2591 LEPCFSFG-NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYE-----MPSEGSRLKTIKLPNSFLQSNG----YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETP 3286
            L P +S   N ++  Y       +   ++P P++TN + L N + ++  K +E+ H+ WA ++++ GWTYG  R D ++ HP L  +  L   ER+       E L+ ++A+G+T+ +      +   GS  +  K   +  Q+ G    Y P P+D+ N++LS  ++ +  +LAEN+H+IWA  + ++    G V +      P LVPY+ + D  KK +R+ S E +K +    Y +  P
Sbjct: 2804 LPPDYSLSKNTDEDYYGRQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIH------PQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKP 3039          

HSP 5 Score: 103.99 bits (258), Expect = 4.865e-21
Identity = 62/206 (30.10%), Postives = 110/206 (53.40%), Query Frame = 2
Query: 9071 DDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGW--TIDADLSRIEMHGERRRPTII---NDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            D  F P+PVDT+ + LP+S++ + ++ A+++H+ WAL  +E G+ +G  R+D ++ HP L  F+ L   ++    +  ++ LK +I+ G+  T+D   +RI      R P  I    +GY P P DL  V +T ++ ++ ++LAEN HN+WA+ +     + G            LVP+  + +  K   R   +E ++ L   GY
Sbjct:  851 DTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIR---PVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGY 1053          

HSP 6 Score: 68.5514 bits (166), Expect = 2.200e-10
Identity = 30/97 (30.93%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 3011 YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVS 3301
            Y P P+D  N+ L + L +LV + +E+ H+ WA  R++ GW+YG + ++  ++ P L PY  + +  ++  R    E +K LLA  +++E    +V+
Sbjct: 2831 YMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVA 2927          

HSP 7 Score: 62.3882 bits (150), Expect = 1.678e-8
Identity = 25/90 (27.78%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            +KP P+D S + L   LE L+DQ A++ H+ WA E +++G+ YG+  +  N   P+L+ +  + +  +    +   E ++ ++ +G+ +D
Sbjct:  967 YKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLD 1056          
BLAST of Ryanodine receptor related vs. Ensembl Fly
Match: RyR (gene:FBgn0011286 transcript:FBtr0088639)

HSP 1 Score: 2057.72 bits (5330), Expect = 0.000e+0
Identity = 1133/2589 (43.76%), Postives = 1598/2589 (61.72%), Query Frame = 2
Query:  125 DEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSL--SKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAM--GEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEG--VLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVV-QQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNS-FLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATK-WNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCD-MGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIF-GVQKSEMEFLRLGLPIKCKDHFTTKSLQER------HASIELMRRQLDPIQVPT-TQDLILEQM----------------------------------PSYPGTLNRNLT------KNLQNM--SSSTLDINKKGKKM----RLGKNPFK--KNRSRDASPDIVAGTT---------TKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGML-RRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDM--CPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTR-SILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNC---GIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFER-RPIEES-KLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRA 7624
            +++++SFLRT+D V LS    G  +R CL+A GFG+R CFLEN++ +N PPDLS CVF+++QALSVRALQE+V         G  SGH+TLLYG+A+LL+H  S+M+L+CLSTSSS DKL+FDVGLQE +  EACWWTVHPA+KQRSEGEKVR+GDDLILVSV++ERYLH T +N ++I   V ASF  T W+V P  +G  R K +G VFGGDVLR FHG DECLT+P + G  + Q+  V+YE G V + ARSLWRLEL +TKW+GGFI W    R+RH+T+GRYL V+ S NE+  V + +A  ++T F +RQ KDD+K   E+ + + +GS  IK+G+TTV +QH  ++ WLSY++YE KK+GVGKVEEKQA++  EG MDD    ++ Q+EESK+A  IR+C+S+FT+FI  L E +   +R S+   K+NL+E++ CLEDLI++F +P  D EHE KQ +  ALRNRQDLFQEEG++NL+L  IDK        + F+ +   G++  + +D +S YLY LLAA+I+GN  NCAQFA  +R++W+F RL S  S+EG  +LDVLHCVL DS EALN++ D HI+++I LL+K GRDP+VL VLCSLC+G  G AVR +Q  I D LLP ++LLLQT LVD  +S+RPN+F+G  + S+ YQKWY+E+ +D IE  T+    LR+GW+N  G+ P+PGG + WG   VGDDL+SFGFDG  LWTGG+   + + + ++P +  GD+IG  +DL+VP+I F  N   V+G FRDFN+DGMF+P +S S+K+S R +FGG HGRL++ PP G+SA+ + L+P++ L L+PCF FGNL K++ AG    +++  F+P+PV+T  + LP+ V+ I++KLAENIHEMWA+ KI+ GW++G++RDD ++ HPCLT FE+LP  E+++D  LA +TL+TI++LGY I  + P   +R++ ++LPN  F+Q NGY+P PLDL  ++L+  LE LV+QLAENTHN+WA +RI+QGW+YG  E++   RSPHLVPY KVD++IKK+NR T+ ETV+TLL Y Y ++ P  + +E  ++ +    +R   +  RT+R +  + VTSGKWY+E E+LT G MR GW   D   G  +GS   S+AFD  +  K +   S  +GK C PGD++G  LDL D TI+FSLNGEL+MD +G E  F +++ + +G+VP  + G GQ A+L +G DV +LK+FT CGLQEGY PFCVNM RPV  WY+++ P      +  + +++V    G     P LK+    F  ++K+  EFLRL LP+ C   F ++  + R      +    LMR      Q+   TQ   ++ M                                  P   G+L RN+T        L  M  S+S LD+N  G++M    + G++PFK    +SRD S + +   T         T +   +V          T  L+      + +   G   ++ S +          ++ +   ++L+++Y++ V + PGQD   +++GWVT+ + L                                S+E N   V   ++  +E+D  +    +D     +  AD L N   QD  GK  SQG+ +GCF+D ATG + F    ++    + + P T L+PA+FV+ T++E    ELGRT  TLP+ A +L    +   P    RLK+Q L+   W+RV N   ++H LKL++VRGWS+L E+ V M+A+HIPEEDRC+DILEL E  +LL FH  +L LY  +C   N+  A +L  H+D+ Q  Y I++ Y+ G LR  F+DLLIA+HLESH+      +NE + PL   L+         + Y + +      S + E               S+ P L   ++T         +  P +D    P+   E ++   ++ L +AV        +PIG + EN+F+PL+K+ D LL++G++   D+  +L ++D  T+            R  +L M + E  KLQ+C+LLH L D QLRHR+E I+  S+DFV ++Q DQLRRY+EIKQSDLPS+V AK TKEFRCPP +QM  IL F         +  D   C  EL+ ++  FH  LM       ++ P+G++   +                       EE ++ P  +  I N     + +EE  K   E  K    +   +V+  T+++WA+ + IEN  L+REMFSLL RQY+ +GE+  +L+KTYVI+ +++DDV ++   L ++R LL VQ+ + EE L++  LW ++NN  FFQHP+L R L VHE VM +M++TL R     +D                                  P   E       K+ D   EMVV CCRFLCYFCRT  QNQK MF+H  ++L+N+++LLARPSLRG+ PLDVAYSSLM+N ELALA+RE  LEK+AVYLSR G+QSN EL+ KGYPD+GWDPVEGER+LDFLR+ VWVNGE +EENANLV+RLLIRRPECLGPALRG    + RA
Sbjct:    9 EQDDVSFLRTEDMVTLSCTATG--ERVCLAAEGFGNRHCFLENIADKNVPPDLSQCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKENEQSI---VNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAGQN-IVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDS-NELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITAL-ETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEEGVLNLILEAIDKIN--IITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVG-NGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGSSMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFDGAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDFNLDGMFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLAKNVLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPP--ARIRPVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEA----QRLKFAGFRTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNEEKVYGGVSESFGKQCGPGDIVGVFLDLADHTISFSLNGELLMDALGGETTFADVTAEGVGFVPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWDEIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMMRGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFSKKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQ-GPKQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLH-------------------------------SREFNKNKVRRGSV-YIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLALHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELK---------ELYSDEEMQHSLRSLVTE---------------SVRPQLRMTEIT---------EPIPDIDQLYSPKFPLEVVRQFVMEALKDAVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREGKDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFK----NLEPDDQDNCTCGLELRGRLGDFHDSLMQKVSLNALQEPDGVEGTAI-----------------------EEVKTGP--ITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSD---------------------------------APTQSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRA 2452          

HSP 2 Score: 1734.15 bits (4490), Expect = 0.000e+0
Identity = 958/2103 (45.55%), Postives = 1341/2103 (63.77%), Query Frame = 2
Query: 7964 NF-HNLPP-EDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSST-GMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSL-APGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMH--GERRR---PTI---INDG----YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFN------EEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSY--------TSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKIGKAKFVDSSESVSK-------------EIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS----DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTK----SLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITS----------LLNWTNVKHSWKFLRSVSVKDIVVGVFR 14077
            NF H LP  E+D DY+D GAAIL FY  LVDLLGRCAP+    +  K+ SLR RAIL+SLV +EDL+GVLSL+F         T+++    E K K+ MP GLLP +K S+VLFLERVYGI+  + F RLLE+AFL D+R AT+LD     +SD ALA+NRY+GNS+LPLL KHS +  E E  AS+L+ TLHT YRLS+ R LTKGQRE VSDFLVALT Q+QP M+ KLLRKL +DV  L+  + V LRLLT  + RC  YY ST G    G +++EEK+LT  LFS IFD+L+ + YDPELF KALPCL AIGCAL PDYS            +  ++ +   G+ + AP  P                       + P P+DT+++ L N L SL+ +F++H HD+WA   +E G+ YG  R+D ++ HP L  +++LS+ ++ +Y +PV E LK ++A GWT++     + ++  G  RR   P I    N+G    YNP+P D+  + +++EM +MAE+LAEN+H+IWA+ K  +++  GG +H  LVP+++LTDKEK + R+ + E LKY+QY GY+                     L +PS           K      G  ++ + E  RF+Y LL KL++Y+++A + ++ ++PS+ +SR   F   T DIKFF KVVLPL+E+YF  H+NYF+   +   N      +EK+M A++FCKL +LLR +L+A G D+ I+VRCLQ LV+ ID R + K      +F+R  +L FF   +DDL   + NL   ++SHL+GT  + + SL Y++ V+LPVL +MFDH++  + G DLL+ ++QVA YKIL ALY LGT  +   DR+ +  E  RHRP LG C+ A +  FPVAFLE HLNK+N+YS+L N   ++SLEA++I+ ++E  +PNL+ I+ E+    ES   Y +APH+I+V LP+LC+YLP WWS+GP+N+   +        VT VTA  +N +L NVLK+I+ NI + +APWMTRIA  TQ I+ N +  +L + FLP+AE++K        +E+  +   KS ++  +++E +L +   +LVR++++FYPLLIKYVDL R  W+K    + + L+  VAEIF IWSKS +F +EEQNF+  NEID+++LIMP   +  +S  S  A   ++G K   +K               SL VAC+KRLLP+GL++F GREQEL+Q  K R +                  +K  + D+ E+ +N + L ++ D   ++ WQ  LY K+GK +     +++ K             +  + R++ +AKVL GL+++DHP    K  ++ ++S QRKRAV+ACFR   LHSLPRHR  N+F  +Y   WL  E      ++E++T++ +D E                    K  +E  E DS+           PDPL+QL+T   R AM + S    +D LY+SYA I +KS   E+++  DE  G+ G +    S+ EQEMEK ++L  Q RLS+RG AEMVLL I   +G+ + +V  ++ LGI++L GGN  +Q  ML  LKEKK +GFF SI+GLM  CSVLDLD FER  KAEGL  G      G  N++DAEFTC LFRF+QL CEGHNL +Q+YLR+QAGNTTTVN++ICTVDYLLRLQESIMDFYWHY+ K+ ID AGK N  KAI++  Q+F TLTE IQGPC  NQ ALAHSRLWDA+ GFLF+F+HMQDKLSK   Q++LL+E + LQK+M+ M+LSMLEGNVVNG IGKQMVDTLVES++NVE+ILK+FD+FL++ D+  S +F   D+  +GW++ K+FR  MEQ K Y PEE+++++ C + N++GK+D+  F + FH+P+K+IGFN+AVLLTNL EHMPN+ RL R +  A  ++  FEP+LGRIEI G S RIERVYFEI+ S+I+QWEKPQI++SKR+F +S+V EGGDKEKLE+FVNFCED I+EM H+  +    +G   ++         + +            +IT+          +L+  N+KH    +++ S+ +++VG F+
Sbjct: 2481 NFTHPLPEGEEDEDYIDTGAAILNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKF---------TLSQTAPGEEKPKSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYS------------LSKNTDEDYYGRQMGAPDQP----------------------QYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYK---------------------LHKPS-----------KGGAVEEGGATQAAVEL-RFSYSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTK---NCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALGSCLGAYSSCFPVAFLEPHLNKHNQYSLL-NRIADHSLEAQDIMVKMESCMPNLETILAEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNH-----VTMVTADHMNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPT--ATRRSAISEGA--PAVGGKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYL------------------KKMPEYDVIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARSYYEQWLQEENVGQEVMVEDLTQTFEDSE--------------------KSKKEGEETDSK-----------PDPLTQLVTTFCRGAMTERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGS-EGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFFK 4444          

HSP 3 Score: 575.859 bits (1483), Expect = 1.104e-163
Identity = 313/500 (62.60%), Postives = 369/500 (73.80%), Query Frame = 2
Query: 14609 MKKIDTGTYI---ISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ------------------------------KPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            + +ID   Y    +S  A+N YN K  ALVLAF INFMLLFY+V                                  S D    +    D++ E + +++   YM  + +I A LHS  +L+MLIAYY LKVPL +FKREKEI+R LEFEG++I EQP DD+ K+HWDKLV+S  SFP NYWDKFVKKKVR KYSE YDF+ I NLLGM       Q SE +G    + K ++  D +Y +WK GV FTDNAFLY   YF  S++GNFN FFFA HLLDVA+ FKTLRTILQSVTHNGKQLVLTVML ++I+Y+YTVIAFNFFRKFYI++ D   D KCH+MLTCFVFHL+ G+RAGGGIGDEI  PDGD YE YRI+FDITFFFFVI+ILLAIIQGLIIDAFGELRDQLE VK++MES CFICG+GK++FD +PHGF+ HV+KEHN ANYM+FLMH+INKPDTEYTGQETYVW +YQQR WDFFPVGDCFRKQYE+EL
Sbjct: 4611 VHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETG----IFKYIMNIDWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGDCFRKQYEDEL 5106          

HSP 4 Score: 121.709 bits (304), Expect = 2.547e-26
Identity = 70/242 (28.93%), Postives = 125/242 (51.65%), Query Frame = 2
Query: 2591 LEPCFSFG-NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYE-----MPSEGSRLKTIKLPNSFLQSNG----YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETP 3286
            L P +S   N ++  Y       +   ++P P++TN + L N + ++  K +E+ H+ WA ++++ GWTYG  R D ++ HP L  +  L   ER+       E L+ ++A+G+T+ +      +   GS  +  K   +  Q+ G    Y P P+D+ N++LS  ++ +  +LAEN+H+IWA  + ++    G V +      P LVPY+ + D  KK +R+ S E +K +    Y +  P
Sbjct: 2790 LPPDYSLSKNTDEDYYGRQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIH------PQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKP 3025          

HSP 5 Score: 103.99 bits (258), Expect = 5.028e-21
Identity = 62/206 (30.10%), Postives = 110/206 (53.40%), Query Frame = 2
Query: 9071 DDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGW--TIDADLSRIEMHGERRRPTII---NDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            D  F P+PVDT+ + LP+S++ + ++ A+++H+ WAL  +E G+ +G  R+D ++ HP L  F+ L   ++    +  ++ LK +I+ G+  T+D   +RI      R P  I    +GY P P DL  V +T ++ ++ ++LAEN HN+WA+ +     + G            LVP+  + +  K   R   +E ++ L   GY
Sbjct:  851 DTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIR---PVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGY 1053          

HSP 6 Score: 68.5514 bits (166), Expect = 2.200e-10
Identity = 30/97 (30.93%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 3011 YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVS 3301
            Y P P+D  N+ L + L +LV + +E+ H+ WA  R++ GW+YG + ++  ++ P L PY  + +  ++  R    E +K LLA  +++E    +V+
Sbjct: 2817 YMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVA 2913          

HSP 7 Score: 62.3882 bits (150), Expect = 1.735e-8
Identity = 25/90 (27.78%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            +KP P+D S + L   LE L+DQ A++ H+ WA E +++G+ YG+  +  N   P+L+ +  + +  +    +   E ++ ++ +G+ +D
Sbjct:  967 YKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLD 1056          
BLAST of Ryanodine receptor related vs. Ensembl Fly
Match: RyR (gene:FBgn0011286 transcript:FBtr0088640)

HSP 1 Score: 2057.34 bits (5329), Expect = 0.000e+0
Identity = 1136/2589 (43.88%), Postives = 1604/2589 (61.95%), Query Frame = 2
Query:  125 DEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSL--SKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAM--GEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEG--VLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVV-QQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNS-FLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLES-GPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCD-MGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIF-GVQKSEMEFLRLGLPIKCKDHFTTKSLQER------HASIELMRRQLDPIQVPT-TQDLILEQM----------------------------------PSYPGTLNRNLT------KNLQNM--SSSTLDINKKGKKM----RLGKNPFK--KNRSRDASPDIVAGTT---------TKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGML-RRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDM--CPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTR-SILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNC---GIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFER-RPIEES-KLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRA 7624
            +++++SFLRT+D V LS    G  +R CL+A GFG+R CFLEN++ +N PPDLS CVF+++QALSVRALQE+V         G  SGH+TLLYG+A+LL+H  S+M+L+CLSTSSS DKL+FDVGLQE +  EACWWTVHPA+KQRSEGEKVR+GDDLILVSV++ERYLH T +N ++I   V ASF  T W+V P  +G  R K +G VFGGDVLR FHG DECLT+P + G  + Q+  V+YE G V + ARSLWRLEL +TKW+GGFI W    R+RH+T+GRYL V+ S NE+  V + +A  ++T F +RQ KDD+K   E+ + + +GS  IK+G+TTV +QH  ++ WLSY++YE KK+GVGKVEEKQA++  EG MDD    ++ Q+EESK+A  IR+C+S+FT+FI  L E +   +R S+   K+NL+E++ CLEDLI++F +P  D EHE KQ +  ALRNRQDLFQEEG++NL+L  IDK        + F+ +   G++  + +D +S YLY LLAA+I+GN  NCAQFA  +R++W+F RL S  S+EG  +LDVLHCVL DS EALN++ D HI+++I LL+K GRDP+VL VLCSLC+G  G AVR +Q  I D LLP ++LLLQT LVD  +S+RPN+F+G  + S+ YQKWY+E+ +D IE  T+    LR+GW+N  G+ P+PGG + WG   VGDDL+SFGFDG  LWTGG+   + + + ++P +  GD+IG  +DL+VP+I F  N   V+G FRDFN+DGMF+P +S S+K+S R +FGG HGRL++ PP G+SA+ + L+P++ L L+PCF FGNL K++ AG    +++  F+P+PV+T  + LP+ V+ I++KLAENIHEMWA+ KI+ GW++G++RDD ++ HPCLT FE+LP  E+++D  LA +TL+TI++LGY I  + P   +R++ ++LPN  F+Q NGY+P PLDL  ++L+  LE LV+QLAENTHN+WA +RI+QGW+YG  E++   RSPHLVPY KVD++IKK+NR T+ ETV+TLL Y Y ++ P  + +E  ++ +    +R   +  RT+R +  + VTSGKWY+E E+LT G MR GW   D   G  +GS   S+AFD  + TK +  S   +G   + GDVIGC +D+++QTI+FSLNGEL+MD +G E  F +++ + +G+VP  + G GQ A+L +G DV +LK+FT CGLQEGY PFCVNM RPV  WY+++ P      +  + +++V    G     P LK+    F  ++K+  EFLRL LP+ C   F ++  + R      +    LMR      Q+   TQ   ++ M                                  P   G+L RN+T        L  M  S+S LD+N  G++M    + G++PFK    +SRD S + +   T         T +   +V          T  L+      + +   G   ++ S +          ++ +   ++L+++Y++ V + PGQD   +++GWVT+ + L                                S+E N   V   ++  +E+D  +    +D     +  AD L N   QD  GK  SQG+ +GCF+D ATG + F    ++    + + P T L+PA+FV+ T++E    ELGRT  TLP+ A +L    +   P    RLK+Q L+   W+RV N   ++H LKL++VRGWS+L E+ V M+A+HIPEEDRC+DILEL E  +LL FH  +L LY  +C   N+  A +L  H+D+ Q  Y I++ Y+ G LR  F+DLLIA+HLESH+      +NE + PL   L+         + Y + +      S + E       +  Q     I P +I+   T  M   + E I P +D    P+   E ++   ++ L +AV        +PIG + EN+F+PL+K+ D LL++G++   D+  +L ++D  T+            R  +L M + E  KLQ+C+LLH L D QLRHR+E I+  S+DFV ++Q DQLRRY+EIKQSDLPS+V AK TKEFRCPP +QM  IL F         +  D   C  EL+ ++  FH  LM       ++ P+G++   +                       EE ++ P  +  I N     + +EE  K   E  K    +   +V+  T+++WA+ + IEN  L+REMFSLL RQY+ +GE+  +L+KTYVI+ +++DDV ++   L ++R LL VQ+ + EE L++  LW ++NN  FFQHP+L R L VHE VM +M++TL R     +D                                  P   E       K+ D   EMVV CCRFLCYFCRT  QNQK MF+H  ++L+N+++LLARPSLRG+ PLDVAYSSLM+N ELALA+RE  LEK+AVYLSR G+QSN EL+ KGYPD+GWDPVEGER+LDFLR+ VWVNGE +EENANLV+RLLIRRPECLGPALRG    + RA
Sbjct:    9 EQDDVSFLRTEDMVTLSCTATG--ERVCLAAEGFGNRHCFLENIADKNVPPDLSQCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKENEQSI---VNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAGQN-IVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDS-NELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITAL-ETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEEGVLNLILEAIDKIN--IITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVG-NGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGSSMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFDGAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDFNLDGMFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLAKNVLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPP--ARIRPVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEA----QRLKFAGFRTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFADVTAEGVGFVPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWDEIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMMRGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFSKKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQ-GPKQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLH-------------------------------SREFNKNKVRRGSV-YIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLALHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELK---------ELYSDEEMQHSLRSLVTE------SVRPQLRMTEITPPVIA---TSSMPSVSSEPI-PDIDQLYSPKFPLEVVRQFVMEALKDAVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREGKDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFK----NLEPDDQDNCTCGLELRGRLGDFHDSLMQKVSLNALQEPDGVEGTAI-----------------------EEVKTGP--ITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSD---------------------------------APTQSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRA 2466          

HSP 2 Score: 1733.38 bits (4488), Expect = 0.000e+0
Identity = 958/2103 (45.55%), Postives = 1341/2103 (63.77%), Query Frame = 2
Query: 7964 NF-HNLPP-EDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSST-GMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSL-APGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMH--GERRR---PTI---INDG----YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFN------EEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSY--------TSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKIGKAKFVDSSESVSK-------------EIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS----DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTK----SLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITS----------LLNWTNVKHSWKFLRSVSVKDIVVGVFR 14077
            NF H LP  E+D DY+D GAAIL FY  LVDLLGRCAP+    +  K+ SLR RAIL+SLV +EDL+GVLSL+F         T+++    E K K+ MP GLLP +K S+VLFLERVYGI+  + F RLLE+AFL D+R AT+LD     +SD ALA+NRY+GNS+LPLL KHS +  E E  AS+L+ TLHT YRLS+ R LTKGQRE VSDFLVALT Q+QP M+ KLLRKL +DV  L+  + V LRLLT  + RC  YY ST G    G +++EEK+LT  LFS IFD+L+ + YDPELF KALPCL AIGCAL PDYS            +  ++ +   G+ + AP  P                       + P P+DT+++ L N L SL+ +F++H HD+WA   +E G+ YG  R+D ++ HP L  +++LS+ ++ +Y +PV E LK ++A GWT++     + ++  G  RR   P I    N+G    YNP+P D+  + +++EM +MAE+LAEN+H+IWA+ K  +++  GG +H  LVP+++LTDKEK + R+ + E LKY+QY GY+                     L +PS           K      G  ++ + E  RF+Y LL KL++Y+++A + ++ ++PS+ +SR   F   T DIKFF KVVLPL+E+YF  H+NYF+   +   N      +EK+M A++FCKL +LLR +L+A G D+ I+VRCLQ LV+ ID R + K      +F+R  +L FF   +DDL   + NL   ++SHL+GT  + + SL Y++ V+LPVL +MFDH++  + G DLL+ ++QVA YKIL ALY LGT  +   DR+ +  E  RHRP LG C+ A +  FPVAFLE HLNK+N+YS+L N   ++SLEA++I+ ++E  +PNL+ I+ E+    ES   Y +APH+I+V LP+LC+YLP WWS+GP+N+   +        VT VTA  +N +L NVLK+I+ NI + +APWMTRIA  TQ I+ N +  +L + FLP+AE++K        +E+  +   KS ++  +++E +L +   +LVR++++FYPLLIKYVDL R  W+K    + + L+  VAEIF IWSKS +F +EEQNF+  NEID+++LIMP   +  +S  S  A   ++G K   +K               SL VAC+KRLLP+GL++F GREQEL+Q  K R +                  +K  + D+ E+ +N + L ++ D   ++ WQ  LY K+GK +     +++ K             +  + R++ +AKVL GL+++DHP    K  ++ ++S QRKRAV+ACFR   LHSLPRHR  N+F  +Y   WL  E      ++E++T++ +D E                    K  +E  E DS+           PDPL+QL+T   R AM + S    +D LY+SYA I +KS   E+++  DE  G+ G +    S+ EQEMEK ++L  Q RLS+RG AEMVLL I   +G+ + +V  ++ LGI++L GGN  +Q  ML  LKEKK +GFF SI+GLM  CSVLDLD FER  KAEGL  G      G  N++DAEFTC LFRF+QL CEGHNL +Q+YLR+QAGNTTTVN++ICTVDYLLRLQESIMDFYWHY+ K+ ID AGK N  KAI++  Q+F TLTE IQGPC  NQ ALAHSRLWDA+ GFLF+F+HMQDKLSK   Q++LL+E + LQK+M+ M+LSMLEGNVVNG IGKQMVDTLVES++NVE+ILK+FD+FL++ D+  S +F   D+  +GW++ K+FR  MEQ K Y PEE+++++ C + N++GK+D+  F + FH+P+K+IGFN+AVLLTNL EHMPN+ RL R +  A  ++  FEP+LGRIEI G S RIERVYFEI+ S+I+QWEKPQI++SKR+F +S+V EGGDKEKLE+FVNFCED I+EM H+  +    +G   ++         + +            +IT+          +L+  N+KH    +++ S+ +++VG F+
Sbjct: 2495 NFTHPLPEGEEDEDYIDTGAAILNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKF---------TLSQTAPGEEKPKSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYS------------LSKNTDEDYYGRQMGAPDQP----------------------QYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYK---------------------LHKPS-----------KGGAVEEGGATQAAVEL-RFSYSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTK---NCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALGSCLGAYSSCFPVAFLEPHLNKHNQYSLL-NRIADHSLEAQDIMVKMESCMPNLETILAEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNH-----VTMVTADHMNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPT--ATRRSAISEGA--PAVGGKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYL------------------KKMPEYDVIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARSYYEQWLQEENVGQEVMVEDLTQTFEDSE--------------------KSKKEGEETDSK-----------PDPLTQLVTTFCRGAMTERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGS-EGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFFK 4458          

HSP 3 Score: 576.244 bits (1484), Expect = 1.035e-163
Identity = 313/500 (62.60%), Postives = 369/500 (73.80%), Query Frame = 2
Query: 14609 MKKIDTGTYI---ISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ------------------------------KPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            + +ID   Y    +S  A+N YN K  ALVLAF INFMLLFY+V                                  S D    +    D++ E + +++   YM  + +I A LHS  +L+MLIAYY LKVPL +FKREKEI+R LEFEG++I EQP DD+ K+HWDKLV+S  SFP NYWDKFVKKKVR KYSE YDF+ I NLLGM       Q SE +G    + K ++  D +Y +WK GV FTDNAFLY   YF  S++GNFN FFFA HLLDVA+ FKTLRTILQSVTHNGKQLVLTVML ++I+Y+YTVIAFNFFRKFYI++ D   D KCH+MLTCFVFHL+ G+RAGGGIGDEI  PDGD YE YRI+FDITFFFFVI+ILLAIIQGLIIDAFGELRDQLE VK++MES CFICG+GK++FD +PHGF+ HV+KEHN ANYM+FLMH+INKPDTEYTGQETYVW +YQQR WDFFPVGDCFRKQYE+EL
Sbjct: 4625 VHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETG----IFKYIMNIDWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGDCFRKQYEDEL 5120          

HSP 4 Score: 121.324 bits (303), Expect = 2.770e-26
Identity = 70/242 (28.93%), Postives = 125/242 (51.65%), Query Frame = 2
Query: 2591 LEPCFSFG-NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYE-----MPSEGSRLKTIKLPNSFLQSNG----YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETP 3286
            L P +S   N ++  Y       +   ++P P++TN + L N + ++  K +E+ H+ WA ++++ GWTYG  R D ++ HP L  +  L   ER+       E L+ ++A+G+T+ +      +   GS  +  K   +  Q+ G    Y P P+D+ N++LS  ++ +  +LAEN+H+IWA  + ++    G V +      P LVPY+ + D  KK +R+ S E +K +    Y +  P
Sbjct: 2804 LPPDYSLSKNTDEDYYGRQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIH------PQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKP 3039          

HSP 5 Score: 103.99 bits (258), Expect = 4.783e-21
Identity = 62/206 (30.10%), Postives = 110/206 (53.40%), Query Frame = 2
Query: 9071 DDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGW--TIDADLSRIEMHGERRRPTII---NDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            D  F P+PVDT+ + LP+S++ + ++ A+++H+ WAL  +E G+ +G  R+D ++ HP L  F+ L   ++    +  ++ LK +I+ G+  T+D   +RI      R P  I    +GY P P DL  V +T ++ ++ ++LAEN HN+WA+ +     + G            LVP+  + +  K   R   +E ++ L   GY
Sbjct:  851 DTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIR---PVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGY 1053          

HSP 6 Score: 68.5514 bits (166), Expect = 2.294e-10
Identity = 30/97 (30.93%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 3011 YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVS 3301
            Y P P+D  N+ L + L +LV + +E+ H+ WA  R++ GW+YG + ++  ++ P L PY  + +  ++  R    E +K LLA  +++E    +V+
Sbjct: 2831 YMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVA 2927          

HSP 7 Score: 62.3882 bits (150), Expect = 1.678e-8
Identity = 25/90 (27.78%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            +KP P+D S + L   LE L+DQ A++ H+ WA E +++G+ YG+  +  N   P+L+ +  + +  +    +   E ++ ++ +G+ +D
Sbjct:  967 YKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLD 1056          
BLAST of Ryanodine receptor related vs. Ensembl Fly
Match: RyR (gene:FBgn0011286 transcript:FBtr0304570)

HSP 1 Score: 2057.34 bits (5329), Expect = 0.000e+0
Identity = 1136/2589 (43.88%), Postives = 1604/2589 (61.95%), Query Frame = 2
Query:  125 DEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSL--SKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAM--GEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEG--VLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVV-QQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNS-FLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLES-GPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCD-MGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIF-GVQKSEMEFLRLGLPIKCKDHFTTKSLQER------HASIELMRRQLDPIQVPT-TQDLILEQM----------------------------------PSYPGTLNRNLT------KNLQNM--SSSTLDINKKGKKM----RLGKNPFK--KNRSRDASPDIVAGTT---------TKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGML-RRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDM--CPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTR-SILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNC---GIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFER-RPIEES-KLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRA 7624
            +++++SFLRT+D V LS    G  +R CL+A GFG+R CFLEN++ +N PPDLS CVF+++QALSVRALQE+V         G  SGH+TLLYG+A+LL+H  S+M+L+CLSTSSS DKL+FDVGLQE +  EACWWTVHPA+KQRSEGEKVR+GDDLILVSV++ERYLH T +N ++I   V ASF  T W+V P  +G  R K +G VFGGDVLR FHG DECLT+P + G  + Q+  V+YE G V + ARSLWRLEL +TKW+GGFI W    R+RH+T+GRYL V+ S NE+  V + +A  ++T F +RQ KDD+K   E+ + + +GS  IK+G+TTV +QH  ++ WLSY++YE KK+GVGKVEEKQA++  EG MDD    ++ Q+EESK+A  IR+C+S+FT+FI  L E +   +R S+   K+NL+E++ CLEDLI++F +P  D EHE KQ +  ALRNRQDLFQEEG++NL+L  IDK        + F+ +   G++  + +D +S YLY LLAA+I+GN  NCAQFA  +R++W+F RL S  S+EG  +LDVLHCVL DS EALN++ D HI+++I LL+K GRDP+VL VLCSLC+G  G AVR +Q  I D LLP ++LLLQT LVD  +S+RPN+F+G  + S+ YQKWY+E+ +D IE  T+    LR+GW+N  G+ P+PGG + WG   VGDDL+SFGFDG  LWTGG+   + + + ++P +  GD+IG  +DL+VP+I F  N   V+G FRDFN+DGMF+P +S S+K+S R +FGG HGRL++ PP G+SA+ + L+P++ L L+PCF FGNL K++ AG    +++  F+P+PV+T  + LP+ V+ I++KLAENIHEMWA+ KI+ GW++G++RDD ++ HPCLT FE+LP  E+++D  LA +TL+TI++LGY I  + P   +R++ ++LPN  F+Q NGY+P PLDL  ++L+  LE LV+QLAENTHN+WA +RI+QGW+YG  E++   RSPHLVPY KVD++IKK+NR T+ ETV+TLL Y Y ++ P  + +E  ++ +    +R   +  RT+R +  + VTSGKWY+E E+LT G MR GW   D   G  +GS   S+AFD  + TK +  S   +G   + GDVIGC +D+++QTI+FSLNGEL+MD +G E  F +++ + +G+VP  + G GQ A+L +G DV +LK+FT CGLQEGY PFCVNM RPV  WY+++ P      +  + +++V    G     P LK+    F  ++K+  EFLRL LP+ C   F ++  + R      +    LMR      Q+   TQ   ++ M                                  P   G+L RN+T        L  M  S+S LD+N  G++M    + G++PFK    +SRD S + +   T         T +   +V          T  L+      + +   G   ++ S +          ++ +   ++L+++Y++ V + PGQD   +++GWVT+ + L                                S+E N   V   ++  +E+D  +    +D     +  AD L N   QD  GK  SQG+ +GCF+D ATG + F    ++    + + P T L+PA+FV+ T++E    ELGRT  TLP+ A +L    +   P    RLK+Q L+   W+RV N   ++H LKL++VRGWS+L E+ V M+A+HIPEEDRC+DILEL E  +LL FH  +L LY  +C   N+  A +L  H+D+ Q  Y I++ Y+ G LR  F+DLLIA+HLESH+      +NE + PL   L+         + Y + +      S + E       +  Q     I P +I+   T  M   + E I P +D    P+   E ++   ++ L +AV        +PIG + EN+F+PL+K+ D LL++G++   D+  +L ++D  T+            R  +L M + E  KLQ+C+LLH L D QLRHR+E I+  S+DFV ++Q DQLRRY+EIKQSDLPS+V AK TKEFRCPP +QM  IL F         +  D   C  EL+ ++  FH  LM       ++ P+G++   +                       EE ++ P  +  I N     + +EE  K   E  K    +   +V+  T+++WA+ + IEN  L+REMFSLL RQY+ +GE+  +L+KTYVI+ +++DDV ++   L ++R LL VQ+ + EE L++  LW ++NN  FFQHP+L R L VHE VM +M++TL R     +D                                  P   E       K+ D   EMVV CCRFLCYFCRT  QNQK MF+H  ++L+N+++LLARPSLRG+ PLDVAYSSLM+N ELALA+RE  LEK+AVYLSR G+QSN EL+ KGYPD+GWDPVEGER+LDFLR+ VWVNGE +EENANLV+RLLIRRPECLGPALRG    + RA
Sbjct:    9 EQDDVSFLRTEDMVTLSCTATG--ERVCLAAEGFGNRHCFLENIADKNVPPDLSQCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKENEQSI---VNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAGQN-IVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDS-NELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITAL-ETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEEGVLNLILEAIDKIN--IITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVG-NGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGSSMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFDGAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDFNLDGMFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLAKNVLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPP--ARIRPVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEA----QRLKFAGFRTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFADVTAEGVGFVPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWDEIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMMRGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFSKKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQ-GPKQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLH-------------------------------SREFNKNKVRRGSV-YIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLALHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELK---------ELYSDEEMQHSLRSLVTE------SVRPQLRMTEITPPVIA---TSSMPSVSSEPI-PDIDQLYSPKFPLEVVRQFVMEALKDAVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREGKDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFK----NLEPDDQDNCTCGLELRGRLGDFHDSLMQKVSLNALQEPDGVEGTAI-----------------------EEVKTGP--ITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSD---------------------------------APTQSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRA 2466          

HSP 2 Score: 1736.47 bits (4496), Expect = 0.000e+0
Identity = 957/2099 (45.59%), Postives = 1341/2099 (63.89%), Query Frame = 2
Query: 7964 NF-HNLPP-EDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSST-GMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSL-APGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMH--GERRRPTI--INDG----YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFN------EEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSY--------TSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKIGKAKFVDSSESVSK-------------EIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS----DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTK----SLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITS----------LLNWTNVKHSWKFLRSVSVKDIVVGVFR 14077
            NF H LP  E+D DY+D GAAIL FY  LVDLLGRCAP+    +  K+ SLR RAIL+SLV +EDL+GVLSL+F         T+++    E K K+ MP GLLP +K S+VLFLERVYGI+  + F RLLE+AFL D+R AT+LD     +SD ALA+NRY+GNS+LPLL KHS +  E E  AS+L+ TLHT YRLS+ R LTKGQRE VSDFLVALT Q+QP M+ KLLRKL +DV  L+  + V LRLLT  + RC  YY ST G    G +++EEK+LT  LFS IFD+L+ + YDPELF KALPCL AIGCAL PDYS            +  ++ +   G+ + AP  P                       + P P+DT+++ L N L SL+ +F++H HD+WA   +E G+ YG  R+D ++ HP L  +++LS+ ++ +Y +PV E LK ++A GWT++     + ++  G  RR +   IN+G    YNP+P D+  + +++EM +MAE+LAEN+H+IWA+ K  +++  GG +H  LVP+++LTDKEK + R+ + E LKY+QY GY+                     L +PS           K      G  ++ + E  RF+Y LL KL++Y+++A + ++ ++PS+ +SR   F   T DIKFF KVVLPL+E+YF  H+NYF+   +   N      +EK+M A++FCKL +LLR +L+A G D+ I+VRCLQ LV+ ID R + K      +F+R  +L FF   +DDL   + NL   ++SHL+GT  + + SL Y++ V+LPVL +MFDH++  + G DLL+ ++QVA YKIL ALY LGT  +   DR+ +  E  RHRP LG C+ A +  FPVAFLE HLNK+N+YS+L N   ++SLEA++I+ ++E  +PNL+ I+ E+    ES   Y +APH+I+V LP+LC+YLP WWS+GP+N+   +        VT VTA  +N +L NVLK+I+ NI + +APWMTRIA  TQ I+ N +  +L + FLP+AE++K        +E+  +   KS ++  +++E +L +   +LVR++++FYPLLIKYVDL R  W+K    + + L+  VAEIF IWSKS +F +EEQNF+  NEID+++LIMP   +  +S  S  A   ++G K   +K               SL VAC+KRLLP+GL++F GREQEL+Q  K R +                  +K  + D+ E+ +N + L ++ D   ++ WQ  LY K+GK +     +++ K             +  + R++ +AKVL GL+++DHP    K  ++ ++S QRKRAV+ACFR   LHSLPRHR  N+F  +Y   WL  E      ++E++T++ +D E                    K  +E  E DS+           PDPL+QL+T   R AM + S    +D LY+SYA I +KS   E+++  DE  G+ G +    S+ EQEMEK ++L  Q RLS+RG AEMVLL I   +G+ + +V  ++ LGI++L GGN  +Q  ML  LKEKK +GFF SI+GLM  CSVLDLD FER  KAEGL  G      G  N++DAEFTC LFRF+QL CEGHNL +Q+YLR+QAGNTTTVN++ICTVDYLLRLQESIMDFYWHY+ K+ ID AGK N  KAI++  Q+F TLTE IQGPC  NQ ALAHSRLWDA+ GFLF+F+HMQDKLSK   Q++LL+E + LQK+M+ M+LSMLEGNVVNG IGKQMVDTLVES++NVE+ILK+FD+FL++ D+  S +F   D+  +GW++ K+FR  MEQ K Y PEE+++++ C + N++GK+D+  F + FH+P+K+IGFN+AVLLTNL EHMPN+ RL R +  A  ++  FEP+LGRIEI G S RIERVYFEI+ S+I+QWEKPQI++SKR+F +S+V EGGDKEKLE+FVNFCED I+EM H+  +    +G   ++         + +            +IT+          +L+  N+KH    +++ S+ +++VG F+
Sbjct: 2495 NFTHPLPEGEEDEDYIDTGAAILNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKF---------TLSQTAPGEEKPKSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYS------------LSKNTDEDYYGRQMGAPDQP----------------------QYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYK---------------------LHKPS-----------KGGAVEEGGATQAAVEL-RFSYSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTK---NCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALGSCLGAYSSCFPVAFLEPHLNKHNQYSLL-NRIADHSLEAQDIMVKMESCMPNLETILAEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNH-----VTMVTADHMNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPT--ATRRSAISEGA--PAVGGKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYL------------------KKMPEYDVIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARSYYEQWLQEENVGQEVMVEDLTQTFEDSE--------------------KSKKEGEETDSK-----------PDPLTQLVTTFCRGAMTERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGS-EGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFFK 4454          

HSP 3 Score: 576.244 bits (1484), Expect = 1.026e-163
Identity = 313/500 (62.60%), Postives = 369/500 (73.80%), Query Frame = 2
Query: 14609 MKKIDTGTYI---ISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ------------------------------KPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            + +ID   Y    +S  A+N YN K  ALVLAF INFMLLFY+V                                  S D    +    D++ E + +++   YM  + +I A LHS  +L+MLIAYY LKVPL +FKREKEI+R LEFEG++I EQP DD+ K+HWDKLV+S  SFP NYWDKFVKKKVR KYSE YDF+ I NLLGM       Q SE +G    + K ++  D +Y +WK GV FTDNAFLY   YF  S++GNFN FFFA HLLDVA+ FKTLRTILQSVTHNGKQLVLTVML ++I+Y+YTVIAFNFFRKFYI++ D   D KCH+MLTCFVFHL+ G+RAGGGIGDEI  PDGD YE YRI+FDITFFFFVI+ILLAIIQGLIIDAFGELRDQLE VK++MES CFICG+GK++FD +PHGF+ HV+KEHN ANYM+FLMH+INKPDTEYTGQETYVW +YQQR WDFFPVGDCFRKQYE+EL
Sbjct: 4621 VHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETG----IFKYIMNIDWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGDCFRKQYEDEL 5116          

HSP 4 Score: 119.398 bits (298), Expect = 1.208e-25
Identity = 68/238 (28.57%), Postives = 122/238 (51.26%), Query Frame = 2
Query: 2591 LEPCFSFG-NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYE-----MPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETP 3286
            L P +S   N ++  Y       +   ++P P++TN + L N + ++  K +E+ H+ WA ++++ GWTYG  R D ++ HP L  +  L   ER+       E L+ ++A+G+T+ +      +   GS  +  K   +      Y P P+D+ N++LS  ++ +  +LAEN+H+IWA  + ++    G V +      P LVPY+ + D  KK +R+ S E +K +    Y +  P
Sbjct: 2804 LPPDYSLSKNTDEDYYGRQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIH------PQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKP 3035          

HSP 5 Score: 103.99 bits (258), Expect = 4.783e-21
Identity = 62/206 (30.10%), Postives = 110/206 (53.40%), Query Frame = 2
Query: 9071 DDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGW--TIDADLSRIEMHGERRRPTII---NDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            D  F P+PVDT+ + LP+S++ + ++ A+++H+ WAL  +E G+ +G  R+D ++ HP L  F+ L   ++    +  ++ LK +I+ G+  T+D   +RI      R P  I    +GY P P DL  V +T ++ ++ ++LAEN HN+WA+ +     + G            LVP+  + +  K   R   +E ++ L   GY
Sbjct:  851 DTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIR---PVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGY 1053          

HSP 6 Score: 68.5514 bits (166), Expect = 2.294e-10
Identity = 30/97 (30.93%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 3011 YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVS 3301
            Y P P+D  N+ L + L +LV + +E+ H+ WA  R++ GW+YG + ++  ++ P L PY  + +  ++  R    E +K LLA  +++E    +V+
Sbjct: 2831 YMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVA 2927          

HSP 7 Score: 62.3882 bits (150), Expect = 1.678e-8
Identity = 25/90 (27.78%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            +KP P+D S + L   LE L+DQ A++ H+ WA E +++G+ YG+  +  N   P+L+ +  + +  +    +   E ++ ++ +G+ +D
Sbjct:  967 YKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLD 1056          
BLAST of Ryanodine receptor related vs. Ensembl Zebrafish
Match: ryr1a (ryanodine receptor 1a (skeletal) [Source:ZFIN;Acc:ZDB-GENE-020108-2])

HSP 1 Score: 1470.68 bits (3806), Expect = 0.000e+0
Identity = 860/2080 (41.35%), Postives = 1248/2080 (60.00%), Query Frame = 2
Query: 8003 VDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRRPTII------NDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASD---DSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQ--------EQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLM--------TKAFA----KITSITSLLNWTNVKHSWKFLRSVSVKDIVVGV 14071
            V LG AI++FYS L+DLLGRCAPE       K  +LR+RAIL+SLV +EDL GV+SL   +PA   + ++ E           M    +P+HKA +VLFL+RVYGI + +  L +LE  FL DMRAA  LD  +   ++ ALALNRYL ++VLPL+TK +      +  A ++++ LHT YRLSR RSLTK QR+ + + L++L + L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY    G    G+++EEE  LT +LF GIF++LA   +D ELF  A+PC+ AI  A+ PDY               S+S+++                E++  V+A       + +F P+PVDT++  +P  L+  ++++A++ HD WA E ++  + +G   ++  KTHP L  +   S+ D+  Y  P+ E++KAMIAW WT+D     +  ++E    R+           + GY+P P D+ G+ +++E+  MAE+LAEN HN W + KK ++ + GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                   R   D  SD                       SS   RFAY  L KLL++++ A   I  ++ +  S R  ++ P  QE   IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M A++FCK+ +L+R ++   G D    V CL  L +++D R ++K   +  + V+  L  FF + ADD+  +++NL + + S     V+  + ++NY    LLPVL S+FDH+++   G D+++ D+Q++CY+I+ ++Y LGT  + + +R         HRP LGEC+A +A   PVA+LE HLN+ N +S+    T       R ILG      EL  ++P LD +++EI DLAESG +YTE PHVIEVTLPMLC+YLP WW RG EN  +        K  T VT++ +N +LG+++K++ NN+    A WM R+A+ +QPIV  A   ML  HF+P  EKLK    +   EEE  + E KS  +        +  +  +L R+++A YPLLI+YVD +R  W+     D + LF +V E+F+ WSKS +FKREEQNFV  NEI+++S +  D    +KS+ S++  +D    K   R  + S  TSL VA +K++LPIGL+M    +QELI  AK R                     K+ D ++ E+L+N + L+ + D+ +  WQ  LYK++ GKA+  D+ E+V     +KRV  ++ VL+ + + +HP    K  W KL+S QR+RAV+ACFRM PL++LPRHR  N+FL  Y+  W+  E      R+I++++++                                    E   E     T PDPL QLI    RTA+ + S    D LY++YA IM+KSC  +++D+  E E + G + +         E+EMEK ++L +Q+RL +RGAAEMVL  I   +G    +V  +++LGIS+L GGN  VQ +ML +LK+KK +GFF+S+  LMQ CSVLDL+ FER NKAEGL   G+   +G +   + D EFTC LFRFLQLLCEGHN  FQ+YLR+Q G+TTT+N+IICTVDYLLRLQESI DFYW+Y+GKD ID  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LEGNVVNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF  +  +  G IS K+F+ +M+ QK Y P EI++++ C +++ +  +++ EF  RF +PAKDIGFN+AVLLTNL EH+P+D RL+  + +A+ ++  F P+LGRIEI G S +IER+YFEI + +  QWE PQ+K+SKR F+  VVNEGG+ EK+E FVNFCEDTI+EM  + +IS + E  +        +                  + AFA     I +   +  + N++  ++ LR +++K+IVVG+
Sbjct: 2454 VHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLSVQIPAFGKDNSIIE---------PKMSASFVPDHKAPMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAAASLDTAAFSTTEMALALNRYLCSAVLPLITKCAPLFAGTDHRAIMIDSMLHTIYRLSRGRSLTKAQRDVIEECLMSLCRYLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWANFGVSSEEELHLTRKLFWGIFESLAHKKFDAELFKIAMPCICAIAGAIPPDYVDA------------SYSSKT----------------EKKASVDA-------EGNFDPKPVDTTNTIIPEKLDGFINRYAEYTHDRWAFEKIQNNWTFGEVMDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMIAWEWTLDKARDGEDEKVEKKTARKISQTAQATYDPSHGYSPQPIDISGMTLSRELQSMAEQLAENYHNTWGRKKKMELQAKGGGTHPLLVPYDTLTAKEKARDREKAYELLKFLQLNGY----------------AVTRGLKDMESD----------------------ISSIEKRFAYGFLQKLLKWMDIAQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLINQYFKNHCLYFLSTPAKILGSGGHASNKEKEMIASIFCKMSALVRHRVFLFGTDAPAIVNCLHILARSLDARTVMK---SGPEIVKAGLRLFFESAADDIEKMVENLKLGKVSKGNQPVKGVSQNINYTTTALLPVLTSLFDHIAQHQFGDDVILDDLQMSCYRIMCSIYSLGTVKTPHAER---------HRPALGECLAHLAAAMPVAYLEPHLNEYNAFSVYTTKTPR----ERAILGLPNQVQELCLDIPELDVLLKEIGDLAESGARYTEMPHVIEVTLPMLCNYLPRWWERGLENFPDLE-----GKLCTDVTSESLNQLLGSIMKIVVNNLGIDEASWMKRLAVFSQPIVSRAKPEMLKSHFIPTMEKLKKRTSKVVAEEEHLRLEGKSEGDEEEGT---IRDEFAVLCRDLYALYPLLIRYVDNNRARWLTFRDPDAEELFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTAD----SKSKMSKAGGSDVERTKKKRRGDRYSVQTSLIVAALKKMLPIGLNMCSPADQELINLAKTRYS------------------LKDTDEEVREFLQNNLHLQGKVDNPSMRWQMALYKEMAGKAEDADAPENV-----VKRVQEVSAVLYHIEVTEHPFKSKKMVWHKLLSKQRRRAVVACFRMTPLYNLPRHRASNMFLDGYKRNWIRNEGYSFEDRMIDDLSKAL----------------------------------EEEEEEEEEKETKPDPLHQLILHFSRTALTEKSKLDIDHLYMAYADIMAKSCHMDEEDEGGEEENEGGEEEMSFEVRQTEMEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGCMVSSTLKLGISILNGGNCEVQQKMLDYLKDKKDVGFFLSVQALMQTCSVLDLNAFERQNKAEGL---GMVSEEGTSEKVMADDEFTCDLFRFLQLLCEGHNNDFQNYLRTQTGSTTTINVIICTVDYLLRLQESISDFYWYYSGKDIIDEPGKRNFSKAMTVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKSMDSQKQYTPSEIQFLLSCSEADENEMINYEEFASRFQEPAKDIGFNIAVLLTNLSEHVPHDTRLQNFLEQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEVNRKQWEMPQVKESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMNIASQISEQDEEEKEEDDIEEAEGGDAGDEEGGGEEGQPESSSAFADFIQSIMNFLGMFTFRNIRRKYRRLRKMTIKEIVVGL 4359          

HSP 2 Score: 1337.01 bits (3459), Expect = 0.000e+0
Identity = 780/1973 (39.53%), Postives = 1149/1973 (58.24%), Query Frame = 2
Query:  137 ISFLRTDDHVCLSSVGHGSSD--RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTN---------AIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLS-KMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLD-PIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQ---YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRP-RRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQ-IVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKS 5980
            I FLRTDD V L        +  + CLS  GFG+R CFLE  S  +N PPDL++C FIL+Q+LSVRALQE++A   + N         + GG  GH+TLLYGHA+LL+HT S M+LSCL+TS S  DKLAFDVGLQE++  EACWWT+HPA+KQRSEGEKVR+GDD+ILVSVSSERYLHL+  +G+ +   V ASF QTLW + PV SG   + + G + GG VLRLFHG  DECLT+P +  +   Q  +  YE GAV SHARSLWRLE ++  WSG  + WG   R+RH+T+GRYL +      +  V   +A    +AF  R SK+ K    ++ + + MG  +IK+GE+  F+QHV+++ WL+Y A    K       +++A++  EGHMDD  TVA+ Q  ES++A  I   A +FT+FI+ LD    + +    S  + L  ++  L+DLI +F  P  + EHE KQ KL +LRNRQ+LFQEEG+I L+L  +D+    +     F +  GED  E + ++ N  Y LLA++IRGNRANCA F     +DW+  +L+  +++ G+L+VL+C+L +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP RDLLLQT +++  +S+RPN+F+G  E S  Y+KWYYE+ +D +E+ +T +   LRVGW+  EG+ P+PGG +GWG   VGDDL S+GFDG NLWTG  P+++ +  Q  IL+  D++ C LDL+VP I F IN  PV+G F +FN+DG+F+P VS SA + VR + GG  G  ++ PP GY+  +EA+LPK+RLR+EP   + +    +    G +++  +  F P PV+T +I LP ++E IR+KLAEN HE+WA+ +I+QGWTYG  RDD  K HPCL  F+ LP  E+ +++ ++ ETL+T++ALG  +          LK IKLP +++Q NGY+P PLDL ++ L+ +  TLV +LAEN HN+WA DR++QGW+Y  +++   KR+P LVPY  +D+  KK+NR T    V+TL+ Y Y+IE P  + S     N         S  IR FRA+ ++ VT GKWY+E E +T G MR GW      +  E+GS+  +Y F+   + +W++ + P+G+  Q GDV+GCM+DL +Q I F+LNGE+++   G E+AFK++    G++P  S G  Q  ++N G +V +L+YFT CGLQEG+ PF +NM R + +W+S+  P  FV +  ++  +E             +S++ G  +S    L+L          T ++   ++A+ +L+  +L  PI+   T  + +   P         LT+ L      TL+++ + +   L K+  +K +        V      SK+      T        G       +A +            V     L+ ++   +   VE++     YY+SV V  GQ+   +++GWVT  + L             +D      K                  V +VT+   ++  ++  SV  S  Y++   +      +     +   +   IGC +D  TG +TF  N +E+   +QV P T L+PA+F  P+++     ELG+ +N +P+ A M R   +   P    RL LQML    WSR+ N        +++E +GW +   E + MMA+HIPEE+RC+DILEL E   L++FH  TL+LY ++C  GN+ VA +L +H+DE+Q FY I+N YL G +R+ ++DLLI+MHLES  R +L T  E +VP+    +S  +       Y + +K               H +P    +  + P L         +G N  D++    + P +  + LK+ +L  L  AV  G Q I +P+GGS E  FVP+LK++  LLIMG+   +D+  IL +++ + F S
Sbjct:   11 IQFLRTDDQVVLQCTATILKEQIKLCLSCEGFGNRLCFLETTSNAQNVPPDLAICCFILEQSLSVRALQEMLANTTELNEAVDLDKWSSQGG--GHRTLLYGHAILLRHTHSGMYLSCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDIILVSVSSERYLHLSYASGDLM---VDASFMQTLWNMNPVCSGC--ELAEGFLTGGHVLRLFHGHMDECLTIPGAE-QGDDQRRNAHYEGGAVCSHARSLWRLEPLRIGWSGSHMKWGQSFRVRHITTGRYLCLDEEKG-LLIVDPEKANTKQSAFCFRASKE-KTEVAQKRDVEGMGIPEIKYGESMCFVQHVATSLWLTY-ASVDAKSARLGPLKRKAILHQEGHMDDALTVARSQTAESQAARMIYNTAGLFTQFIKGLDSLSGKSKSPGPSPSLPLDAIVLSLQDLIFYFRPPEEELEHEEKQTKLRSLRNRQNLFQEEGMITLVLDCVDRLN-VYNTSAHFSEFAGEDAAESWKEIVNLFYELLASLIRGNRANCALFC--DNLDWLVSKLDRLEASSGILEVLYCILIESPEVLNIIQENHIKSIIALLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQNLITENLLPGRDLLLQTNIINYVTSMRPNIFLGTCEGSTQYKKWYYELIVDHVESFLTAHPFHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLHSYGFDGLNLWTGRVPRQVTSPSQH-ILSAEDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGLFFPVVSFSAGIKVRFLLGGRQGDFKFLPPPGYAPCYEAVLPKDRLRIEPIKEYKHDNDGVRNLLGPTQSLSHTAFTPCPVDTVQIVLPPHLERIREKLAENSHELWAVTRIEQGWTYGLFRDDNKKLHPCLVDFQSLPDPEKSYNLAMSGETLKTLLALGCHVGMGDEKAEENLKKIKLPKTYMQCNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIIQDIVNKRNPRLVPYILLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGHGGGNG-------RSDKIRVFRAEKSYAVTQGKWYFEFEAVTVGEMRVGWARPSVHADRELGSDDLAYVFNGFKSQRWHIGNEPFGRQWQSGDVVGCMIDLTEQNIMFTLNGEMLISDSGSEMAFKDIEIGEGFIPVCSLGMSQVGRINLGQNVSSLRYFTICGLQEGFEPFAINMKRDITMWFSKSLP-QFVPVPTDHPHIE-------------VSRVDGTVES-APCLKL----------THRTFGSQNANTDLLFFRLSMPIEFHETFKVPVGASP---------LTRTLTIPEDETLEVDPESEFELLKKSATRKEQDEKEKEPSVPKELPGSKESENEKDTTTEKSKKRGFFSKAKKAAFIA-------PPPVVPTMPRLMEDVVPDDRDDVEIISNTTTYYYSVRVFAGQEPSGVWVGWVTPDYHL-------------YDLHFDLCK------------------VRNVTVTVGDDKGNIHDSVKRSNCYMVWGGEF-----SSSQQTRISQEDFVIGCLVDLDTGLMTFTANGKEINTFYQVEPNTKLFPAVFCLPSSQNMLQVELGKLKNIMPISAAMFRSDCKNPVPQCPPRLDLQMLTPVIWSRMPNHFLSPETGRVSERQGWKVQCMEPLVMMALHIPEENRCIDILELSERTDLMKFHYHTLKLYGSVCALGNNRVAHALCSHVDESQLFYAIENTYLPGPIRSGYYDLLISMHLESAKRNRLMTNKEFIVPMTDETRSITL-------YSDAEKA--------------HALPGVGLTTCLRPKL--HFAPTGFVGTNA-DLY---TLSPMLPLQMLKDHALSMLTEAVQDGGQAIRDPVGGSVEYHFVPILKLISTLLIMGVFDDDDVKHILKLIEPSVFSS 1856          

HSP 3 Score: 535.028 bits (1377), Expect = 3.288e-151
Identity = 283/489 (57.87%), Postives = 351/489 (71.78%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNST----------DPDDMEE----------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRK------KMIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++  ++N YN +  AL LAF +NF+LLFY+V   P S  E   S             +D E                 +  L +S  YM      LA LH+  A   +I Y CLK+PLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +KY + Y    I  LLGM+  S     +   +K       M+AW    DI+Y IWK+GV+FTDN FLYL  Y V SL+G++N FFFACHLLD+A+  KTLRTIL SVTHNGKQL++TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4573 FMNCLSRNFYNIRFLALFLAFALNFILLFYKVSDTPPSSDEFEGSGIFEGSGLFEGSAEDFEGSGGEDGGDDEDEEGPVYYFLEESTGYMQPTLSFLAILHTVIAFISIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPADDDIKGQWDRLVLNTPSFPTNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLDVSKQQTDKKPEEPDNSMLAWFTSIDIKYQIWKFGVVFTDNTFLYLVWYTVMSLLGHYNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 5061          

HSP 4 Score: 379.407 bits (973), Expect = 4.244e-104
Identity = 225/536 (41.98%), Postives = 312/536 (58.21%), Query Frame = 2
Query: 6005 VTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILN-LFERRPIEESKLCIETAKIDENK--NLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            V   +L M L ESVKLQ+C LL   CD +LRHR+E I+  S+ FV+ +Q +Q +RY E+ Q+  + ++ TA+ T+EFR PP++Q+  ++NF      C EE+D      E+++  +  FH                 ++LL  C        +H     I   E+ E +   L   L  L E+      K   E    ++ K   L ++I  T+I WA+ +FI+N +L+R MFSLL RQY+ALGE+  +L K Y+I+  S  D  +LL  LG++R LL VQ+G  EE L+   + +IM+N+VF+QHPNL R L +HETVM++MV+ L     G  D++   ++ F                                             MV  CCRFLCYFCR S QNQ++MF+HL Y+L+NS + L    +RG+ PLDVA +S +DNNELALA++E+ LE V  YL+  G+QS   LLSKGYPDIGW+PV GE++LDFLRF V+VNGE +EENAN+VVRLLIRRPEC GPALRG
Sbjct: 1961 VGEGLLHMKLPESVKLQMCTLLQYFCDCELRHRVEAIIAFSDKFVNQVQTNQRQRYNELMQAFTMSAAETARKTREFRSPPQEQVNMLMNFK----NCPEEED--CPVPEDVRNGLLTFH-----------------HDLLAHC-------GVH-----IEEEEQEEEVDTSLSGRLRRLVEKVKSLRKKPEAEPEPEEDKKPSTLQELISHTMIYWAQESFIQNPELVRLMFSLLHRQYDALGELIRALPKAYIINAVSIQDTMELLECLGQIRSLLIVQMGPEEERLMIQSIGNIMSNRVFYQHPNLMRALGMHETVMEVMVNVL-----GGGDSK---EIRF-------------------------------------------PRMVTNCCRFLCYFCRISRQNQRSMFDHLGYLLQNSGIGLG---MRGSTPLDVAAASCIDNNELALALQEQDLEMVVKYLAGCGLQSCPMLLSKGYPDIGWNPVGGEKYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRG 2407          

HSP 5 Score: 107.071 bits (266), Expect = 7.261e-22
Identity = 71/274 (25.91%), Postives = 134/274 (48.91%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRL--KTIKLPNSFLQ-----SNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI----ETPPTDVSEMAVSNSFNILKR--KGSSAIRTFRAQSTWKVTSGK 3403
            Y+  +E K +V     F P+PV+T    +P  ++   ++ AE  H+ WA +KI   WT+G+  D+  KTHP L  ++     +++       E+++ ++A  +T++     E  ++  KT +  +   Q     S+GY PQP+D+  ++LS  L+++  QLAEN HN W   +  +      ++       P LVPY+ +    K  +R+ + E +K L    Y++    +   +D+S +    ++  L++  K     + F A     V+SG+
Sbjct: 2757 YSSKTEKKASVDAEGNFDPKPVDTTNTIIPEKLDGFINRYAEYTHDRWAFEKIQNNWTFGEVMDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMIAWEWTLDKARDGEDEKVEKKTARKISQTAQATYDPSHGYSPQPIDISGMTLSRELQSMAEQLAENYHNTWGRKKKME------LQAKGGGTHPLLVPYDTLTAKEKARDREKAYELLKFLQLNGYAVTRGLKDMESDISSIEKRFAYGFLQKLLKWMDIAQEFIAHLEAVVSSGR 3024          

HSP 6 Score: 99.3673 bits (246), Expect = 1.604e-19
Identity = 61/201 (30.35%), Postives = 101/201 (50.25%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGER---RRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDT  I LP  LE + ++ A++ H+ WA+  +E+G+ YG+ R+D  K HP L+ F  L   ++   +    E LK ++A G  +     + E + ++    +  +  +GY P P DL  V +T     + E+LAEN HN+WA+ +       + +  I    +  LVP+ +L +K K   R      ++ L   GY
Sbjct:  858 FTPCPVDTVQIVLPPHLERIREKLAENSHELWAVTRIEQGWTYGLFRDDNKKLHPCLVDFQSLPDPEKSYNLAMSGETLKTLLALGCHVGMGDEKAEENLKKIKLPKTYMQCNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIIQDIVNKRNPRLVPYILLDEKTKKTNRDTVCAAVRTLIGYGY 1058          

HSP 7 Score: 65.0846 bits (157), Expect = 4.040e-9
Identity = 38/172 (22.09%), Postives = 80/172 (46.51%), Query Frame = 2
Query: 8864 KALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHG 9379
            K  PCL        P+ S+  ++    + ++ +       G   A         EE L       +    + +KP P+D +H++L  +  +L+++ A++ H+ WA + V +G+ Y + ++ +NK +P L+ + LL +  +    + V  A++ +I +G+ I+        HG
Sbjct:  909 KLHPCLVDFQSLPDPEKSYNLAMSGETLKTLLALGCHVGMGDEKA---------EENLKKIKLPKTYMQCNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIIQDIVNKRNPRLVPYILLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGHG 1071          
BLAST of Ryanodine receptor related vs. Ensembl Zebrafish
Match: ryr1b (ryanodine receptor 1b (skeletal) [Source:ZFIN;Acc:ZDB-GENE-070705-417])

HSP 1 Score: 1466.44 bits (3795), Expect = 0.000e+0
Identity = 882/2162 (40.80%), Postives = 1271/2162 (58.79%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID-ADLSRIEMHGERRRPTIIND----------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSN-NKSEASR----SANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASD---DSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXT----KSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLM--------------TKAFA----KITSITSLLNWTNVKHSWKFLRSVSVKDIVVGV 14071
            GG GLL A++E I +S                 A + P  K         ED                + + + + LG AI++FYS L+DLLGRCAPE       K  +LR+RAIL+SLV +EDL GV+SL   +P      T  +DG+     +  M    +P+HKAS+VLFL+RVYGI + +  L +LE  FL DMRA+  LD  +   ++ ALALNRYL ++VLPLLTK +      +  A ++++ LHT YRLSR R+LTK QR+ + D L++L + L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY    G    G+ +EEE  L+ +LF GIF++LA   +D ELF  A+PC+ AI  A+ PDY                 S  S T +                      AS   + +F P+PV+T++  +P  L++ ++++A+H HD WA E ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E++KAM+AW WT++ A     E+  E +    I+           GY+P P DL G+ +++E+  MAE+LAEN HN W + KK ++ + GGG H +LVP++ LT KEK+R R+   +LLK+LQ NGY                     GL      I                     SS   RFAY  L KLL+++E A   I  ++ +  S R  ++ P  QE   IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M A++FCKL  L+R +++  G D +  V CL  L +++D R ++K   +  + V+  L  FF + ADD+  +++NL + + S  K  V+  + +++Y    LLPVL S+FDH+++   G D+++ D+Q++CY+I+ ++Y LGT  + + + +         RP LGEC+A +A   PVAFLE +LN+ N YS+    T       R ILG      EL  ++P LD +++EI  LAESG +YTE PHVIE+TLPMLC+YLP WW RGPEN       E+     T VT++ +N +LG+++K++ NN+    A WM R+A+  QPIV  A   ML  HF+P  EKLK  + +   EEE  + E K+  ++       +  +  +L R+++A YPLLI+YVD +R  W+  P  D + LF +V E+F+ WSKS +FKREEQNFV  NEI+++S +  D  S  +KS   R     +++D   KK   R  + S  TSL VA +K+LLPIGL+M    +QELI  AK R                     K+ D ++ E+L+N + L+ + +D +  WQ  LYK+  GKA+  D+ E V     +KRV  ++ VL+ L L +HP    K  W KL+S QR+RAV+ACFRM PL+++PRHR  N+FL  Y+  WL  E      ++I++++++ +  E  E                                      + PDPL QLI    RTA+ +      D LY+SYA IM+KSC   ++D+  E  G E +    ++  E+EMEK ++L +Q+RL DRGAAEMVL  I   +G    +V  +++LGIS+L GGN+ VQ RML +LK+KK +GFF+S+  LMQ CSVLDL+ FER NKAEGL   G+   +G     + D EFTC LFRFLQLLCEGHN  FQ+YLR+Q G+TTT+NIIICTVD+LLRLQESI DFYW+Y+GKD ID  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LEGNVVNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF  +  +  G IS K+F  AM+ QK Y P EI++++ C +++ +  ++F EF +RF +PAKDIGFN+AVLLTNL EH+P+D RL+  + +A+ ++  F P+LGRIEI G S RIER+YFEI +++ +QWE PQ+++SKR F+  VVNEGG+ EK+E FVNFCEDTI+EM  + +IS + E +   +    ++  G                     + AFA     I +  SL  + N++  ++ +R +++KD++VG+
Sbjct: 2394 GGAGLLAAIEEAIKISED--------------PARDGPTPKKDRRFMFGGED----------------QHEENRLHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPVQIP------TFGKDGQ---IVEPKMSASFVPDHKASMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRASASLDTVAFSTTEMALALNRYLCSAVLPLLTKCAPLFAGTDHRAIMIDSMLHTIYRLSRGRALTKAQRDVIEDCLMSLVKYLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWANFGVTSEEELHLSRKLFWGIFESLAHKKFDAELFKIAMPCICAIAGAIPPDYV--------------DASYSSMTEKK---------------------ASVDAEGNFDPKPVETTNTIIPERLDAFINKYAEHTHDKWAFEKIQNNWTYGEVLDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWTLEKARDGETEVKTEVKATRKISQTAQATYDPSQGYSPQPVDLIGMALSRELQSMAEQLAENYHNTWGRKKKMELQAKGGGTHPLLVPYDTLTAKEKARDREKAQDLLKFLQLNGY-----------------AVTRGLKDMEQEI---------------------SSIEKRFAYGFLQKLLKWMEIAQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLINQYFKNHCLYFLSTPAKVLGSGGHASNKEKEMIASIFCKLAGLVRHRVSLFGTDASAVVNCLHILSRSLDARTVMK---SGPEIVKAGLRSFFESAADDIEKMVENLKLGKVS-TKNQVKGVSQNISYTTTALLPVLTSLFDHIAQHQFGDDVMLDDLQISCYRIMCSIYSLGTVKTPHAENQ---------RPALGECLAHLAAAMPVAFLEPNLNEFNSYSVYTTKTPR----ERTILGLPSQVQELCLDIPELDVLMKEIGHLAESGARYTEMPHVIEITLPMLCNYLPRWWERGPENF-----PEQEGCLCTDVTSEQLNQLLGSIMKIVVNNLGIDEASWMKRLAVFAQPIVSRAKPEMLKSHFIPTMEKLKKRSGKVVAEEEQLRMEGKTEVDSEGGT---IRDEFAVLCRDLYALYPLLIRYVDNNRARWLTCPDPDAEDLFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTADSKSKMSKSNTGRFLGGGSDDDRTKKK--RRGDRYSVQTSLIVAALKKLLPIGLNMCSPADQELINLAKIR------------------YSLKDTDEEVREFLQNNLHLQGKVEDPSMRWQMALYKETSGKAEDADAPEKV-----VKRVQEVSAVLYHLELTEHPYKSKKMVWHKLLSKQRRRAVVACFRMTPLYNIPRHRASNMFLDGYKRNWLENEGYSFEDKMIDDLSKALEQEEEEEEET----------------------------------ESKPDPLHQLILHFSRTALTEKLKLEVDHLYMSYADIMAKSCHIGEEDEGGEEGGVEPSFEVRQTEMEKEMEKQRLLYQQSRLHDRGAAEMVLQMISACKGETGVMVSSTLKLGISILNGGNSDVQQRMLDYLKDKKDVGFFLSLQALMQTCSVLDLNAFERQNKAEGL---GMVSEEGTKEKVMADDEFTCDLFRFLQLLCEGHNNDFQNYLRTQTGSTTTINIIICTVDFLLRLQESISDFYWYYSGKDIIDEPGKRNFSKAMTVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFSKAMDSQKQYTPSEIQFLLSCSEADENEMINFEEFANRFQEPAKDIGFNIAVLLTNLSEHVPHDTRLQNFLEQAESVLNYFRPFLGRIEIMGASKRIERIYFEISEANRNQWEMPQVRESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMNIASQISEQEEEVIEDEDEEEEEESGGGGGGEGEGEEGNGEEAPPESSSAFADFIKSIVNFLSLFTFRNLRRRYRKIRKMTIKDMIVGL 4352          

HSP 2 Score: 1113.6 bits (2879), Expect = 0.000e+0
Identity = 594/1319 (45.03%), Postives = 852/1319 (64.59%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVGHGSSD--RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQ--KSEMEFLRLGLPIKCKDHFTTK 4042
            +EEI FLRT+D V L        +  + CLS  GFG+R CFLE  S  +N PPDL++C F+L+Q+LSVRALQE++A   D        GH+TLLYGHA+LL+H  S+M+LSCL+TS S  DKLAFDVGLQ +A  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +G+ +   V ASF QTLW + PV SG   + + G + GG VLRLFHG  DECL +   + +   + +   YE GAV S ARSLWRLE ++  WSG  + WG   R+RH+T+GRYL +      +  +   +A    +AF  R SK+  +   ++ + + MG  +IK+GE+  F+QH+S+  WL+Y A + K   +G ++  + ++  EGHMDD  T ++ Q EES++A  I     +FT+FI+ LD    + +      + L  VI  L+DLI +F  P  + EHE KQ KL +LRNRQ+LFQEEG+I ++L  ID+    +     F +  GE+  E + ++ N LY LLA++IRGNR+NCA F     +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VL SLC+   G AVR NQ LI +NLLP RDLLLQT +V+  SSVRPN+F+G  E S  Y+KWY+E+ +D +E+ VT     LRVGW+  EGF P+PGG +GWG   VGDDL+S+GFDG +LW+G   +++ +  Q   L   D++ C LDL+VP I F IN  PV+G F +FN+DG+F+P +S SA V  R + GG HG  ++ PP GY+  +EALLPK+R+R+EP   + +  + +    G +++  +  F P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  K HPCL  F+ LP  ER +++ ++ ETL+T++ALG  +          L+ IKLP +++ S+GY+P PLDL ++ L+ +   LV +LAEN HN+WA DR++QGW+Y  V++   KR+P LVPY  +D+  KK+NR +    V+TL+ Y Y+IE P  + S   V +            +R FRA+  + VTSGKWY+E E +T G MR GW   +  S  E+GS+  +Y F+   A +W++ + P+G+  Q GDV+GCM+DL +  I F+LNGE+++   G E+AFK++    G++P  + G  Q  ++N G +V +L+YF  CGLQEG+ PF +NM R + +W+S+  P  FV +  +++ +EV    G+V   P +K+  K FG Q   ++M F RL +P++   H T K
Sbjct:    8 DEEIQFLRTEDQVVLQCTATVLKEQIKLCLSCEGFGNRLCFLETTSNAQNVPPDLAICSFVLEQSLSVRALQEMLANTVDMTESSQGGGHRTLLYGHAILLRHYHSSMYLSCLTTSRSLTDKLAFDVGLQLDATGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYASGDLM---VDASFMQTLWNMNPVCSGC--ELAEGYLTGGHVLRLFHGHMDECLAISTPD-QGEEERKIAQYEGGAVCSQARSLWRLEPLRIGWSGSHMKWGQAFRVRHITTGRYLCLDDEKG-LMVLDPEKANTKQSAFSFRASKEKVEGEKKKRDVEGMGIPEIKYGESMCFMQHISTGLWLTYAALDAKAARLGTMKR-RVMLHQEGHMDDALTCSRSQTEESQAARMIYSTTGLFTQFIKGLDSLSGKNKSPGPVSLPLDGVILSLQDLIHYFRPPEEELEHEEKQTKLRSLRNRQNLFQEEGMITIVLECIDRLN-VYNTAAHFSEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFC--DNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLRSLCVC-NGVAVRSNQNLITENLLPGRDLLLQTNIVNYASSVRPNIFLGTCEGSTQYKKWYFEVMVDYVESFVTAQATHLRVGWAMTEGFSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGHVSRQVASPNQHA-LAADDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGLFFPAISFSAGVKARFLLGGRHGDFKFLPPPGYAPCYEALLPKDRMRIEPIKEYKHDFEGVRNLLGPTQSLTHTSFTPCPVDTAQIVLPPHLERIREKLAENIHELWAVTRIEQGWTYGVFRDDNKKLHPCLVDFQSLPEPERNYNLQMSGETLKTLLALGCHVGMGDEKAEENLRKIKLPKTYVMSSGYKPAPLDLNHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQDIVNKRNPRLVPYNLLDERTKKTNRDSVNNAVRTLIGYGYNIEPPDQESSGHGVEDVH-------GDKVRIFRAEKQYGVTSGKWYFEFEAVTTGEMRVGWARPNVRSDVELGSDELAYVFNGNRAQRWHIGNDPFGRQWQSGDVVGCMIDLIEMNIMFTLNGEMLISDSGSEMAFKDIEIGDGFIPVCTLGLSQVGRINLGQNVSSLRYFAICGLQEGFEPFAINMKRDITMWFSKSLP-QFVPVPTDHNHIEVSRVDGTVDSAPCIKITHKTFGSQNANTDMLFFRLSMPVEF--HLTFK 1303          

HSP 3 Score: 532.332 bits (1370), Expect = 2.088e-150
Identity = 278/519 (53.56%), Postives = 358/519 (68.98%), Query Frame = 2
Query: 14597 NPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNST---------------------------------DPDDMEE-----------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKK-----MIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFY-IKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            N  E+++I    Y+    ++N YN +  AL +AF +NF+LLFY+V  +   + E+   +                                 +   MEE           +  L +S  YM       + LH+  +   +I Y CLKVPLV+FKREKE++R LEF+G+++TEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV  KY + Y    I  LLGM+  S    +    +K+     M  W    DI+Y IWK+GV+FTDN FLYL  Y V SL+G+FN FFFACHLLD+A+  KTLRTIL SVTHNGKQL++TV L +V++YLYTV+AFNFFRKFY + +++   DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQV+EDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4563 NELEIQRIKFMNYL----SRNFYNLRFLALFIAFALNFILLFYKVSDRLPGEEEEFEGSAMFEGSGAFEGSAVFEGSAVFEGSGVFEGSGEAEGSGMEENGEEDEENGFVYYFLEESTGYMEPAMAFFSILHTIISFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYVTEQPEDDDIKGQWDRLVLNTPSFPNNYWDKFVKRKVLEKYGDIYGRERIAELLGMDLASLDVSAMTHEKKRQPDPSMFTWLTSIDIKYQIWKFGVVFTDNTFLYLVWYTVMSLLGHFNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLLMTVGLLAVVVYLYTVVAFNFFRKFYNMSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGSDYFDSTPHGFETHTMEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 5077          

HSP 4 Score: 385.185 bits (988), Expect = 6.834e-106
Identity = 227/560 (40.54%), Postives = 324/560 (57.86%), Query Frame = 2
Query: 6017 ILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTT 7693
            +L M + ESVKLQ+C LL   CD +LRHR+E I+  S++FV  IQ++Q  RY E+ ++  + ++ TA+ T+EFR PP++Q+  + NF       H  +++     +E++   N FH  L+++CG+     ++      +   + R R L L+       ++ +S+ Q              ++ +   E  +  +   L ++I  T+I WA+ AFI+N +L+R MFSLL RQY+ALGE+  +L K Y IS  S  D  ++L  LG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L     G  D++   ++ F                                            +MV  CCRFLCYFCR S QNQ++MF+HLSY+L+NS + L    +RG+ PLDVA +S +DNNELALA++E+ LE V  YL+  G++    LLSKGYPDIGW+P  GER+LDFLRF V+VNGE +EENAN+VVRLLIRRPEC GPALRG   A   A     A E  +  S   A +G T
Sbjct: 1948 LLQMKMPESVKLQMCTLLQYFCDCELRHRVEAIMAYSDNFVGQIQSNQRERYNELMRAFTMSAAETARRTREFRSPPQEQIFLLTNFK------HNPEEEDCPVPDEVRETHNNFHNDLLNHCGVH----IEEEVEEEEVDTSLRGRLLTLV-------DKVKSLKQ--------------KKEEEEPEPEEEPKPSTLQELISHTMIHWAQEAFIQNPELVRLMFSLLHRQYDALGELIRALPKAYAISAVSVQDTMEMLECLGQIRSLLIVQMGPEEERLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLG----GGGDSK---EIRF-------------------------------------------PQMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSGIGLG---MRGSTPLDVAAASCIDNNELALALQEQDLEMVVTYLAGCGLRMCPMLLSKGYPDIGWNPGGGERYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRGEGGAGLLA-----AIEEAIKISEDPARDGPT 2418          

HSP 5 Score: 250.366 bits (638), Expect = 3.951e-65
Identity = 164/492 (33.33%), Postives = 243/492 (49.39%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQ-GVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKL-DMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF 5974
            YY+SV +  GQ+  ++++GWVT  F +             +D      K      T GD K +                  +  S+  S  Y++         G      +K SQ  + IGC +D ATG L F  N +E+   +QV P T L+PA+FV P+++     ELG+ +N +P+ A M R  R+   P    RL +QML    WSR+ N      + +++E  GW +   E + MMA+HIPEE+RC+DILEL E   LL+FH  TL LY  +C  GN+ VA +L +H+DE+Q FY I+N YL G LR+ ++DLLI++HLES  R +L T  E +VP+     S  +   +                        H +P    +  + P L    +        G D  P L  + P I  + LK  +L  L  AV  G+Q + +P+GGS E  FVP+LK++  LLIMG+  + D+  IL ++D + F
Sbjct: 1419 YYYSVRIFAGQEPSEVWVGWVTPDFHM-------------YDLNFDLSKVRTVTVTVGDDKGN------------------IHDSIKRSNCYMVWG-------GEFSSSQQKFSQEDLVIGCLVDLATGLLNFTANGKEINTFYQVEPNTKLFPAVFVLPSSQNMLQLELGKLKNIMPLSAAMFRSERKNPVPQCPPRLDVQMLTPVIWSRMPNHFLNPVVGRVSERHGWMVECTEPLTMMALHIPEENRCIDILELSEQHDLLQFHYHTLMLYCAVCALGNNRVAHALCSHVDESQLFYAIENTYLPGPLRSGYYDLLISIHLESAKRNRLGTNREFIVPMTSETLSITLFPDAEAA---------------------HDLPGVGLTTCLRPKLHFSPINFV-----GTD--PDLYTLSPIIPLQNLKTQALSMLTEAVFDGSQAMRDPVGGSVEFHFVPILKLISTLLIMGIFNNEDVKHILKMIDPSVF 1844          

HSP 6 Score: 110.923 bits (276), Expect = 5.381e-23
Identity = 65/211 (30.81%), Postives = 111/211 (52.61%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDT+ I LP  LE + ++ A+++H+ WA+  +E+G+ YG+ R+D  K HP L+ F  L + ++   ++   E LK ++A G  +       + +L +I++     +  +++ GY P P DL  V +T     + EKLAEN HN+WA+ +       + +  I    +  LVP+ +L ++ K   R   N  ++ L   GY
Sbjct:  845 SLTHTSFTPCPVDTAQIVLPPHLERIREKLAENIHELWAVTRIEQGWTYGVFRDDNKKLHPCLVDFQSLPEPERNYNLQMSGETLKTLLALGCHVGMGDEKAEENLRKIKL----PKTYVMSSGYKPAPLDLNHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQDIVNKRNPRLVPYNLLDERTKKTNRDSVNNAVRTLIGYGY 1051          

HSP 7 Score: 108.227 bits (269), Expect = 3.657e-22
Identity = 64/227 (28.19%), Postives = 110/227 (48.46%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQ--------SNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K +V     F P+PVET    +P  ++   +K AE+ H+ WA +KI   WTYG+  D+  KTHP L  ++     +++       E+++ ++A  +T+      E      +K      Q        S GY PQP+DL+ ++LS  L+++  QLAEN HN W   +  +      ++       P LVPY+ +    K  +R+ + + +K L    Y++
Sbjct: 2741 YSSMTEKKASVDAEGNFDPKPVETTNTIIPERLDAFINKYAEHTHDKWAFEKIQNNWTYGEVLDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWTLEKARDGETEVKTEVKATRKISQTAQATYDPSQGYSPQPVDLIGMALSRELQSMAEQLAENYHNTWGRKKKME------LQAKGGGTHPLLVPYDTLTAKEKARDREKAQDLLKFLQLNGYAV 2961          

HSP 8 Score: 70.0922 bits (170), Expect = 1.000e-10
Identity = 50/186 (26.88%), Postives = 90/186 (48.39%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  +G  + ++L+ +       FE L H  ++FD  L    +  I A+   I  +         T K  +   + N + P+P++  N  +   L+  +N+ AE+TH+ WA ++I+  W+YG V +   K  P L PY+   +  K+  R    E++K +LA+ +++E
Sbjct: 2664 KLLTNHYERCWKYYCLPNGWANFGVTSEEELHLSRKLFWGIFESLAH--KKFDAELFKIAMPCICAIAGAIPPDYVDASYSSMTEKKASVDAEGN-FDPKPVETTNTIIPERLDAFINKYAEHTHDKWAFEKIQNNWTYGEVLDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWTLE 2846          

HSP 9 Score: 64.3142 bits (155), Expect = 5.647e-9
Identity = 27/100 (27.00%), Postives = 59/100 (59.00%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHG 9379
            +KP P+D +H++L  +   L+++ A++ H+ WA + V +G+ Y + ++ +NK +P L+ ++LL +  +    + V  A++ +I +G+ I+        HG
Sbjct:  965 YKPAPLDLNHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQDIVNKRNPRLVPYNLLDERTKKTNRDSVNNAVRTLIGYGYNIEPPDQESSGHG 1064          
BLAST of Ryanodine receptor related vs. Ensembl Zebrafish
Match: ryr2b (ryanodine receptor 2b (cardiac) [Source:ZFIN;Acc:ZDB-GENE-061226-3])

HSP 1 Score: 1324.69 bits (3427), Expect = 0.000e+0
Identity = 838/2067 (40.54%), Postives = 1190/2067 (57.57%), Query Frame = 2
Query: 7985 EDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTA-SILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDG----------YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAI-----VTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV---------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSL-NYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLE-SHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAP--HVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSRE-EPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDIVVGVF 14074
            EDD D + +G AI+TFYS L+DLLGRCAPE    +  K  ++R+RAIL+SLV  EDLEG++++ F LP       VN D      D + M     P+HKA++VLFL+RVYG+QD +  LRLL+  FLTD++AA  +D    G +D ALA+NRYL  +VLPLL+K+S  L E   +    ++  L   Y LS+   LTK QRE + D L+A+  +L+P M+  LLR L+ DVP L   S +PL+LLT  Y++   YY  S G    G A+EEE  LT +LF GIF  LAK  YD +LF  AL CL+A+  A+ PD                 H   S TG           E    +D E           F PQP+DT ++ +P SLE +++++A+H H+ W++E    G+V+G   ++ +K HP L  +  LS+ D+  Y   + E +K M+  GWTI    +  E HG       I+            ++P P D   V +T +   MAE+LAEN H+IWA  K  +++S GGG H +LVP++ L+ K+KSR R    ++LK+   NGY                            S+ R+        P             +RFAY L+ + LR  E+A      + V Q R     +  +P  Q+   I FF KV+LPL+++YF  H  YF+         G QS +  +EK+M  +LFCKL SL R++++  G+D    V CLQ L Q++D R ++K +S S   VR  +  FF   A+DL L+++N+T++  +  +   +RG   L  Y    L+PVL ++F H S+  +G  L++ +VQ  CY+IL++LY LGT S  + +R+         R +LGEC+AA++  FPV FLE S L+ +      ++      +E +       K LPNL     E+ +LA +G     A    V EVTLP+LCSY+  W       +   A++E      ++VT +  N +LG +L +I  ++ +  + WM R+A+  QPI+  A  ++L  HFLP+ EKL+  A     EEE  + E +            + ++  +LV++++AFYPLLI ++DLHR +W+++   D + LF++VAE+F+ W+KS +FK EEQNFV QNEI++++ ++    +++KS  ++        +K   +  + S++TSL VA  K+LL + ++     +Q L+  AK R  +      RDT   +   I      D+     N++D                                   + ++R+L +A+VL  L  V+HP  + +  W K++S QRKRAV+AC RM PL++LPRHR VNLFL  Y  +WL  E +    RLIE++ ++                  VEI+ +G E R                  + DPL QLI    + A+ Q S   +D LY+ YA IM+KSC  E++ D+D        KS +E+EMEK ++L +Q RL DRGAAEM+L ++   RG +  +V  +++LGI++L GGNTSVQ +ML +L+ KK +GFF S++GLMQ CSVLDL+ FER  KAE L  G   D  G   + D + TC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR  ESI DFYW+Y+GKD ID  G+ N  KAI + KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+  M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS+NVEMILKFFD+FL++KD+TSSEAF  +D +  G IS K+F+ AME  K Y+  EIE+++ C +      +D+ +F  RFH+PAK+IGFN+AVLLTNL EHMPNDARL+  +  A  +++ F P+LGRIEI G   RIERVYFEI +S   QWEKPQ+K+SKR F+  VVN+GG+KEK+E FVNFCEDTI+EMQ + +ISG   G  L      ++        L      +   +T  LN  +V++  K +R +S+K I+  +F
Sbjct: 2364 EDDHDVIHMGHAIMTFYSALIDLLGRCAPETHLIEAGKGEAIRIRAILRSLVPREDLEGIINIPFSLP------VVNSDDLVVEPDMSRM---FCPDHKAAMVLFLDRVYGVQDQQFVLRLLKFGFLTDLKAAVNMDTTGLGGTDMALAINRYLCVAVLPLLSKYSSLLCESSSSRSGPVDELLQGVYSLSKASGLTKAQREAIQDCLLAVCGKLKPSMVQPLLRNLVFDVPQLPENSKMPLKLLTNHYEQSRKYYCRSYGFGDFGSASEEELCLTRRLFWGIFSALAKKSYDADLFKLALGCLSAVAAAIPPD-----------------HLDLSCTGGR---------ERHSVMDSERG---------FCPQPLDTLNVTIPESLEFVVNKYAEHTHEKWSMEKFGNGWVHGEQLSESSKVHPLLKPYRALSEKDKECYRGVIKETVKCMLVLGWTIKRT-NEGESHGIHNPARRISQSGKLSFEGASTFSPKPVDTSSVTLTWDQYAMAERLAENYHHIWAARKLQELESKGGGSHPLLVPYDALSVKDKSRVRDKAQDVLKFFHVNGY----------------------------SVKRNREVADADSPAI----------ASRFAYGLIQQALRLTERAQESVIELEVAQARGQINKAERVPHEQQ---IHFFIKVLLPLLDQYFKNHHLYFMSTTMSSLRDGCQSTS--KEKEMVTSLFCKLGSLARRRISIFGNDALALVNCLQILAQSLDGRMLMKTTSES---VRGSIGSFFEAAAEDLELMVENVTLDGLNRAQ---KRGDPELITYTTTALIPVLSAIFQHDSQRQSGAGLILDEVQSCCYRILSSLYILGTCSGSFIERQ---------RSVLGECLAALSAAFPVCFLELSDLHSH------FDTLSNEGIEEKAC-----KLLPNLHEAFLEVEELAGAGSSARHALLLRVTEVTLPLLCSYVSRW-----GEVDNQASQE---GHCSSVTPQHANALLGYILSIIHAHLGTSDSAWMKRLAVFGQPIINKAEPHLLKSHFLPLMEKLRKRAESVLLEEEHLKMEGRGDVSEQELD---IQERFTVLVQDIYAFYPLLIPFIDLHRMSWLREVNADAEKLFSLVAEVFIFWAKSHNFKWEEQNFVVQNEINNMAFLV----NSSKSRMNKGGVFCQERRKVKRKADRYSTHTSLIVAAPKKLLSVAMNGCCHGDQGLVSHAKSRFAQ------RDTEDEVRAYIHSILQQDL---CGNSVD----------------------------------PLRVERILSIARVLFHLDQVEHPQKMKRPVWYKMLSKQRKRAVVACLRMAPLYNLPRHRAVNLFLQGYERVWLKAENDSPEDRLIEDLAKAAH----------------VEILKEGAEQR-----------------NSIDPLHQLINLFSQCALTQRSKLEEDGLYMCYAEIMAKSCQSEEEQDEDGL------KSFEEKEMEKQRLLYQQARLHDRGAAEMILQKLSASRGDMGPMVAATLKLGIAILNGGNTSVQQKMLGYLRRKKDVGFFHSLAGLMQSCSVLDLNAFERQIKAESLGVGA-EDNSGEKVMADEQLTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLR--ESISDFYWYYSGKDVIDERGQHNFSKAITVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSRDSSQIELLKALMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSSNVEMILKFFDMFLKLKDLTSSEAFHEYDPDSKGLISKKDFQRAMEVFKRYSQSEIEFLLSCAEMAESELLDYPDFVTRFHEPAKEIGFNMAVLLTNLSEHMPNDARLQNFLELADSVLKYFHPHLGRIEILGSGKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNKGGEKEKMELFVNFCEDTIFEMQLAAQISGTESGEELKAKKGKEEKEVEKTETL-----PEDKRMTRDLNCFSVRNIRKHIRRISMKSIISVIF 4211          

HSP 2 Score: 1088.17 bits (2813), Expect = 0.000e+0
Identity = 597/1330 (44.89%), Postives = 823/1330 (61.88%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVGHG-SSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYD-TNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSS-SADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSV---IASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRC--LEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKEN----------VVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQK---SEMEFLRLGLPIKCKDHF 4033
            E+EI FLRT D + L     G    + CL+A GFG R CFLE+ S   N P DL +CVF+LD  LSVRALQE++A   D   A    +G +TLLYG AVL +H  S+M+L CLSTS  S+DKLAFDVGLQE+   E CWWTVHPA+KQRSEGEKVR+GDDLILVSVSSERYLH++  NGE     V    A+FQQTLW+V PVSSG +  +  G V GGD +RL HG  DECLT+  +    + QH SV +E G VS  ARSLWRLE +   WSG  I WG   RLRH+T+G +L +      +  V R +A    TAF  R SK+  +S       D MG+ +IK+G++  F+QHV +  WL+Y+     KR    V ++QAV+  EGHMDDG T+++ Q EESK+A  IR    +F++FI  LD+     Q+ +++  NL   I C  L+DL+ +F  P M ++H+I+Q  + AL+NRQ+LFQ+EGII L+L  ID     +     F +A+G++  E ++ + N  Y LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALN+I + HI+ +I LLDK GR+ ++L VLCSLC+   G AVR NQ LI D LLP+RDLLLQTRL++  SSVRPN+F+   + SA Y+KWYYE+ ++  E  VT     LRVGW++ EG+ P P G   WGS  VGDDL S+GFDG  LWTGG  +R+ +   Q +L   D+I C LDL+   I F +N +PV+G   +F +DG+ +P VS SA V VRM+FGG  G  R+ PP G+S   EALLPK R +LE C         +   ++ET+ +          V F P PV++++++ P  +E IR++LAEN+HE+W + KI+QGWTYG  +D+  K H CL  F +LP  ER   +  + + LRT++A G  I          +K ++L N +   NGY+P P+D   + L+   E LV  LAEN HNIWA +RI+QGWSYG  ++   KRS  LVP+  +D+  K++ R    + + TLL + Y++E  P +  E A S+S   +K  G+   R FR +  + V SGKWY+E E +T G MR GW     +   ++GS+ Q++ FD      W+  +   G   + GDVIGC+LDL   T+  +LNGE +++  G E A K++    G++P  S G  Q  +LN G  + +LKYF  CGLQEGY PF +NMS+ +PLW S  +P LF+ I   +  ++V    G+V   P LK+  ++FG ++     + F RL +PI+C   F
Sbjct:    7 EDEIQFLRTRDELVLRCCSSGPHQQKLCLAAEGFGERLCFLESTSNSKNVPADLCVCVFVLDHCLSVRALQEMLANREDLCTASHEAAGRRTLLYGQAVLFRHAYSDMYLCCLSTSGLSSDKLAFDVGLQEDTKGEVCWWTVHPASKQRSEGEKVRVGDDLILVSVSSERYLHVSWTNGEGNDSGVGRVDAAFQQTLWSVAPVSSGTVNTQ--GHVRGGDTVRLLHGHTDECLTI-RAAKHKADQHRSVHFEGGLVSLQARSLWRLETLHVVWSGSHIHWGQPFRLRHLTTGSFLGLIHDQG-LQLVERDRADVKCTAFAFRASKEIAESLDYVKRRDGMGAPEIKYGDSLCFIQHVDTGLWLTYQT-TDSKRQKESVSQRQAVLQAEGHMDDGITLSRSQREESKAACLIRSSVLLFSQFISGLDDVT---QKENITNFNLPIEIICVTLQDLLGYFHCPEMGQDHKIRQGDIGALKNRQNLFQDEGIILLVLDCIDHLH-VYNSAAHFAEAVGKEAGECWEGVLNAFYKLLAALIRGNRNNCAQFS--GSLDWLVSRLERLEASSGILEVLHCVLVESPEALNVIKESHIKTIISLLDKHGRNHKILDVLCSLCVC-HGMAVRSNQHLICDTLLPERDLLLQTRLINQVSSVRPNIFLCTRDDSAQYKKWYYEVVVEKAEPFVTAEPTHLRVGWASTEGYRPSPTGGHDWGSNGVGDDLCSYGFDGLQLWTGGVGRRVSSP-NQHLLREDDVISCCLDLSATCISFRVNGQPVQGMLENFCVDGLLFPVVSFSAGVQVRMLFGGRQGEFRFLPPAGFSPCAEALLPKTRCKLELC-------HELTRNHTETQRDLLGPVVPISPVTFTPVPVDSSQVEYPPQLEQIRERLAENLHELWLIDKIEQGWTYGPVKDEGKKVHLCLVEFSKLPDQERIHTLQSSEDILRTLLAFGVHIGLSDEHAEENVKYVRLSNKYELWNGYKPAPVDQSRVVLTDAQEELVEYLAENEHNIWARERIRQGWSYGPQQDVKFKRSTQLVPFYLLDERYKQAGRDAMRDALGTLLGFGYTVE--PLE-KEHASSSS---VKSVGAERFRIFRLEQLFAVHSGKWYFEFEAVTDGEMRVGWARPGCKPDVDLGSDDQAFVFDGSKGQWWHGGAERLGGCWKRGDVIGCLLDLTTDTMMITLNGEQLLNSHGSEFAVKDLIKSDGFLPVCSIGINQVGRLNLGCQIESLKYFNVCGLQEGYQPFGLNMSKDLPLWMSWREP-LFIPIQDNHPNIQVVRIEGTVNNTPCLKVTKRVFGHEERGSGSVGFYRLSMPIECAQVF 1309          

HSP 3 Score: 579.326 bits (1492), Expect = 1.520e-164
Identity = 390/1119 (34.85%), Postives = 561/1119 (50.13%), Query Frame = 2
Query: 4481 ENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNL-------ISDDVTLKML-GENGEDIFPKLDM-CPEINYERLKNISLKELANAVNK-GAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRS-------------------------ILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLD------------INELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNAL-GEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG-----------SSTAITRADPGTTAKEST 7654
            EN LV     YY+SV +   Q+   +++GWVTS F            + SFD         LD          ++W   H              SV  S  Y++  A+             + S G+ IGC +D ATG LTF  N +E+   +QV P T L+PA+F K T+     FELG  +N +P+ AG+ R  RR A P    RL +Q L  + W+RV +    + + +L E  GW        Q+M ++IPEE RC+DILEL E   LL+FH  TL LY  +  +GN +V+ +L +H+D++Q  + +Q   + G LRT +++LLI +HL++H+  +    +E +VP+           +S   Y +++K   F              P    S S++P +       I  +  + ++ G+ G  ++  L    PEI  + LK + +  L  AV   G  + +P GGS E + VPLL ++  LL+MG+    D+  + S++        P   M    R+                         +L M L E+VKLQ+C LL  LCD Q+RHR+E ++  S DFV ++Q DQ  RY E+  + ++ +++TA+ TKEFR PP++Q+  +L+F   S  C         C E+++  +  FH+ LM +CGIE   G +            ++ L+++    KR  S        G PEE  S P  LQ                              Q+I  T++ WA+   IE+ DL+R +FSLL +QY  L G++   L+K Y IS  S +D   L  +L  +R LL  ++G+ EE  +   L DIMNNKVF+QHPNL R L +HETVM++MV+ L          R S ++ F                                            +MV  CCRFLCYFCR S QNQK MF+HLSY+L+N ++ LA PS+RG+ PLDVA +S+MDNNELAL++ E  LEKV  YL   G++S   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENA +VVRLLIRRPEC GPALRG            +  I+    GTTA  S+
Sbjct: 1402 ENRLVRCT-TYYYSVRIPFSQEPSCVWVGWVTSKFS---------HHDVSFD---------LDRICTVTVTLGDEWGKVH-------------ESVKRSSCYMVCAAE------GSSLSHSRSSNGLEIGCLVDTATGLLTFTANGKEITTYYQVEPGTKLFPAVFAKATSSNVFQFELGCIKNVMPLSAGVFRSERRNANPQCPPRLCVQHLTHTRWTRVPDHTQSVEMSRLEERYGWRAQCSHIQQIMTLYIPEESRCVDILELSESHDLLKFHNHTLLLYSALSAHGNTHVSHALCSHVDQSQLLFALQCSRMPGHLRTSYYNLLINIHLDAHASARQTMNHEYIVPM--------TNTQSITLYKSNEKVERF--------------PGSDRSTSLWPKMHFTSPCFIRSNNKIDLVDGDEGRVLWSSLRQDSPEIPLDVLKAVVIAMLKEAVMVVGQGVRDPTGGSVELLLVPLLNLIHTLLLMGVYQGADLEAVFSLI-------LPGEYMRATQRTEETDELGESDGGAEEKEKGDWKYDVLLQMKLPEAVKLQVCQLLKYLCDCQVRHRVEAVISFSGDFVGHLQEDQRFRYNEVVDALNMSAALTARKTKEFRSPPQEQINMMLSFREDSQECP--------CPEDIQDLMWEFHQDLMSHCGIEIESGSENENEDDLSIRNHLHGLVDKIMHLKRRMS--------GLPEEIASKPVSLQ------------------------------QLISETMLHWAQEETIEDPDLVRAVFSLLHQQYAGLHGQMSAPLQKAYCISQTSVEDTLHLQWALACIRSLLKARMGKEEEECMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVL--------GARESKEIIF-------------------------------------------PKMVAHCCRFLCYFCRISRQNQKAMFDHLSYLLDNGNVGLASPSMRGSTPLDVAAASVMDNNELALSLTEADLEKVVQYLGGCGLRSCALLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENAYVVVRLLIRRPECFGPALRGEGANGLLATMEEAIRISNQQDGTTAHSSS 2356          

HSP 4 Score: 559.296 bits (1440), Expect = 1.626e-158
Identity = 277/466 (59.44%), Postives = 358/466 (76.82%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKM--NSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKK---------MIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK-DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            T +++ FA+N YN ++ AL LAF INF+LLFY+V    + D E    + +     E +  L ++  YM ++   LA LH+  +L  +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD++V++TPS+P NYWDKFVK+KV  KY E Y    +  LLG+++ +    S    RK+         +   D++Y +WK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD +E YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG EYFD +PHGFE H  +EHN ANY++FLM++INK  TE+TGQE+YVW+++Q+RCW+FFPVGDCFRKQYE++L
Sbjct: 4413 TKLLNCFARNFYNMRLLALFLAFAINFILLFYKV-SSTTDDVEIAFHDESTKSSQEVYFELEENSGYMKMILHCLAVLHTIISLCCIIGYYCLKVPLVIFKREKELARKLEFDGLYITEQPSEDDIKGQWDRMVINTPSYPSNYWDKFVKRKVMAKYGELYGSARVSELLGLDKAALDFSSGAQERKRPMQKGILFRLNTTDVKYHMWKLGVVFTDNSFLYLAWYMFVSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGEPMDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEFEFYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNEYFDTVPHGFESHTLQEHNLANYLFFLMYLINKDVTEHTGQESYVWKMFQERCWEFFPVGDCFRKQYEDQL 4877          

HSP 5 Score: 103.219 bits (256), Expect = 1.174e-20
Identity = 65/249 (26.10%), Postives = 125/249 (50.20%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINY--EMPSEGSRLKTIKLPN----SFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI----ETPPTDVSEMAVSNSFNILKRKGSSAIR-TFRAQST 3382
            F P+P++T  + +P  +E + +K AE+ HE W+M+K   GW +G+   + +K HP L  +  L   +++    +  ET++ ++ LG+TI    E  S G      ++      SF  ++ + P+P+D  +++L+     +  +LAEN H+IWA  ++++      +E+      P LVPY+ +    K   R  + + +K      YS+    E    D   +A   ++ ++++    A+R T RAQ +
Sbjct: 2690 FCPQPLDTLNVTIPESLEFVVNKYAEHTHEKWSMEKFGNGWVHGEQLSESSKVHPLLKPYRALSEKDKECYRGVIKETVKCMLVLGWTIKRTNEGESHGIHNPARRISQSGKLSFEGASTFSPKPVDTSSVTLTWDQYAMAERLAENYHHIWAARKLQE------LESKGGGSHPLLVPYDALSVKDKSRVRDKAQDVLKFFHVNGYSVKRNREVADADSPAIASRFAYGLIQQ----ALRLTERAQES 2928          

HSP 6 Score: 90.8929 bits (224), Expect = 6.616e-17
Identity = 58/201 (28.86%), Postives = 99/201 (49.25%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPT---IINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGG------GVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVD+S +  P  LE + ++ A++LH+ W ++ +E+G+ YG  +++  K H  L+ F  L   +++  ++   + L+ ++A+G  I       E + +  R +    + +GY P P D   V +T    ++ E LAEN HNIWA+ +     S G            LVPF +L ++ K   R    + L  L   GY
Sbjct:  856 FTPVPVDSSQVEYPPQLEQIRERLAENLHELWLIDKIEQGWTYGPVKDEGKKVHLCLVEFSKLPDQERIHTLQSSEDILRTLLAFGVHIGLSDEHAEENVKYVRLSNKYELWNGYKPAPVDQSRVVLTDAQEELVEYLAENEHNIWARERIRQGWSYGPQQDVKFKRSTQLVPFYLLDERYKQAGRDAMRDALGTLLGFGY 1056          

HSP 7 Score: 73.1738 bits (178), Expect = 1.191e-11
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 2
Query: 3008 GYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTW 3385
            G+ PQPLD LN+++   LE +VN+ AE+TH  W+M++   GW +G   + + K  P L PY  + +  K+  R    ETVK +L   ++I+      +E       N  +R   S   +F   ST+
Sbjct: 2689 GFCPQPLDTLNVTIPESLEFVVNKYAEHTHEKWSMEKFGNGWVHGEQLSESSKVHPLLKPYRALSEKDKECYRGVIKETVKCMLVLGWTIKR----TNEGESHGIHNPARRISQSGKLSFEGASTF 2810          

HSP 8 Score: 54.6842 bits (130), Expect = 4.827e-6
Identity = 26/92 (28.26%), Postives = 53/92 (57.61%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP PVD S + L ++ E L++  A++ H+ WA E + +G+ YG  ++   K    L+ F LL +  +    + + +AL  ++ +G+T++
Sbjct:  968 NGYKPAPVDQSRVVLTDAQEELVEYLAENEHNIWARERIRQGWSYGPQQDVKFKRSTQLVPFYLLDERYKQAGRDAMRDALGTLLGFGYTVE 1059          
BLAST of Ryanodine receptor related vs. Ensembl Zebrafish
Match: ryr2b (ryanodine receptor 2b (cardiac) [Source:ZFIN;Acc:ZDB-GENE-061226-3])

HSP 1 Score: 1282.32 bits (3317), Expect = 0.000e+0
Identity = 815/2063 (39.51%), Postives = 1160/2063 (56.23%), Query Frame = 2
Query: 7985 EDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTA-SILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDG----------YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAI-----VTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV---------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSL-NYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAP--HVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSRE-EPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDIVVGVF 14074
            EDD D + +G AI+TFYS L+DLLGRCAPE    +  K  ++R+RAIL+SLV  EDLEG++++ F LP       VN D      D + M     P+HKA++VLFL+RVYG+QD +  LRLL+  FLTD++AA  +D    G +D ALA+NRYL  +VLPLL+K+S  L E   +    ++  L   Y LS+   LTK QRE + D L+A+  +L+P M+  LLR L+ DVP L   S +PL+LLT  Y++   YY  S G    G A+EEE  LT +LF GIF  LAK  YD +LF  AL CL+A+  A+ PD                 H   S TG           E    +D E           F PQP+DT ++ +P SLE +++++A+H H+ W++E    G+V+G   ++ +K HP L  +  LS+ D+  Y   + E +K M+  GWTI    +  E HG       I+            ++P P D   V +T +   MAE+LAEN H+IWA  K  +++S GGG H +LVP++ L+ K+KSR R    ++LK+   NGY                            S+ R+        P             +RFAY L+ + LR  E+A      + V Q R     +  +P  Q+   I FF KV+LPL+++YF  H  YF+         G QS +  +E  +  T++  L S+       LG+D    V CLQ L Q++D R ++K +S S   VR  +  FF   A+DL L+++N+T++  +  +   +RG   L  Y    L+PVL ++F H S+  +G  L++ +VQ  CY+IL++LY LGT S  + +R+         R +LGEC+AA++  FPV FLE           L +    +   + E +G+    LPNL     E+ +LA +G     A    V EVTLP+LCSY+  W       +   A++E      ++VT +  N +LG +L +I  ++ +  + WM R+A+  QPI+  A  ++L  HFLP+ EKL+  A     EEE  + E +            + ++  +LV++++AFYPLLI ++DLHR +W+++   D + LF++VAE+F+ W+KS +FK EEQNFV QNEI++++ ++      N S+         + +K      + S++TSL VA  K+LL + ++     +Q L+  AK R                    Q++ + ++  Y+ +             I Q+V            S ++    + ++R+L +A+VL  L  V+HP  + +  W K++S QRKRAV+AC RM PL++LPRHR VNLFL  Y  +WL  E +    RLIE++ ++                  VEI+ +G E R                  + DPL QLI    + A+                                    T+   E+EMEK ++L +Q RL DRGAAEM+L ++   RG +  +V  +++LGI++L GGNTSVQ +ML +L+ KK +GFF S++GLMQ CSVLDL+ FER  KAE L  G   D  G   + D + TC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI + KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+  M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS+NVEMILKFFD+FL++KD+TSSEAF  +D +  G IS K+F+ AME  K Y+  EIE+++ C +      +D+ +F  RFH+PAK+IGFN+AVLLTNL EHMPNDARL+  +  A  +++ F P+LGRIEI G   RIERVYFEI +S   QWEKPQ+K+SKR F+  VVN+GG+KEK+E FVNFCEDTI+EMQ + +ISG   G  L      ++        L      +   +T  LN  +V++  K +R +S+K I+  +F
Sbjct: 2356 EDDHDVIHMGHAIMTFYSALIDLLGRCAPETHLIEAGKGEAIRIRAILRSLVPREDLEGIINIPFSLP------VVNSDDLVVEPDMSRM---FCPDHKAAMVLFLDRVYGVQDQQFVLRLLKFGFLTDLKAAVNMDTTGLGGTDMALAINRYLCVAVLPLLSKYSSLLCESSSSRSGPVDELLQGVYSLSKASGLTKAQREAIQDCLLAVCGKLKPSMVQPLLRNLVFDVPQLPENSKMPLKLLTNHYEQSRKYYCRSYGFGDFGSASEEELCLTRRLFWGIFSALAKKSYDADLFKLALGCLSAVAAAIPPD-----------------HLDLSCTGGR---------ERHSVMDSERG---------FCPQPLDTLNVTIPESLEFVVNKYAEHTHEKWSMEKFGNGWVHGEQLSESSKVHPLLKPYRALSEKDKECYRGVIKETVKCMLVLGWTIKRT-NEGESHGIHNPARRISQSGKLSFEGASTFSPKPVDTSSVTLTWDQYAMAERLAENYHHIWAARKLQELESKGGGSHPLLVPYDALSVKDKSRVRDKAQDVLKFFHVNGY----------------------------SVKRNREVADADSPAI----------ASRFAYGLIQQALRLTERAQESVIELEVAQARGQINKAERVPHEQQ---IHFFIKVLLPLLDQYFKNHHLYFMSTTMSSLRDGCQSTSKEKEMLVLLTVWIALSSM---PCFLLGNDALALVNCLQILAQSLDGRMLMKTTSES---VRGSIGSFFEAAAEDLELMVENVTLDGLNRAQ---KRGDPELITYTTTALIPVLSAIFQHDSQRQSGAGLILDEVQSCCYRILSSLYILGTCSGSFIERQ---------RSVLGECLAALSAAFPVCFLE-----------LSDLHSHFDTLSNEGIGKKSSLLPNLHEAFLEVEELAGAGSSARHALLLRVTEVTLPLLCSYVSRW-----GEVDNQASQE---GHCSSVTPQHANALLGYILSIIHAHLGTSDSAWMKRLAVFGQPIINKAEPHLLKSHFLPLMEKLRKRAESVLLEEEHLKMEGRGDVSEQELD---IQERFTVLVQDIYAFYPLLIPFIDLHRMSWLREVNADAEKLFSLVAEVFIFWAKSHNFKWEEQNFVVQNEINNMAFLV------NSSKRVFCQERRKVKRK----ADRYSTHTSLIVAAPKKLLSVAMNGCCHGDQGLVSHAKSRFA------------------QRDTEDEVRAYIHS-------------ILQQV------------SQQAALDPLRVERILSIARVLFHLDQVEHPQKMKRPVWYKMLSKQRKRAVVACLRMAPLYNLPRHRAVNLFLQGYERVWLKAENDSPEDRLIEDLAKAAH----------------VEILKEGAEQR-----------------NSIDPLHQLINLFSQCAL------------------------------------TQRRFEKEMEKQRLLYQQARLHDRGAAEMILQKLSASRGDMGPMVAATLKLGIAILNGGNTSVQQKMLGYLRRKKDVGFFHSLAGLMQSCSVLDLNAFERQIKAESLGVGA-EDNSGEKVMADEQLTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDERGQHNFSKAITVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSRDSSQIELLKALMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSSNVEMILKFFDMFLKLKDLTSSEAFHEYDPDSKGLISKKDFQRAMEVFKRYSQSEIEFLLSCAEMAESELLDYPDFVTRFHEPAKEIGFNMAVLLTNLSEHMPNDARLQNFLELADSVLKYFHPHLGRIEILGSGKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNKGGEKEKMELFVNFCEDTIFEMQLAAQISGTESGEELKAKKGKEEKEVEKTETL-----PEDKRMTRDLNCFSVRNIRKHIRRISMKSIISVIF 4164          

HSP 2 Score: 1084.71 bits (2804), Expect = 0.000e+0
Identity = 596/1330 (44.81%), Postives = 823/1330 (61.88%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVGHG-SSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYD-TNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSS-SADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSV---IASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRC--LEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKEN----------VVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQK---SEMEFLRLGLPIKCKDHF 4033
            E+EI FLRT D + L     G    + CL+A GFG R CFLE+ S   N P DL +CVF+LD  LSVRALQE++A   D   A    +G +TLLYG AVL +H  S+M+L CLSTS  S+DKLAFDVGLQE+   E CWWTVHPA+KQRSEGEKVR+GDDLILVSVSSERYLH++  NGE     V    A+FQQTLW+V PVSSG +  +  G V GGD +RL HG  DECLT+  +    + QH SV +E G VS  ARSLWRLE +   WSG  I WG   RLRH+T+G +L +      +  V R +A    TAF  R SK  +   + +   D MG+ +IK+G++  F+QHV +  WL+Y+     KR    V ++QAV+  EGHMDDG T+++ Q EESK+A  IR    +F++FI  LD+     Q+ +++  NL   I C  L+DL+ +F  P M ++H+I+Q  + AL+NRQ+LFQ+EGII L+L  ID     +     F +A+G++  E ++ + N  Y LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALN+I + HI+ +I LLDK GR+ ++L VLCSLC+   G AVR NQ LI D LLP+RDLLLQTRL++  SSVRPN+F+   + SA Y+KWYYE+ ++  E  VT     LRVGW++ EG+ P P G   WGS  VGDDL S+GFDG  LWTGG  +R+ +   Q +L   D+I C LDL+   I F +N +PV+G   +F +DG+ +P VS SA V VRM+FGG  G  R+ PP G+S   EALLPK R +LE C         +   ++ET+ +          V F P PV++++++ P  +E IR++LAEN+HE+W + KI+QGWTYG  +D+  K H CL  F +LP  ER   +  + + LRT++A G  I          +K ++L N +   NGY+P P+D   + L+   E LV  LAEN HNIWA +RI+QGWSYG  ++   KRS  LVP+  +D+  K++ R    + + TLL + Y++E  P +  E A S+S   +K  G+   R FR +  + V SGKWY+E E +T G MR GW     +   ++GS+ Q++ FD      W+  +   G   + GDVIGC+LDL   T+  +LNGE +++  G E A K++    G++P  S G  Q  +LN G  + +LKYF  CGLQEGY PF +NMS+ +PLW S  +P LF+ I   +  ++V    G+V   P LK+  ++FG ++     + F RL +PI+C   F
Sbjct:    9 EDEIQFLRTRDELVLRCCSSGPHQQKLCLAAEGFGERLCFLESTSNSKNVPADLCVCVFVLDHCLSVRALQEMLANREDLCTASHEAAGRRTLLYGQAVLFRHAYSDMYLCCLSTSGLSSDKLAFDVGLQEDTKGEVCWWTVHPASKQRSEGEKVRVGDDLILVSVSSERYLHVSWTNGEGNDSGVGRVDAAFQQTLWSVAPVSSGTVNTQ--GHVRGGDTVRLLHGHTDECLTI-RAAKHKADQHRSVHFEGGLVSLQARSLWRLETLHVVWSGSHIHWGQPFRLRHLTTGSFLGLIHDQG-LQLVERDRADVKCTAFAFRASKIAESLDYVK-RRDGMGAPEIKYGDSLCFIQHVDTGLWLTYQT-TDSKRQKESVSQRQAVLQAEGHMDDGITLSRSQREESKAACLIRSSVLLFSQFISGLDDVT---QKENITNFNLPIEIICVTLQDLLGYFHCPEMGQDHKIRQGDIGALKNRQNLFQDEGIILLVLDCIDHLH-VYNSAAHFAEAVGKEAGECWEGVLNAFYKLLAALIRGNRNNCAQFS--GSLDWLVSRLERLEASSGILEVLHCVLVESPEALNVIKESHIKTIISLLDKHGRNHKILDVLCSLCVC-HGMAVRSNQHLICDTLLPERDLLLQTRLINQVSSVRPNIFLCTRDDSAQYKKWYYEVVVEKAEPFVTAEPTHLRVGWASTEGYRPSPTGGHDWGSNGVGDDLCSYGFDGLQLWTGGVGRRVSSP-NQHLLREDDVISCCLDLSATCISFRVNGQPVQGMLENFCVDGLLFPVVSFSAGVQVRMLFGGRQGEFRFLPPAGFSPCAEALLPKTRCKLELC-------HELTRNHTETQRDLLGPVVPISPVTFTPVPVDSSQVEYPPQLEQIRERLAENLHELWLIDKIEQGWTYGPVKDEGKKVHLCLVEFSKLPDQERIHTLQSSEDILRTLLAFGVHIGLSDEHAEENVKYVRLSNKYELWNGYKPAPVDQSRVVLTDAQEELVEYLAENEHNIWARERIRQGWSYGPQQDVKFKRSTQLVPFYLLDERYKQAGRDAMRDALGTLLGFGYTVE--PLE-KEHASSSS---VKSVGAERFRIFRLEQLFAVHSGKWYFEFEAVTDGEMRVGWARPGCKPDVDLGSDDQAFVFDGSKGQWWHGGAERLGGCWKRGDVIGCLLDLTTDTMMITLNGEQLLNSHGSEFAVKDLIKSDGFLPVCSIGINQVGRLNLGCQIESLKYFNVCGLQEGYQPFGLNMSKDLPLWMSWREP-LFIPIQDNHPNIQVVRIEGTVNNTPCLKVTKRVFGHEERGSGSVGFYRLSMPIECAQVF 1310          

HSP 3 Score: 575.089 bits (1481), Expect = 2.517e-163
Identity = 387/1109 (34.90%), Postives = 555/1109 (50.05%), Query Frame = 2
Query: 4481 ENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNL-------ISDDVTLKML-GENGEDIFPKLDMCPEINYERLKNISLKELANAVNK-GAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRS-------------------------ILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCG---IEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNAL-GEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG-----------SSTAITRADPGTTAKEST 7654
            EN LV     YY+SV +   Q+   +++GWVTS F            + SFD         LD          ++W   H              SV  S  Y++  A+             + S G+ IGC +D ATG LTF  N +E+   +QV P T L+PA+F K T+     FELG  +N +P+ AG+ R  RR A P    RL +Q L  + W+RV +    + + +L E  GW        Q+M ++IPEE RC+DILEL E   LL+FH  TL LY  +  +GN +V+ +L +H+D++Q  + +Q   + G LRT +++LLI +HL++H+  +    +E +VP+           +S   Y +++K   F              P    S S++P +       I  +  + ++ G+ G D        PEI  + LK + +  L  AV   G  + +P GGS E + VPLL ++  LL+MG+    D+  + S++        P   M    R+                         +L M L E+VKLQ+C LL  LCD Q+RHR+E ++  S DFV ++Q DQ  RY E+  + ++ +++TA+ TKEFR PP++Q+  +L+F   S  C         C E+++  +  FH+ LM +CG   I    G+  +  +         + +HL     G PEE  S P  LQ                              Q+I  T++ WA+   IE+ DL+R +FSLL +QY  L G++   L+K Y IS  S +D   L  +L  +R LL  ++G+ EE  +   L DIMNNKVF+QHPNL R L +HETVM++MV+ L          R S ++ F                                            +MV  CCRFLCYFCR S QNQK MF+HLSY+L+N ++ LA PS+RG+ PLDVA +S+MDNNELAL++ E  LEKV  YL   G++S   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENA +VVRLLIRRPEC GPALRG            +  I+    GTTA  S+
Sbjct: 1403 ENRLVRCT-TYYYSVRIPFSQEPSCVWVGWVTSKFS---------HHDVSFD---------LDRICTVTVTLGDEWGKVH-------------ESVKRSSCYMVCAAE------GSSLSHSRSSNGLEIGCLVDTATGLLTFTANGKEITTYYQVEPGTKLFPAVFAKATSSNVFQFELGCIKNVMPLSAGVFRSERRNANPQCPPRLCVQHLTHTRWTRVPDHTQSVEMSRLEERYGWRAQCSHIQQIMTLYIPEESRCVDILELSESHDLLKFHNHTLLLYSALSAHGNTHVSHALCSHVDQSQLLFALQCSRMPGHLRTSYYNLLINIHLDAHASARQTMNHEYIVPM--------TNTQSITLYKSNEKVERF--------------PGSDRSTSLWPKMHFTSPCFIRSNNKIDLVDGDEGRD-------SPEIPLDVLKAVVIAMLKEAVMVVGQGVRDPTGGSVELLLVPLLNLIHTLLLMGVYQGADLEAVFSLI-------LPGEYMRATQRTEETDELGESDGGAEEKEKGDWKYDVLLQMKLPEAVKLQVCQLLKYLCDCQVRHRVEAVISFSGDFVGHLQEDQRFRYNEVVDALNMSAALTARKTKEFRSPPQEQINMMLSFREDSQECP--------CPEDIQDLMWEFHQDLMSHCGRQTIRTIGGIIDDLSIRNHLHGLVDKIMHLKRRMSGLPEEIASKPVSLQ------------------------------QLISETMLHWAQEETIEDPDLVRAVFSLLHQQYAGLHGQMSAPLQKAYCISQTSVEDTLHLQWALACIRSLLKARMGKEEEECMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVL--------GARESKEIIF-------------------------------------------PKMVAHCCRFLCYFCRISRQNQKAMFDHLSYLLDNGNVGLASPSMRGSTPLDVAAASVMDNNELALSLTEADLEKVVQYLGGCGLRSCALLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENAYVVVRLLIRRPECFGPALRGEGANGLLATMEEAIRISNQQDGTTAHSSS 2348          

HSP 4 Score: 454.136 bits (1167), Expect = 9.077e-127
Identity = 244/459 (53.16%), Postives = 313/459 (68.19%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMI----AWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK-DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            T +++ FA+N YN ++ AL LAF INF+LLFY+V        +   S+     E +  L ++  YM ++   LA LH+  +L  +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD++V++TPS+P NYWDKFVK+KV  KY E Y    +  LLG+++ +    S    RK+ I      D++Y +WK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD +E YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG EYFD +PH  ++     H   N                                       CFRKQYE++L
Sbjct: 4353 TKLLNCFARNFYNMRLLALFLAFAINFILLFYKVTNVLGVAGDFTKSSQ----EVYFELEENSGYMKMILHCLAVLHTIISLCCIIGYYCLKVPLVIFKREKELARKLEFDGLYITEQPSEDDIKGQWDRMVINTPSYPSNYWDKFVKRKVMAKYGELYGSARVSELLGLDKAALDFSSGAQERKRPIFRLNTTDVKYHMWKLGVVFTDNSFLYLAWYMFVSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGEPMDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEFEFYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNEYFDTVPHVLQEIRGHPHELNN---------------------------------------CFRKQYEDQL 4768          

HSP 5 Score: 103.219 bits (256), Expect = 1.273e-20
Identity = 65/249 (26.10%), Postives = 125/249 (50.20%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINY--EMPSEGSRLKTIKLPN----SFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI----ETPPTDVSEMAVSNSFNILKRKGSSAIR-TFRAQST 3382
            F P+P++T  + +P  +E + +K AE+ HE W+M+K   GW +G+   + +K HP L  +  L   +++    +  ET++ ++ LG+TI    E  S G      ++      SF  ++ + P+P+D  +++L+     +  +LAEN H+IWA  ++++      +E+      P LVPY+ +    K   R  + + +K      YS+    E    D   +A   ++ ++++    A+R T RAQ +
Sbjct: 2682 FCPQPLDTLNVTIPESLEFVVNKYAEHTHEKWSMEKFGNGWVHGEQLSESSKVHPLLKPYRALSEKDKECYRGVIKETVKCMLVLGWTIKRTNEGESHGIHNPARRISQSGKLSFEGASTFSPKPVDTSSVTLTWDQYAMAERLAENYHHIWAARKLQE------LESKGGGSHPLLVPYDALSVKDKSRVRDKAQDVLKFFHVNGYSVKRNREVADADSPAIASRFAYGLIQQ----ALRLTERAQES 2920          

HSP 6 Score: 90.8929 bits (224), Expect = 6.770e-17
Identity = 58/201 (28.86%), Postives = 99/201 (49.25%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI---INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGG------GVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVD+S +  P  LE + ++ A++LH+ W ++ +E+G+ YG  +++  K H  L+ F  L   +++  ++   + L+ ++A+G  I       E + +  R +    + +GY P P D   V +T    ++ E LAEN HNIWA+ +     S G            LVPF +L ++ K   R    + L  L   GY
Sbjct:  857 FTPVPVDSSQVEYPPQLEQIRERLAENLHELWLIDKIEQGWTYGPVKDEGKKVHLCLVEFSKLPDQERIHTLQSSEDILRTLLAFGVHIGLSDEHAEENVKYVRLSNKYELWNGYKPAPVDQSRVVLTDAQEELVEYLAENEHNIWARERIRQGWSYGPQQDVKFKRSTQLVPFYLLDERYKQAGRDAMRDALGTLLGFGY 1057          

HSP 7 Score: 73.559 bits (179), Expect = 1.150e-11
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 2
Query: 3008 GYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTW 3385
            G+ PQPLD LN+++   LE +VN+ AE+TH  W+M++   GW +G   + + K  P L PY  + +  K+  R    ETVK +L   ++I+      +E       N  +R   S   +F   ST+
Sbjct: 2681 GFCPQPLDTLNVTIPESLEFVVNKYAEHTHEKWSMEKFGNGWVHGEQLSESSKVHPLLKPYRALSEKDKECYRGVIKETVKCMLVLGWTIKR----TNEGESHGIHNPARRISQSGKLSFEGASTF 2802          

HSP 8 Score: 54.6842 bits (130), Expect = 4.663e-6
Identity = 26/92 (28.26%), Postives = 53/92 (57.61%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP PVD S + L ++ E L++  A++ H+ WA E + +G+ YG  ++   K    L+ F LL +  +    + + +AL  ++ +G+T++
Sbjct:  969 NGYKPAPVDQSRVVLTDAQEELVEYLAENEHNIWARERIRQGWSYGPQQDVKFKRSTQLVPFYLLDERYKQAGRDAMRDALGTLLGFGYTVE 1060          
BLAST of Ryanodine receptor related vs. Ensembl Zebrafish
Match: RYR2 (ryanodine receptor 2a (cardiac) [Source:NCBI gene;Acc:100126126])

HSP 1 Score: 1158.67 bits (2996), Expect = 0.000e+0
Identity = 633/1320 (47.95%), Postives = 865/1320 (65.53%), Query Frame = 2
Query:  155 DDHVCL--SSVGHGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYD-----TNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSP-QHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSF----GNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGC----EIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFT 4036
            DD V L  S+  H    + CL+A GFG+R CFLE+ S   N PPDLS+C F+L+Q+LSVRALQE++A   +     + A GG  GH+TLLYGHAVLL+H+ S M+L CLST+ SS DKLAFDVGLQE+A  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  NG      V A+FQQTLW+V+P+ SG+  + + G + GGDVLRL HG  DECLTVP  +GEH   Q  +V YE GAVS HARSLWRLE ++  WSG  I WG   RLRHVT+G+YLS+      +  + + +A   STAF  R SK+ K       E D MG  DIK+G++  ++QHV +  WL+Y++    K       +++A++  EGHMDDG T+++ Q EES++A  IR    +F RFI+ LD    + + S+L  + +  V   L+DLI +F  P+   EHE KQ +L AL++RQ+LFQEEG+INL+L  ID+    +     F    G++  E +  + N LY LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  SS+RPN+F+GV E SA Y+KWYYE+ +D ++  VT     LRVGW++ +G+ P+PGG +GWG   VGDDL+S+GFDG +LW G   + + +   Q +L   D++ C LDL+ P I F IN +PV+G F +FN DG+F+P VS SA V VR + GG HG  ++ PP GY+  FEA+LP+E+LR+E    +    GN    +  G + T     F P PV+T++I LP ++E IR+KLAENIHE+W M KID GWTYG  RDD  + HPCL  F RLP  ER +++ ++ ETL+T++ALG  +         ++K +KL   +  S+GY+P P+DL +I L+S  E +V++LAEN HN+WA DRI+QGW+YG  ++   KR+P LVPY  +D+  KKSN+ +  E V+TLL Y Y++E P  D +   V N         +   R FRA+ T+ V  GKWY+E+E++T G MR GW       GC    E+G++ Q++ FD   A +W+  +  +G+  Q GDV+GCM+D+ ++T+ F+LNGE+++D  G E+AFK+     G++P  S G  Q  ++NFG DV TLKYFT CGLQEGY PF VNM+R + +W S+  P  F  +   +  +EV    G+V   P LK+  + FG Q S  ++ F RL +PI+C + F 
Sbjct:    1 DDEVVLQCSATLHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTEERAEGVSTAQGG--GHRTLLYGHAVLLRHSYSGMYLCCLSTARSSTDKLAFDVGLQEDATGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSL---HVDAAFQQTLWSVVPICSGS--EVAQGFLIGGDVLRLLHGHMDECLTVP--SGEHGEEQRRTVHYEGGAVSIHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSMMDDQG-LLLMDKEKADVKSTAFCFRSSKE-KLDFGLRKEMDGMGVPDIKYGDSVCYIQHVDAGLWLTYQS-VDAKCARMGGVQRKAIMHHEGHMDDGLTLSRSQHEESRTARVIRSTVFLFNRFIRGLDTLSKKGKTSTLD-LPIESVSLSLQDLIGYFQPPDEHLEHEDKQNRLRALKSRQNLFQEEGMINLVLECIDRLH-VYSSAAHFADVAGKEAGESWKSILNSLYELLAALIRGNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC-HGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELIVDHVDPFVTAEATHLRVGWASTQGYGPYPGGGEGWGGNGVGDDLYSYGFDGLHLWAGCVARSVSSP-NQHLLRAEDVVSCCLDLSAPSISFRINGQPVQGMFENFNSDGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPSGYAPCFEAVLPREKLRVEHSQEYKQDHGNTRDLL--GPTVTLSQAAFTPTPVDTSQIVLPPHLERIREKLAENIHELWVMNKIDLGWTYGAVRDDNKRQHPCLVEFSRLPEQERSYNLQMSQETLKTLLALGCHVGVADERAAEKVKNLKLSAKYELSSGYKPAPMDLCHIKLASTQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDIKNKRNPRLVPYVLLDERTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAREDVGN-------LSAERFRIFRAEKTYCVNGGKWYFELEVVTAGEMRVGWA----RPGCLPDQELGADEQAFVFDGFKAQRWHQGNEHFGRSWQSGDVVGCMVDMNERTMMFTLNGEVLLDDSGSELAFKDFEVWEGFIPVCSLGVSQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNMNRDLTMWISKRLP-QFTPVPLIHEHIEVTRIDGTVESPPCLKVTQRSFGSQNSHTDIMFYRLSMPIECSEAFA 1288          

HSP 2 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 412/1110 (37.12%), Postives = 579/1110 (52.16%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSK-------------------------PALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGS---------------STAITRADPGTTAKESTVIFSATHATEGTTENIGTS 7711
            YY+SV + PGQ+   +++GWVTS F               +DT            T GD K                    +  S+  S  Y++   +  +    + +       G+ IGC +D A G LTF  N +EL   +QV P T L+PA+F + T+     FELGR ++ +P+ AG+ +  R+   P    RL +Q L    WSRV N   +  + ++NE  GW + + E +Q M +HIPEE+R +DILEL E   LL+FH  TL LY  IC  GN+ VA +L +H+DE Q  Y IQN Y+ G LRT ++DLLI +HL S++  +L   +E +VP+           KS   + N +K               H +P    S S+ P +     +       G D F      PE   E LK+ +++ L  AV +G+  + +P+GGS E +FVPL+K+   LLIMG+  + D+  IL +++ + F                              LR       +L M L E VKLQ+CHLL  LCD Q+RHRIE +V  S+DFV+N+Q +Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF        +EK D   C E+++ ++  FH  LM +CGIE  +    +   +    T R R + L+          E +    + + +L             +  K  +   L Q+I  T++ WA+ + IE+ +L+R MF LL RQY+ +G    +L KTY I+  S +D   LL SLG++R LL V++G  EE L+ + L DIMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E+   K      MV  CCRFLCYFCR S QNQK MF+HLSY+LENSS+ LA PS+RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+  G+QS V L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENAN+VVRLLIRRPEC GPALRG                S   +R  P  T +ES  +       E  T ++G +
Sbjct: 1397 YYYSVRIFPGQEPSSVWVGWVTSDF-------------HQYDTAFEISNVRTVTVTLGDEKGK------------------VHESIKRSNCYMVWAGECTSPGQGRSN------NGLEIGCLVDTANGLLTFTSNGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKSIMPLSAGLFKSERKNVVPQCPPRLHVQFLTPVLWSRVPNQFLRSEVTRVNERLGWMVQSLEPLQFMTLHIPEENRSVDILELTEQQDLLKFHYHTLRLYSAICALGNNRVAHALCSHVDEAQLLYAIQNKYMPGLLRTGYYDLLIDIHLSSYATARLMMNSEYIVPMTPE-------TKSITLFPNEKKK--------------HGLPGIGLSTSLQPRMRFSSPSFV-----GVDCF---QYSPEFPLETLKSRTMEMLTEAVREGSLHVRDPVGGSTEFLFVPLIKLFYTLLIMGIFHNGDLKTILQLIEPSVFSQDSGADGGGGSVGDGCGRGQLEGGVVDDGLRGKMPKEGLLQMKLPEPVKLQMCHLLQYLCDCQVRHRIEAVVAFSDDFVANLQENQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNF-------KDEKQDCP-CPEDIREQLLDFHEDLMTHCGIETDDDKSGDGDSD---FTIRGRLMSLV----------EKVTYLKKKMTDL------------PKKKKSKKPSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGQVRALPKTYTINAVSVEDTISLLASLGQIRSLLSVRMGREEEKLMIHGLSDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEITFPK------MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVQYLAGCGLQSCVMLMSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAIEEAIKISEDPSRDGPSPTTEESRTLNDVMEEEEDDTIHMGNA 2356          

HSP 3 Score: 624.009 bits (1608), Expect = 3.253e-178
Identity = 371/981 (37.82%), Postives = 543/981 (55.35%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQ-GIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI----DADLSRIEMHGERRRPTIIND-------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSR-YSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYF-------VGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTG 10654
            GG GLL A++E I         K++++      +    + +TL  +  + ED                    D + +G AI+TFY+ L+DLLGRCAPE       K  ++R+RAIL+SL+ +EDL GV+S+ F++P      T+ +DG     D   M  G  P+HKA++VLFL+RVYGI+D    L LLE  FL D+RAA  LD  +   +D ALALNRYL  +VLPLLTK +      E  AS++++ LHT YRLS+   LTK QR+ + + L+A+  +L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY  +G  G  G A+EEE  L+ +LF GIFD LA+  YDPELF  ALPCL+A+G AL PDY                          +      ++E +  +D E          +F PQP DTS + +P  L+  ++++A++ H+ W++E    G+V+G    + +K HP L  +  LS+ D+  Y  P+ E+LK M++WGW+I    ++D S   +H   RR ++ +        G++P P D+  V +++++  MAE LAEN HNIWAQ KK +++S GGG H +LVP++ LT KEKS+ R+   ++LK+ Q NGY                            S+ R+  ++    P+             RFAY  L +L+ YV++A   + +     R     +P  Q+   IKFFGKVVLPLV++YF  H+ YF       +     A N+EK+M  +LFCKL  L+R +++  G+D    V CL  L Q +D R ++K   T +D V+  L  FF N A+DL   ++NL   +F+H +   +     +NY  + LLPVL S+F+H+ +   G DL++ DVQV+CY+ILN LY LGT  S Y +R+         RP +GEC+AA +  FPVAFLE  LNK+N YSI YNC G
Sbjct: 2306 GGNGLLAAIEEAI---------KISEDPSRDGPSPTTEESRTLNDVMEEEED--------------------DTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRAILRSLIPIEDLVGVISIPFLMP------TLAKDGSVIEPD---MSAGFCPDHKAAMVLFLDRVYGIEDQNFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTKCAPLFAGTEPFASLIDSLLHTVYRLSKGCCLTKAQRDAIEECLLAVCGKLRPSMMQHLLRRLVFDVPVLNEHTKMPLKLLTNHYERCWKYYCLSGGWGSFGAASEEELHLSRKLFWGIFDALARKKYDPELFKLALPCLSAVGGALPPDY--------------------------MESNYVAMMEKQSSMDAEG---------NFNPQPADTSSVVVPEKLDHFINKYAEYSHEKWSMEKFAVGWVHGEQMCESSKVHPLLKPYKCLSEKDKEVYRWPIRESLKTMLSWGWSIERMRESDAS--TLHNRTRRISLSSQRSIEGAHGFSPRPVDMSNVTLSRDLHSMAELLAENYHNIWAQKKKLELESKGGGSHPLLVPYDTLTAKEKSKDREKAQDILKFFQINGY----------------------------SVSRAMKEQDLDTPSIE----------KRFAYTFLQQLITYVDEAHGHMLEFDAGIRPKGEKIPHEQQ---IKFFGKVVLPLVDQYFKNHRLYFLSTAVRPISSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMK---TGQDSVKAALRAFFDNAAEDLEKTMENLRQGQFTHTRSQPKGVTQIINYTTVALLPVLSSLFEHIGQNLFGEDLILDDVQVSCYRILNNLYSLGTSKSIYVERQ---------RPAIGECLAAFSSAFPVAFLEPSLNKHNTYSI-YNCKG 3157          

HSP 4 Score: 595.89 bits (1535), Expect = 1.106e-169
Identity = 331/639 (51.80%), Postives = 421/639 (65.88%), Query Frame = 2
Query: 11987 HRGVNLFLTAYRSMWLSREEP-ITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGE 13891
            HR VNLFL  Y   W+  EE     +LIE++ +                       P  +EP E  E            T   DPL QLI    RTA+ +     +D LY++YA IM+K                       E+EMEK ++L +Q RL DRGAAEMVL  I   +G +  +V  +++LGI++L GGN++VQ +ML +LK+K+ +GFF S++GLMQ C  +     +                       D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI + KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+E M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS NVEMILKFFD+FL++KD+TSS+AF  +D +  G IS ++F  AME  K Y   E E+++ C +++ +  +D+ EF +RFH+PAKDIGFNVAVLLTNL EHMP+D+RL+  +  A+ ++  F+PYLGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG+KEK+E FVNFCEDTI+EMQ + R+S  GE
Sbjct: 3158 HRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAK-----------------------PGVEEPPEEDE-----------MTKNIDPLHQLIQLFSRTALTEKCKLEEDHLYMAYADIMAK-----------------VRPLYNEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGEMGPMVASTLKLGIAILNGGNSTVQQKMLDYLKDKRDVGFFQSLAGLMQSCRYISEKVMQ-----------------------DDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAINVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDAFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENELLDYEEFVERFHEPAKDIGFNVAVLLTNLSEHMPHDSRLQTFLELAESVLNYFQPYLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAARMSDAGE 3722          

HSP 5 Score: 258.07 bits (658), Expect = 2.071e-67
Identity = 147/254 (57.87%), Postives = 179/254 (70.47%), Query Frame = 2
Query: 15251 FLYLGLYFVTSLIGNFNYFFFACHLLDVAISF------KTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDG-VKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            F    L F+ SL    ++F     +L + +SF             QSV  +   LVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGD+IE P GD YE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD +PHGFE H  +EHN +     +             QE+YVW++YQ+RCW+FFP GDCFRKQYE++L
Sbjct: 4239 FFLSALPFLFSLSIFCSFFCSLLFVLSICLSFYLSYYSSVYLLFCQSVCLS---LVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGESPDMKCDDMLTCYMFHMYVGVRAGGGIGDQIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLSTLFLLVF------------QESYVWKMYQERCWEFFPAGDCFRKQYEDQL 4477          

HSP 6 Score: 128.642 bits (322), Expect = 2.171e-28
Identity = 64/158 (40.51%), Postives = 98/158 (62.03%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSS------------------DPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNY 15055
            +++ FA+N YN ++ AL +AF INF+LLFY+V    +                   DP   +S+ P  +    +L +S  YM    +ILA LH+  +   +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD+LV++T    +N+
Sbjct: 3987 LLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSAVTEGKEVLFSASSDTSVQWDPLSGSSSRPVTVH--FVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTHCSTENF 4142          

HSP 7 Score: 107.457 bits (267), Expect = 5.958e-22
Identity = 60/209 (28.71%), Postives = 112/209 (53.59%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGS----RLKTIKLPN--SFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F P+P +T+ + +P  +++  +K AE  HE W+M+K   GW +G+   + +K HP L  ++ L   +++       E+L+T+++ G++I     S+ S    R + I L +  S   ++G+ P+P+D+ N++LS  L ++   LAEN HNIWA  +  +      +E+      P LVPY+ +    K  +R+ + + +K      YS+
Sbjct: 2670 FNPQPADTSSVVVPEKLDHFINKYAEYSHEKWSMEKFAVGWVHGEQMCESSKVHPLLKPYKCLSEKDKEVYRWPIRESLKTMLSWGWSIERMRESDASTLHNRTRRISLSSQRSIEGAHGFSPRPVDMSNVTLSRDLHSMAELLAENYHNIWAQKKKLE------LESKGGGSHPLLVPYDTLTAKEKSKDREKAQDILKFFQINGYSV 2872          

HSP 8 Score: 100.908 bits (250), Expect = 5.851e-20
Identity = 58/201 (28.86%), Postives = 99/201 (49.25%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI---INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDTS I LP  LE + ++ A+++H+ W +  ++ G+ YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G  +     R     +  + +    ++ GY P P DL  + +      M +KLAENAHN+WA+ +            I    +  LVP+ +L ++ K   +    E ++ L   GY
Sbjct:  836 FTPTPVDTSQIVLPPHLERIREKLAENIHELWVMNKIDLGWTYGAVRDDNKRQHPCLVEFSRLPEQERSYNLQMSQETLKTLLALGCHVGVADERAAEKVKNLKLSAKYELSSGYKPAPMDLCHIKLASTQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDIKNKRNPRLVPYVLLDERTKKSNKDSLREAVRTLLGYGY 1036          

HSP 9 Score: 69.3218 bits (168), Expect = 1.783e-10
Identity = 26/91 (28.57%), Postives = 60/91 (65.93%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA 9352
            +KP P+D  HI+L ++ E+++D+ A++ H+ WA + + +G+ YG+ ++  NK +P L+ + LL +  +    + + EA++ ++ +G+ ++A
Sbjct:  950 YKPAPMDLCHIKLASTQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDIKNKRNPRLVPYVLLDERTKKSNKDSLREAVRTLLGYGYNLEA 1040          

HSP 10 Score: 59.6918 bits (143), Expect = 1.430e-7
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 3011 YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            + PQP D  ++ +   L+  +N+ AE +H  W+M++   GW +G     + K  P L PY+ + +  K+  R    E++KT+L++ +SIE
Sbjct: 2670 FNPQPADTSSVVVPEKLDHFINKYAEYSHEKWSMEKFAVGWVHGEQMCESSKVHPLLKPYKCLSEKDKEVYRWPIRESLKTMLSWGWSIE 2759          
BLAST of Ryanodine receptor related vs. Ensembl Xenopus
Match: zmym2 (zinc finger MYM-type containing 2 [Source:Xenbase;Acc:XB-GENE-961591])

HSP 1 Score: 1455.27 bits (3766), Expect = 0.000e+0
Identity = 872/1993 (43.75%), Postives = 1207/1993 (60.56%), Query Frame = 2
Query: 8009 LGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID--ADLSRIEMHGERRRPTIINDG-----YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRP--SSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQS-------MAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTT-VTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLA-----AGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            +G AI++FYS L+DLLGRCAPE    +  K  ++R+R+IL+SLV  EDL G++S+   LPA       N+DG     D   M     P+HKA +VLFL+RVYGI+D    L LLE AFL D+RA+  LD  S   ++ ALALNRY+ ++VLPLLT+ +      E  A+++++TLHT YRLS+ RSLTK QR+ + + L+++   ++P M+ +LLR+L+ DVP L     +PL+LLT  Y++C  YY   +G    G+A+EEE  LT +LF GIFD+L+   YD ELF  ++PCL+AI  AL PDY             + +    +P               E+Q+ V+A       + +F P+P++TS++ LP  LE ++++ A+H HD WA + +  G+ YG++ ++  KTHP L  F  LS+ ++  Y  P+ E++K M+A GW+++   +   + +H E  +   I+       +   P  L    ++  M  M E +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK+R R+   EL K+LQ NGY                  +R   D   D+                      SS   RFA+  L K+L YV+ A   +  +    SS  S   P  QE   IKFF KV+LPLV++YF  H  YF+   +        A N+EK+M A    +L SL        G D    V CL  L Q +D R ++K  S   + V+  +  FF N A+DL   L+NL + +F+H +  ++  + ++NY  + LLP+L S+F+HV++   G DLL+ DVQV+CY+IL +LY LGT  + Y +R+         RP LGEC+AA+A   PVAFLE  LN NN  ++        S   R ILG      E+  ++P+L+ +++EI DLAESG +YTE PHVIEV LPMLC+YL  WW RG EN+ ENA      +P  T VT++ ++ +LGN+LK+I NN+    A WM RIA+  QPI+  A  ++L  HF+P  EKLK  A++   EEE  Q +  S ++        L+ +  +L R+++AFYP+LI+YVD +R+ W+K+P  D+D LF +VAE+F++W KS +FKREEQNFV QNEI++L+ +      NNKS+ S+S   D   K+   R    S  TSL VA +K++LPIGL+M    +QELI  AK R                     K+ D +++E+L+N + L+E+ +D    WQ  LYK I +     S E    E +++RV  ++  +  L  V+ P    K  W KL+S QRKRAV+ACFRM PL++LPRHR +NLFL  Y+  W+  EE     +LIE++ +  K  E  E                                        PDPL Q+I    R A+ + S   DD LY +YA +M+K                       E+EMEK + L +Q RL +RGAAEMVL  I   +G +  +V E+++LGI++L GGNT VQ +ML +LKEKK  GFF S+SGLMQ CSVLDL+ FER NKAEGL         +   +G   L + EFT  LFRFLQLLCEGHN  FQ++LR+Q GNTTTVNIII TVDYLLRLQESI DFYW+Y+GK+ ID +G+ N  K++ + KQIF +LTEYIQGPC+GNQ +LAHSRLWDA+ GFL +FA+MQ KLS+D  Q+ELL+E + L ++M++MLLS+LEGNVVNG IGKQMVDTLVESS+NVEMILKFFD+FL++KD+TSS+AF  +D    G IS KEF+ AME QK YA  EIE+++ C +++ +   ++ EF DRFH+PAKDIGFNVAVLLTNL EHMPND+RL+ L+  A  ++  F PYLGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG++EK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2250 MGNAIMSFYSALIDLLGRCAPETHLIEAGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPA------FNKDGSVFEPD---MAASFCPDHKAPMVLFLDRVYGIKDQSFLLHLLEVAFLPDLRASASLDTASLSVTEMALALNRYICSAVLPLLTRCAPLFSGTEHYAALIDSTLHTIYRLSKGRSLTKAQRDTIEECLLSICHHMRPSMLQQLLRRLVFDVPLLNEYCKMPLKLLTNHYEQCWKYYCLPSGWGSYGLASEEELHLTEKLFWGIFDSLSNKKYDAELFRMSMPCLSAIAGALPPDY-------------VDTRIKATP---------------EKQMSVDA-------EGNFDPKPINTSNLTLPEKLEYIVNKNAEHSHDKWAYDKIHSGWKYGLSLDENMKTHPLLRPFKTLSEKEKEIYRWPLRESVKTMLAMGWSVERTKEGEALALHRENEKMRSISQSSQKKLFFAKPLAL----ISGSMQGMVEVMAENYHNIWAKKKKMELESKGGGSHPLLVPYDTLTAKEKARDREKAQELFKFLQVNGY----------------AISRGLKDMELDA----------------------SSMEKRFAFKFLKKVLHYVDSAQEFIAHLEAVVSSGKSEKSPHEQE---IKFFAKVLLPLVDQYFKNHCLYFLSSPTKTLSSSGYASNKEKEMVARYVIELSSLFFNA----GSDSATMVSCLHILAQTLDTRTVMKSGS---ELVKAGVRAFFENAAEDLEKTLENLKLGKFTHSRTQMKGVSQNINYTTVALLPILTSIFEHVARHQFGVDLLLDDVQVSCYRILCSLYALGTGKNIYVERQ---------RPALGECLAALAGAIPVAFLEPSLNLNNPLTVF----NTKSPRERAILGMPDTVEEMCPDMPHLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGTENVPENA------RPCCTQVTSEHLSVILGNILKIINNNLGIDEASWMKRIAVYAQPIISKAQPDLLKSHFIPTLEKLKKKAIKIVLEEE--QLKADSKADTQEAELLILD-EFAVLCRDLYAFYPMLIRYVDNNRSNWLKKPDIDSDELFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLT----GNNKSKMSKSGGQDLERKRTKRRGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKGR------------------YSLKDTDDEVKEHLRNNLHLQEKSEDPAVKWQLNLYKDIRR-----SEEQSDSEKIVERVQKISAAIFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQKFWIESEENSFEEKLIEDLAKPKKTDEEEEEET----------------------------------EKKPDPLHQIILHFSRNALTERSKLEDDPLYTAYAAMMAK-----------------------EKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMGPMVVETLKLGIAVLNGGNTVVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNNDFQNFLRTQMGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKEVIDESGQHNFSKSLAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKLKDLTSSDAFKEYDPEGKGVISKKEFQKAMEGQKQYAQSEIEFLLSCAEADENDMFNYVEFVDRFHEPAKDIGFNVAVLLTNLNEHMPNDSRLQCLLEPASSVLSYFSPYLGRIEIMGGAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQIS 4040          

HSP 2 Score: 1150.96 bits (2976), Expect = 0.000e+0
Identity = 609/1320 (46.14%), Postives = 859/1320 (65.08%), Query Frame = 2
Query:  137 ISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAK----GYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLS-KMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTK 4042
            I FL  DD V L  V   H    +FCL+A G G+R CFLE  S  +  PPDL +C F+L+Q+LSVRALQE++A     G +  + GG  GH+TLLYGHA+LL+H+ S M+L+CL+TS S  DKLAFDVGLQ  +  EACWWT+HPA+KQRSEGEKVRIGDDLILVSVSSERYLHL+  NG +  Q V ASF QTLW V P  SG+  ++  G + GG V+R FHG DECLT+P ++   + QH  V YE G   + ARSLWR+E ++  WSG  I WG   RLRH+T+G+YL+++     V    R+++   S+AF  R SK+ K     + + D MG+A+IK+G++  F+QHV+S  WL+Y+A +  K       +++A++  EGHMDDG T+ K Q EES++A  IR   ++F++FI  LD         S    + + EV++ L+DLID+F  P  + EHE KQ KL +L+NRQ+LF+EEG++ L+L  ID+    +     F + +GE     + ++ N LY LLAA+IRGNR+NCAQF+  + +DW+  +LE  +S+ G+L+VLHC+L +S EALN+I   HIR +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  +S+RPN+F+GV E SA Y+KWY+E+ ID ++  +T     LRVGW++  G+ P+PGG +GWG   VGDDLFS+GFDG +LW+G  P+ + +   Q +L   D++ C LDL VP I F IN +PV+G F +FN +G+F+P VS SA V VR + GG HG  ++ PP GY+  +EALLPKE++R+EP   +      +    G +       FIP P++T++I LP ++E IRDKLAENIHE+W M KI+ GW YG+ RDD  + HPCL  F +LP  E+ +++ ++ ETL+T++ALG  I +   +    LK +KLP +++ SNGY+P PLDL ++ L    E LV++LAEN HN+WA DRIKQGW+YG  ++   K            +  KKSNR +  E V+T + Y Y+IE P  ++++        + +R G   IR FR + T+ V +GKWY+E E++T G MR GW         E+G++ Q++ F+   A  WN+ S  +G+  QPGDV+GCM++L+D+++ F+LNGEL++   G E+AF +   + G+VP  S G  Q  ++N G D  T KY+T CGLQEG+ PF VNM+R + +W+S+  P  FV++ K++  +EV    G+V   P LK+  K FG Q S  +M + RL +P++    F T+
Sbjct:   16 IQFLGFDDEVVLQCVATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVPPDLCICNFVLEQSLSVRALQEMLANTMANGNEGASQGG--GHRTLLYGHAILLRHSFSGMYLTCLTTSRSLTDKLAFDVGLQNTSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSISNGMSNIQ-VDASFMQTLWNVHPTCSGSSVEE--GYLLGGHVVRFFHGHDECLTIPSTDSGEA-QHRKVNYEAGGAGARARSLWRVEPLRISWSGSHIRWGQTFRLRHITTGQYLALTEDQGLVLQ-DRAKSDTKSSAFCFRASKE-KLDTGSKRDIDGMGAAEIKYGDSICFVQHVNSGLWLTYKA-QDAKTARLGPLKRRAILHQEGHMDDGVTLQKCQHEESQAARIIRNTTALFSQFISDLDSVTGNNWAGSTPITLPIEEVVQTLQDLIDYFKPPEEELEHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLN-VYSSAAHFAEFLGEKDGPAWKEIMNLLYELLAALIRGNRSNCAQFS--NNLDWLISKLERLESSSGILEVLHCILIESPEALNLIEKGHIRSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRTNQNLICDNLLPRRDLLLQTRLVNDVTSMRPNIFLGVAEGSAQYKKWYFEMIIDQVDPFLTPEPTHLRVGWASTSGYAPYPGGGEGWGGNGVGDDLFSYGFDGLHLWSGRVPRAVAST-NQHLLASDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTEGLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPAGYAPCYEALLPKEKMRVEPVKEYKRDFDGVRDLLGTTHFLSQASFIPCPIDTSQIVLPPHLEKIRDKLAENIHELWGMNKIELGWIYGKVRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCLIVHSNQTAEENLKKVKLPKNYMMSNGYKPAPLDLSDVKLLPAQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKH-----------ERTKKSNRDSLREAVRTFIGYGYNIEPPDQEITD-------QMTERVGIDKIRFFRVEKTYAVETGKWYFEFEVVTGGDMRVGWARPGCRPDIELGADEQAFVFEGSRAQCWNMGSSFFGRSWQPGDVVGCMINLEDKSMIFTLNGELLITNQGSELAFADFEIENGFVPVCSLGLSQIGRMNLGKDASTFKYYTMCGLQEGFQPFAVNMTRDIVMWFSKRLPT-FVNVPKDHPHIEVTRIDGTVESPPCLKVTHKTFGTQNSNEDMIYCRLSMPVEFHSAFNTE 1302          

HSP 3 Score: 562.377 bits (1448), Expect = 2.788e-159
Identity = 278/472 (58.90%), Postives = 362/472 (76.69%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNST-------DPDDMEE---FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-------EASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            T +++  A+N YN +  AL +AF INF+LLFY+V ++ SS+    ++        D +D  E   + +L ++  YM    +ILA +H+  +   +I YYCLKVPLV+FKREKEI+R +EF+G++ITEQP++D++K  WD+LV++TPSFP NYWDKFVK+KV NKY + Y  + I  LLG+++ +       +     G L   + + D++Y IWK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GDPYE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQV+EDME+KCFICGIG +YFD  PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4332 TKMLNYLARNFYNLRFLALFVAFAINFILLFYKVTEEHSSEDSDNDTNLWDTFQEDDEDANEGAVYFVLQENTGYMAPTLRILAIIHTIISFLCVIGYYCLKVPLVVFKREKEIARNVEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGADRIAELLGLDKNALDFSPVKKTKPEEGSLVSWLSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDDPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 4803          

HSP 4 Score: 336.65 bits (862), Expect = 5.374e-91
Identity = 169/331 (51.06%), Postives = 223/331 (67.37%), Query Frame = 2
Query: 6608 LSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            L ++I  T++ WA+   I++ +L+R MFSLL RQY+++GE+  +++KTY IS  S +D   LL SLG++R LL V++G+ EEML+ + L DIMNNKVF+QHPNL R L +HETVM++MV+ L                      G+  +Q+               A P+               MV  CCRFLCYFCR S QNQK MFEHL Y+LENSS+ LA PS+RG+ PLDVA +S+MDNNELALA++E  LEKV  YL+  G+QS   L++KGYPDIGW+P+EGER+L FLRF V+VNGE +EENA++VV+LLIRRPEC GP+LRG
Sbjct: 1926 LKELISQTMVRWAQEDHIQDPELVRIMFSLLRRQYDSIGELLRAMRKTYTISAASVEDTINLLASLGQIRSLLSVRMGKEEEMLMIDGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVL---------------------GGDKSQQI---------------AFPK---------------MVASCCRFLCYFCRISRQNQKAMFEHLGYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALQEPDLEKVVTYLAGCGLQSCPMLIAKGYPDIGWNPIEGERYLSFLRFAVFVNGESVEENASVVVKLLIRRPECFGPSLRG 2205          

HSP 5 Score: 326.635 bits (836), Expect = 5.531e-88
Identity = 218/679 (32.11%), Postives = 339/679 (49.93%), Query Frame = 2
Query: 4433 STVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLR-RPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAV-NKGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF-------------------------KSKPALRMPRV-TRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNC 6382
            S  +  +  L   QL+E S       YY+SV +  GQD   +++GWVT  +            ++ FD      K+     T GD +                    +  SV  S  Y++   D+  + G+Q     + +  + IGC +D A+G L+F  N ++L   +QV P T L+PA+F++PT+     FELGR +NT+P+ A + +   +   P    RL +Q +    WSR+ N   K+   +++E  GW +   E +QMMA+HIPEE+RC+DILEL E   L++FH  TL+LY  +C  GN+ V+ +L +H+D++Q  Y I N YL G LR+ F++LLI+M LES    KL   NE ++P+    +  R+     ++                     H +P    S  +  +L     T+       E+   +    PEI  + LK+ +L  L  AV + G  I +P+GG  E  FVP+LK++  LLIMG     D+  IL ++D   F                           + A R P   T+ +L   L ESVKLQ+C LLH  CD +L+HR+E IV  S++FVS +Q +Q  RY E+ Q+ ++ +++TAK T+EFR PP++Q+  +LNF          +DD   C EE++ ++  FH  L+ +C
Sbjct: 1297 SAFNTEENFLKRNQLQEAS-SHTTTTYYYSVRIFAGQDPSSVWVGWVTPDYHFY---------SEKFDL----AKNCTVTVTLGDERGR------------------VHESVKRSNCYMVWGGDL--SAGSQ--RSSRSNVDIDIGCLVDLASGLLSFTANGKDLGTCYQVEPNTKLFPAVFLQPTSTNLIQFELGRLKNTMPLSAAIFKSEEKNPVPQCPPRLDVQTITPVLWSRMPNIFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCIDILELSEQEDLMKFHYHTLKLYCAVCALGNNRVSHALCSHVDQSQLLYTIDNQYLPGLLRSGFYNLLISMFLESAKEGKLMMNNEFIIPITDETRKIRLFPDESKR---------------------HGLPGVGRSTCLKSDL---HFTVPCFLLTAEE---RQQHGPEIPIDILKSKALSMLTEAVQSSGEYIRDPVGGKVEFQFVPVLKLIATLLIMGEFEDEDVRQILLLIDPNVFGDNKEEETEEYEKEEVAQVEEKAVEAGEKATRDPTAPTKGLLQTRLPESVKLQMCELLHYFCDCELKHRVESIVSFSDNFVSKLQYNQKFRYNELMQALNMSAALTAKKTREFRSPPQEQINMLLNFRV--------QDDCP-CPEEIRDELFEFHEDLLMHC 1903          

HSP 6 Score: 102.834 bits (255), Expect = 1.991e-20
Identity = 76/257 (29.57%), Postives = 125/257 (48.64%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRL------KTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI----ETPPTDVSEMAVSNSFNILKR--KGSSAIRTFRAQSTWKVTSGK 3403
            F P+P+ T+ + LP  +E I +K AE+ H+ WA  KI  GW YG + D+  KTHP L  F+ L   E++       E+++T++A+G+++  E   EG  L      + ++  +   Q   +  +PL L    +S  ++ +V  +AEN HNIWA  +  +      +E+      P LVPY+ +    K  +R+ + E  K L    Y+I    +    D S M    +F  LK+      + + F A     V+SGK
Sbjct: 2567 FDPKPINTSNLTLPEKLEYIVNKNAEHSHDKWAYDKIHSGWKYGLSLDENMKTHPLLRPFKTLSEKEKEIYRWPLRESVKTMLAMGWSV--ERTKEGEALALHRENEKMRSISQSSQKKLFFAKPLAL----ISGSMQGMVEVMAENYHNIWAKKKKME------LESKGGGSHPLLVPYDTLTAKEKARDREKAQELFKFLQVNGYAISRGLKDMELDASSMEKRFAFKFLKKVLHYVDSAQEFIAHLEAVVSSGK 2811          

HSP 7 Score: 101.679 bits (252), Expect = 5.257e-20
Identity = 50/154 (32.47%), Postives = 88/154 (57.14%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGW-------TIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK 9520
            F P P+DTS I LP  LE + D+ A+++H+ W +  +E G++YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G        T + +L ++++     +  ++++GY P P DL  V +      + +KLAENAHN+WA+ +
Sbjct:  859 FIPCPIDTSQIVLPPHLEKIRDKLAENIHELWGMNKIELGWIYGKVRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCLIVHSNQTAEENLKKVKL----PKNYMMSNGYKPAPLDLSDVKLLPAQEVLVDKLAENAHNVWAKDR 1008          
BLAST of Ryanodine receptor related vs. Ensembl Xenopus
Match: RYR1 (ryanodine receptor 1 (skeletal) [Source:NCBI gene;Acc:100495378])

HSP 1 Score: 1452.96 bits (3760), Expect = 0.000e+0
Identity = 853/2007 (42.50%), Postives = 1216/2007 (60.59%), Query Frame = 2
Query: 8003 VDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRR--------PTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQ---------EQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            V LG AI++FYS L+DLLGRCAPE       K  +LR+RAIL+SLV +EDL GV+SL   +PA        +DG      +  M    +P+HKA +VLFL+RVYGI++ +  L++LE  FL DMRAA  LD  +   ++ ALALNRYL  +VLPL+TK +      E  A ++++ LHT YRLSR RSLTK QR+ + + L+AL + L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIF++LA   +D EL+  A+PCL AI  A+ PDY                 S  S T +                      AS   + +F P+P++T ++ +P  L+  ++++A++ HD WA E ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++     +  +IE   + R+        PT+    ++P P DL G+ +++E+  MAE+LAEN HN W + KK +++S GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                G     LD                          TSS   RFAY  L KLL+ ++ A   I  ++ +  S R  +    S    +IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M A+LFCK+ +L+R +++  G  +  ++         +  R ++K   +  + V+  L  FF   ++D+  +++NL + + S  +  V+  A ++NY  + LLPVL S+F+H+++   G D+++ DVQV+CY+ L ++Y LGT  S Y +++         RP LGEC+A +A   PVAFLE  LN+ N YS+        S   R ILG      E+  ++P+L+ ++++I  LAESG +YTE PHVIEVTLPMLC+YLP WW RGPEN+ +++     S   T+VT++ +N +LGN+L+++ NN+    A WM R+A+  QPIV  A   +L  HF+P  EKLK  A +   EEE  + E KS SE +  +   +  +  +L R+++A YPLLI+YVD +R  W+ +P  D + LF +V E+F+ WSKS +FKREEQNFV QNEI+++S +  D    +KS+ S+S  +D    K   R  + S  TSL VA +K++LPIGL+M    +QELI  AK R                     K+ D ++ E+L+N + L+ + D+ +  WQ  LY K+ GKA+     +S + E ++KRV  ++ VL  L L +HP    K  W KL+S QR+RAV+ACFRM PL++LPRHR  N+FL  Y+  W +S       R+I+++++S++  E  E                                        PDPL QLI    RTA+ + S   +D LY++YA IM+KSC  ED+ ++   + +E   + +         E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   ++V  +++LGIS+L GGN+ VQ +ML +LKEK+ +GFF S+  LMQ CSVLDL+ FER NKAEGL   G+    G     + D +FT  LFR LQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD ID  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LEGN+VNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF  +  +  G IS K+F+ AM+ QK Y   EI++++ C +++ +  ++F EF DRF +PAKDIGFN+AVLLTNL EH+PND RL+  +  A  +I  F+PYLG+IEI G   RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2315 VHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPLQIPA------FGKDGN---PIEPKMSASFVPDHKAPMVLFLDRVYGIENQDFLLQVLEVGFLPDMRAAASLDTAAFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTIYRLSRGRSLTKAQRDVIEECLMALCRYLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAHKRFDAELYKIAMPCLCAIAGAIPPDYV--------------DASYSSKTEKK---------------------ASVDAEGNFDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEDDKIEKKTKSRKISQSQTYDPTV--QTFSPTPMDLTGITLSRELQSMAEQLAENYHNTWGRKKKQELESKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQINGY------------AVTRGLKDMELD--------------------------TSSIEKRFAYGFLQKLLKLMDTAQEFIAHLEAVVSSGRVEK----SPHEREIKFFAKILLPLINQYFKNHCLYFLSTPAKVLGSGGHASNKEKEMIASLFCKMAALVRHRVSLFGKGLTYALH----FFIFLQYRTVMK---SGPEIVKAGLRSFFEGASEDIEKMVENLKLGKVSQSRTQVKGVAQNINYTTVALLPVLTSLFEHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKSPYVEKQ---------RPALGECLARLAAAMPVAFLEPSLNEYNIYSVYTT----KSPRERAILGLPNSVEEMCPDIPDLETLMKDISMLAESGARYTEMPHVIEVTLPMLCNYLPRWWERGPENIPDDS-----SPCCTSVTSEHLNTLLGNILRIVVNNLGIDEASWMKRLAVFAQPIVSKAKPELLRSHFIPTMEKLKKRAGKVVAEEEQLRMEAKSESEDSESL---IRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNLDAEELFRMVGEVFIFWSKSHNFKREEQNFVVQNEINNMSFLTAD----SKSKMSKSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCSPTDQELITLAKTR------------------YSLKDTDEEVREFLQNNLHLQGKCDNSSMRWQMALYNKMSGKAE-----DSNNPEKIVKRVQEVSAVLFHLELTEHPFKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPRHRACNMFLEGYKQAWIMSEAHDFEDRMIDDLSKSSEAEEEEEEQE----------------------------------EKKPDPLHQLILHFSRTALTEKSKLDEDYLYMAYADIMAKSCHMEDESEEAAEDEEEVELTFEVCTCTSHKDEKEMEKQKLLYQQSRLHNRGAAEMVLQMISACKGEPGSMVSSTLKLGISILNGGNSDVQQKMLDYLKEKREVGFFQSVQALMQTCSVLDLNAFERQNKAEGL---GMVTEDGTREKVMADDQFTQDLFRLLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDIIDDQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNIVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYTTSEIQFLLSCSEADENEMINFEEFADRFQEPAKDIGFNLAVLLTNLSEHVPNDTRLQNFLELADCIINYFKPYLGKIEIMGAGKRIERIYFEISEANKTQWEMPQVKESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMQIASQIS 4141          

HSP 2 Score: 1160.59 bits (3001), Expect = 0.000e+0
Identity = 601/1294 (46.45%), Postives = 851/1294 (65.77%), Query Frame = 2
Query:  200 RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQS----GHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHF 4033
            + C+ A GFG+R CFLE+ S  +N PPDL++C FIL+Q+LSVRALQE++A   +T  +G +S    GH+TLLYGHA+LL+H  S+M+L CL+TS S  DKLAFDVGLQE++  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P++SG +   S+G V GG VLRLFHG  DECLT+  S  +   Q     YE GAV SHARSLWRLE ++  WSG  + WG   R+RHVT+GRYL+       +  +   +A   +TAF  R SK+ K     + + + MG A+IK+GE+  F+QHVSS  WL+Y A    K       +++A++  EGHMDD   +++ Q EES+++  I   + +F  FI+ LD    + + S    + +  VI  L+DLI +F  P  + +HE KQ KL +L+NRQ+LFQEEGII+L+L  ID+    +     F +  GE+  E + ++ N LY LLAA+IRGNR+NCA F+  S +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP RDLLLQTRLV+  +S+RPN+F+G  E S  Y+KWYYE+ +D +E  VT     LRVGW+  EG+ P+PG  +GWG+  VGDDL+SFGFDG +LW+  +P    N   Q +L   D++ C LDLTVP I F  N  PV+G F +FN+DG+F+P VS SA +++R + GG HG  ++ PP GY+ ++EALLP++R+R+EP   + +  ++I    G +++  +  F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +          LK IKLP +++ SNGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGW+Y  +++   KR+P LVPY  +D+  KK+NR +  E V+TL+ Y Y+IE P  +                 S  +R FRA+ ++ V SGKWY+E E +T G MR GWV  +     E+G++  +Y F+     +W++ S P+G+   PGDV+GCM+DL +  I F+LNGE+++   G E+AFK++    G++P  S G  Q  +LN G DV +L+YFT CGLQEG+ PF +NM R +  W+S+  P  FV++  +++ +EV    G+V   P LK+  K FG Q S  +M+F RL +P++  + F
Sbjct:   20 KMCMGAEGFGNRLCFLESTSNAQNVPPDLAICCFILEQSLSVRALQEMLA---NTVEMGNESSQGGGHRTLLYGHAILLRHCHSDMYLCCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPITSG-LYIVSLGYVTGGHVLRLFHGHMDECLTIA-STDQGEEQRRIPHYEGGAVCSHARSLWRLEPLRISWSGSHMKWGQSFRVRHVTTGRYLARDDEKG-LVVLDAERANTKATAFCFRASKE-KLDVAPKRDVEGMGIAEIKYGESMCFVQHVSSGLWLTYGA-LDAKVVRLGPLKRKAILHQEGHMDDALCLSRSQREESQASRMIYSTSGLFNLFIKGLDSLSGKNKPSKPVTLPIDMVILTLQDLIGYFQHPEDELQHEEKQTKLRSLKNRQNLFQEEGIISLVLDCIDRLN-VYSTAAHFSEFAGEEAAESWKEIVNLLYELLAALIRGNRSNCALFS--SNLDWVVSKLDRLEASSGILEVLYCVLIESPEVLNIIKENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQNLITENLLPRRDLLLQTRLVNYVTSMRPNVFLGTCEGSTQYKKWYYEMVVDHVEPFVTAEATHLRVGWAMTEGYSPYPGAGEGWGANGVGDDLYSFGFDGLHLWSVCRPVTSHN---QHLLAADDVVSCCLDLTVPSISFRFNGHPVQGMFENFNLDGLFFPVVSFSAGINIRFLLGGRHGDFKFLPPPGYAPVYEALLPRDRMRIEPIKEYKHDFENIRNLLGPTKSLSHTSFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGTVRDDNKRLHPCLLDFHNLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEENLKKIKLPKTYVMSNGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGYNIEPPDQE-----------------SKRMRIFRAEKSYAVKSGKWYFEFEAVTTGEMRVGWVRPEVRPDVELGADELAYVFNGCRGQRWHIGSEPFGRNWLPGDVVGCMIDLTEMNIMFTLNGEMLISDSGSELAFKDIEIGDGFIPVCSLGMSQVGRLNLGQDVSSLRYFTICGLQEGFEPFAINMKRDITTWFSKSLP-QFVNVPTDHAHIEVGRIDGTVDNPPCLKVTHKTFGSQNSNNDMQFFRLSMPVEFHETF 1277          

HSP 3 Score: 615.535 bits (1586), Expect = 2.112e-175
Identity = 381/1048 (36.35%), Postives = 559/1048 (53.34%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTE--KSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQ-IVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF-------------KSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            YY+SV +  GQ+   ++IGWVT  + L             +D      K  +   T GD K +                  + +S+  S  Y++   +    FGN     +   + + IGC +D ATG +TF  N +E+   FQV P T L+PA+F  P ++    FELG+ +N +P+ A M R   +   P    RL++QML    WSR+ N    +   +++E +GW +   E + MMA+HIPEE RC+D+LEL E   +L+FH  TL+LY ++C  GN+ VA +L +H+DE+Q  Y I++++L G LR+ ++DLLI++HLES  R +L   NE +VP+         TE  KS   + N  K               H +P    S  + P+L     +         +++    + P I  + LK  ++  L  AV  G Q   +P+GGS E  FVP+LK++  LLIMG+   +D+  IL +++   F             + +       +   +L M L ESVKLQ+C+LL   CD +L+HR+E I+  S   + ++Q +Q +RY E+ Q+  + ++ TA+ T+EFR PP++Q+  +LNF   S       +D     E+++ +++ FH  L+ +CG +                T  S+ L  L         G      +Q               LC+E         L ++I  T++ WA+ +FI++ +L+R MFSLL RQY+ LGE+  +L K Y I+  S +D   LL SLG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L     G  D++                                        E++  K      MV  CCRFLCYFCR S QNQ+ MF+HLSY+L+NS + L    +RG+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LLSKGYPDIGW+PV GER+LDFLRF V+VNGE +EENAN+VVRLLIRRPEC GPALRG
Sbjct: 1397 YYYSVRIFAGQEPTGVWIGWVTPDYHL-------------YDMNFDLSKVRVATITMGDDKGN------------------IFNSIKRSNCYMVWGGE----FGNNTQQARVRKEDLVIGCLIDLATGLMTFTANGKEVNTFFQVEPNTKLFPAVFASPQSQNMFQFELGKLKNIMPISAAMFRSENKNPVPQCPPRLEVQMLTPVVWSRMPNDFLNVESERISERQGWMVECSEPLMMMALHIPEESRCIDVLELSERLNMLKFHYHTLKLYCSVCALGNNRVAHALCSHVDESQLLYTIESNHLSGLLRSGYYDLLISIHLESEKRARLTMNNEFIVPM---------TEETKSITLFPNDNKK--------------HGLPGVGMSTCLKPDL---HFSHTCFVSTSTELY---QLSPFIPLDVLKIKAINMLTEAVLDGGQHTRDPVGGSVEFQFVPVLKLISTLLIMGVFEDDDVRHILKMIEPNVFTEEEEEAEQEQAGEEETKEEEEGLEEGLLQMKLPESVKLQMCNLLQYFCDRELQHRVEAIIAFSERHMESLQTNQRQRYKELMQAFTMTAAETARRTREFRSPPQEQINMLLNFRNLS-------EDDCPIPEDIRDELSEFHTDLLSHCGKKQ--------------TTNISKGLIYL---------GGRCNSLVQ---------------LCVEFPP----GTLQELISHTMVHWAQESFIQSPELVRVMFSLLHRQYDGLGELIRALPKAYTINAVSVEDTMNLLESLGQIRSLLIVQMGPEEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVL-----GGGDSK----------------------------------------EIRFPK------MVTNCCRFLCYFCRISRQNQRAMFDHLSYLLQNSGIGLG---MRGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLSKGYPDIGWNPVGGERYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRG 2277          

HSP 4 Score: 535.028 bits (1377), Expect = 5.092e-151
Identity = 269/455 (59.12%), Postives = 343/455 (75.38%), Query Frame = 2
Query: 14648 FAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN----QPSEASGSRGWLRKKMIAWDIQY--LIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK-DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++N YN +  AL LAF INF+LLFY+V        E      P     + +L +S  YM     +L+ +H+  A   +I Y CLK+PLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +KY + Y    I  LLGM+    + S  +G +    K +++W + Y   +W   ++FTDN+FLYL  Y V SL+G++N FF+A HLLD+A+  KTLRTIL SVTHNGKQL++TV L +V++YLYTV+AFNFFRKFY K  D  + DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK DTE+TGQE+YVW++YQ+RCWDFFP GDCFRK YE++L
Sbjct: 4414 LSRNFYNLRFLALFLAFAINFILLFYKVCMDDGGGDEDEEEEGP----VYFVLEESTGYMQPTLYMLSVIHTLIAFLCIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLEISSQNGKKQEPDKSLLSWYVLYNKTLWLCVLVFTDNSFLYLVWYMVMSLLGHYNNFFYAAHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFENHTLEEHNLANYMFFLMYLINKDDTEHTGQESYVWKMYQERCWDFFPAGDCFRKTYEDQL 4864          

HSP 5 Score: 108.612 bits (270), Expect = 3.743e-22
Identity = 63/226 (27.88%), Postives = 110/226 (48.67%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGY-------RPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K +V     F P+P+ET  + +P  ++   +K AE  H+ WA +KI   W+YG+  D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  +++         QS  Y        P P+DL  I+LS  L+++  QLAEN HN W   + ++      +E+      P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2618 YSSKTEKKASVDAEGNFDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEDDKIEKKTKSRKISQSQTYDPTVQTFSPTPMDLTGITLSRELQSMAEQLAENYHNTWGRKKKQE------LESKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQINGYAV 2837          

HSP 6 Score: 106.686 bits (265), Expect = 1.416e-21
Identity = 64/211 (30.33%), Postives = 110/211 (52.13%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S +   F P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G  +       + +L +I++     +  ++++GY P P DL  V +T     + +KLAEN HN+WA+ +       + +  I    +  LVP+ +L +K K   R    E ++ L   GY
Sbjct:  830 SLSHTSFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGTVRDDNKRLHPCLLDFHNLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEENLKKIKL----PKTYVMSNGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGY 1036          

HSP 7 Score: 74.7146 bits (182), Expect = 6.760e-12
Identity = 52/186 (27.96%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  YG  + ++L+ T       FE L H  ++FD  L    +  + A+   I  +        KT K  +   + N + P+P++ LN+ +   L+  +N+ AE TH+ WA ++I+  WSYG   +   K  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2541 KLLTNHYERCWKYYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAH--KRFDAELYKIAMPCLCAIAGAIPPDYVDASYSSKTEKKASVDAEGN-FDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2723          

HSP 8 Score: 67.0106 bits (162), Expect = 1.544e-9
Identity = 27/92 (29.35%), Postives = 58/92 (63.04%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP P+D SH++L  +  +L+D+ A++ H+ WA + V +G+ Y + ++  NK +P L+ + LL +  +    + + EA++ +I +G+ I+
Sbjct:  948 NGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGYNIE 1039          
BLAST of Ryanodine receptor related vs. Ensembl Xenopus
Match: RYR1 (ryanodine receptor 1 (skeletal) [Source:NCBI gene;Acc:100495378])

HSP 1 Score: 1451.42 bits (3756), Expect = 0.000e+0
Identity = 853/2007 (42.50%), Postives = 1216/2007 (60.59%), Query Frame = 2
Query: 8003 VDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRR--------PTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQ---------EQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            V LG AI++FYS L+DLLGRCAPE       K  +LR+RAIL+SLV +EDL GV+SL   +PA        +DG      +  M    +P+HKA +VLFL+RVYGI++ +  L++LE  FL DMRAA  LD  +   ++ ALALNRYL  +VLPL+TK +      E  A ++++ LHT YRLSR RSLTK QR+ + + L+AL + L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIF++LA   +D EL+  A+PCL AI  A+ PDY                 S  S T +                      AS   + +F P+P++T ++ +P  L+  ++++A++ HD WA E ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++     +  +IE   + R+        PT+    ++P P DL G+ +++E+  MAE+LAEN HN W + KK +++S GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                G     LD                          TSS   RFAY  L KLL+ ++ A   I  ++ +  S R  +    S    +IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M A+LFCK+ +L+R +++  G  +  ++         +  R ++K   +  + V+  L  FF   ++D+  +++NL + + S  +  V+  A ++NY  + LLPVL S+F+H+++   G D+++ DVQV+CY+ L ++Y LGT  S Y +++         RP LGEC+A +A   PVAFLE  LN+ N YS+        S   R ILG      E+  ++P+L+ ++++I  LAESG +YTE PHVIEVTLPMLC+YLP WW RGPEN+ +++     S   T+VT++ +N +LGN+L+++ NN+    A WM R+A+  QPIV  A   +L  HF+P  EKLK  A +   EEE  + E KS SE +  +   +  +  +L R+++A YPLLI+YVD +R  W+ +P  D + LF +V E+F+ WSKS +FKREEQNFV QNEI+++S +  D    +KS+ S+S  +D    K   R  + S  TSL VA +K++LPIGL+M    +QELI  AK R                     K+ D ++ E+L+N + L+ + D+ +  WQ  LY K+ GKA+     +S + E ++KRV  ++ VL  L L +HP    K  W KL+S QR+RAV+ACFRM PL++LPRHR  N+FL  Y+  W +S       R+I+++++S++  E  E                                        PDPL QLI    RTA+ + S   +D LY++YA IM+KSC  ED+ ++   + +E   + +         E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   ++V  +++LGIS+L GGN+ VQ +ML +LKEK+ +GFF S+  LMQ CSVLDL+ FER NKAEGL   G+    G     + D +FT  LFR LQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD ID  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LEGN+VNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF  +  +  G IS K+F+ AM+ QK Y   EI++++ C +++ +  ++F EF DRF +PAKDIGFN+AVLLTNL EH+PND RL+  +  A  +I  F+PYLG+IEI G   RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2328 VHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPLQIPA------FGKDGN---PIEPKMSASFVPDHKAPMVLFLDRVYGIENQDFLLQVLEVGFLPDMRAAASLDTAAFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTIYRLSRGRSLTKAQRDVIEECLMALCRYLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAHKRFDAELYKIAMPCLCAIAGAIPPDYV--------------DASYSSKTEKK---------------------ASVDAEGNFDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEDDKIEKKTKSRKISQSQTYDPTV--QTFSPTPMDLTGITLSRELQSMAEQLAENYHNTWGRKKKQELESKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQINGY------------AVTRGLKDMELD--------------------------TSSIEKRFAYGFLQKLLKLMDTAQEFIAHLEAVVSSGRVEK----SPHEREIKFFAKILLPLINQYFKNHCLYFLSTPAKVLGSGGHASNKEKEMIASLFCKMAALVRHRVSLFGKGLTYALH----FFIFLQYRTVMK---SGPEIVKAGLRSFFEGASEDIEKMVENLKLGKVSQSRTQVKGVAQNINYTTVALLPVLTSLFEHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKSPYVEKQ---------RPALGECLARLAAAMPVAFLEPSLNEYNIYSVYTT----KSPRERAILGLPNSVEEMCPDIPDLETLMKDISMLAESGARYTEMPHVIEVTLPMLCNYLPRWWERGPENIPDDS-----SPCCTSVTSEHLNTLLGNILRIVVNNLGIDEASWMKRLAVFAQPIVSKAKPELLRSHFIPTMEKLKKRAGKVVAEEEQLRMEAKSESEDSESL---IRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNLDAEELFRMVGEVFIFWSKSHNFKREEQNFVVQNEINNMSFLTAD----SKSKMSKSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCSPTDQELITLAKTRYS------------------LKDTDEEVREFLQNNLHLQGKCDNSSMRWQMALYNKMSGKAE-----DSNNPEKIVKRVQEVSAVLFHLELTEHPFKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPRHRACNMFLEGYKQAWIMSEAHDFEDRMIDDLSKSSEAEEEEEEQE----------------------------------EKKPDPLHQLILHFSRTALTEKSKLDEDYLYMAYADIMAKSCHMEDESEEAAEDEEEVELTFEVCTCTSHKDEKEMEKQKLLYQQSRLHNRGAAEMVLQMISACKGEPGSMVSSTLKLGISILNGGNSDVQQKMLDYLKEKREVGFFQSVQALMQTCSVLDLNAFERQNKAEGL---GMVTEDGTREKVMADDQFTQDLFRLLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDIIDDQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNIVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYTTSEIQFLLSCSEADENEMINFEEFADRFQEPAKDIGFNLAVLLTNLSEHVPNDTRLQNFLELADCIINYFKPYLGKIEIMGAGKRIERIYFEISEANKTQWEMPQVKESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMQIASQIS 4154          

HSP 2 Score: 1157.9 bits (2994), Expect = 0.000e+0
Identity = 601/1294 (46.45%), Postives = 848/1294 (65.53%), Query Frame = 2
Query:  200 RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAK--GYDTNAI--GGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHF 4033
            + C+ A GFG+R CFLE+ S  +N PPDL++C FIL+Q+LSVRALQE++A   G     I  G   GH+TLLYGHA+LL+H  S+M+L CL+TS S  DKLAFDVGLQE++  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P++SG +   S+G V GG VLRLFHG  DECLT+  S  +   Q     YE GAV SHARSLWRLE ++  WSG  + WG   R+RHVT+GRYL+       +  +   +A   +TAF  R SK+ K     + + + MG A+IK+GE+  F+QHVSS  WL+Y A    K       +++A++  EGHMDD   +++ Q EES+++  I   + +F  FI+ LD    + + S    + +  VI  L+DLI +F  P  + +HE KQ KL +L+NRQ+LFQEEGII+L+L  ID+    +     F +  GE+  E + ++ N LY LLAA+IRGNR+NCA F+  S +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP RDLLLQTRLV+  +S+RPN+F+G  E S  Y+KWYYE+ +D +E  VT     LRVGW+  EG+ P+PG  +GWG+  VGDDL+SFGFDG +LW+  +P    N   Q +L   D++ C LDLTVP I F  N  PV+G F +FN+DG+F+P VS SA +++R + GG HG  ++ PP GY+ ++EALLP++R+R+EP   + +  ++I    G +++  +  F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +          LK IKLP +++ SNGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGW+Y  +++   KR+P LVPY  +D+  KK+NR +  E V+TL+ Y Y+IE P  +                 S  +R FRA+ ++ V SGKWY+E E +T G MR GWV  +     E+G++  +Y F+     +W++ S P+G+   PGDV+GCM+DL +  I F+LNGE+++   G E+AFK++    G++P  S G  Q  +LN G DV +L+YFT CGLQEG+ PF +NM R +  W+S+  P  FV++  +++ +EV    G+V   P LK+  K FG Q S  +M+F RL +P++  + F
Sbjct:   30 KMCMGAEGFGNRLCFLESTSNAQNVPPDLAICCFILEQSLSVRALQEMLANTAGRPPGKIMMGPGGGHRTLLYGHAILLRHCHSDMYLCCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPITSG-LYIVSLGYVTGGHVLRLFHGHMDECLTIA-STDQGEEQRRIPHYEGGAVCSHARSLWRLEPLRISWSGSHMKWGQSFRVRHVTTGRYLARDDEKG-LVVLDAERANTKATAFCFRASKE-KLDVAPKRDVEGMGIAEIKYGESMCFVQHVSSGLWLTYGA-LDAKVVRLGPLKRKAILHQEGHMDDALCLSRSQREESQASRMIYSTSGLFNLFIKGLDSLSGKNKPSKPVTLPIDMVILTLQDLIGYFQHPEDELQHEEKQTKLRSLKNRQNLFQEEGIISLVLDCIDRLN-VYSTAAHFSEFAGEEAAESWKEIVNLLYELLAALIRGNRSNCALFS--SNLDWVVSKLDRLEASSGILEVLYCVLIESPEVLNIIKENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQNLITENLLPRRDLLLQTRLVNYVTSMRPNVFLGTCEGSTQYKKWYYEMVVDHVEPFVTAEATHLRVGWAMTEGYSPYPGAGEGWGANGVGDDLYSFGFDGLHLWSVCRPVTSHN---QHLLAADDVVSCCLDLTVPSISFRFNGHPVQGMFENFNLDGLFFPVVSFSAGINIRFLLGGRHGDFKFLPPPGYAPVYEALLPRDRMRIEPIKEYKHDFENIRNLLGPTKSLSHTSFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGTVRDDNKRLHPCLLDFHNLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEENLKKIKLPKTYVMSNGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGYNIEPPDQE-----------------SKRMRIFRAEKSYAVKSGKWYFEFEAVTTGEMRVGWVRPEVRPDVELGADELAYVFNGCRGQRWHIGSEPFGRNWLPGDVVGCMIDLTEMNIMFTLNGEMLISDSGSELAFKDIEIGDGFIPVCSLGMSQVGRLNLGQDVSSLRYFTICGLQEGFEPFAINMKRDITTWFSKSLP-QFVNVPTDHAHIEVGRIDGTVDNPPCLKVTHKTFGSQNSNNDMQFFRLSMPVEFHETF 1290          

HSP 3 Score: 615.15 bits (1585), Expect = 2.871e-175
Identity = 381/1048 (36.35%), Postives = 559/1048 (53.34%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTE--KSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQ-IVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF-------------KSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            YY+SV +  GQ+   ++IGWVT  + L             +D      K  +   T GD K +                  + +S+  S  Y++   +    FGN     +   + + IGC +D ATG +TF  N +E+   FQV P T L+PA+F  P ++    FELG+ +N +P+ A M R   +   P    RL++QML    WSR+ N    +   +++E +GW +   E + MMA+HIPEE RC+D+LEL E   +L+FH  TL+LY ++C  GN+ VA +L +H+DE+Q  Y I++++L G LR+ ++DLLI++HLES  R +L   NE +VP+         TE  KS   + N  K               H +P    S  + P+L     +         +++    + P I  + LK  ++  L  AV  G Q   +P+GGS E  FVP+LK++  LLIMG+   +D+  IL +++   F             + +       +   +L M L ESVKLQ+C+LL   CD +L+HR+E I+  S   + ++Q +Q +RY E+ Q+  + ++ TA+ T+EFR PP++Q+  +LNF   S       +D     E+++ +++ FH  L+ +CG +                T  S+ L  L         G      +Q               LC+E         L ++I  T++ WA+ +FI++ +L+R MFSLL RQY+ LGE+  +L K Y I+  S +D   LL SLG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L     G  D++                                        E++  K      MV  CCRFLCYFCR S QNQ+ MF+HLSY+L+NS + L    +RG+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LLSKGYPDIGW+PV GER+LDFLRF V+VNGE +EENAN+VVRLLIRRPEC GPALRG
Sbjct: 1410 YYYSVRIFAGQEPTGVWIGWVTPDYHL-------------YDMNFDLSKVRVATITMGDDKGN------------------IFNSIKRSNCYMVWGGE----FGNNTQQARVRKEDLVIGCLIDLATGLMTFTANGKEVNTFFQVEPNTKLFPAVFASPQSQNMFQFELGKLKNIMPISAAMFRSENKNPVPQCPPRLEVQMLTPVVWSRMPNDFLNVESERISERQGWMVECSEPLMMMALHIPEESRCIDVLELSERLNMLKFHYHTLKLYCSVCALGNNRVAHALCSHVDESQLLYTIESNHLSGLLRSGYYDLLISIHLESEKRARLTMNNEFIVPM---------TEETKSITLFPNDNKK--------------HGLPGVGMSTCLKPDL---HFSHTCFVSTSTELY---QLSPFIPLDVLKIKAINMLTEAVLDGGQHTRDPVGGSVEFQFVPVLKLISTLLIMGVFEDDDVRHILKMIEPNVFTEEEEEAEQEQAGEEETKEEEEGLEEGLLQMKLPESVKLQMCNLLQYFCDRELQHRVEAIIAFSERHMESLQTNQRQRYKELMQAFTMTAAETARRTREFRSPPQEQINMLLNFRNLS-------EDDCPIPEDIRDELSEFHTDLLSHCGKKQ--------------TTNISKGLIYL---------GGRCNSLVQ---------------LCVEFPP----GTLQELISHTMVHWAQESFIQSPELVRVMFSLLHRQYDGLGELIRALPKAYTINAVSVEDTMNLLESLGQIRSLLIVQMGPEEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVL-----GGGDSK----------------------------------------EIRFPK------MVTNCCRFLCYFCRISRQNQRAMFDHLSYLLQNSGIGLG---MRGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLSKGYPDIGWNPVGGERYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRG 2290          

HSP 4 Score: 546.969 bits (1408), Expect = 1.261e-154
Identity = 274/457 (59.96%), Postives = 346/457 (75.71%), Query Frame = 2
Query: 14648 FAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN----QPSEASGSRGWLRKKMIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++N YN +  AL LAF INF+LLFY+V        E      P     + +L +S  YM     +L+ +H+  A   +I Y CLK+PLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +KY + Y    I  LLGM+    + S  +G +    K +++W    DI+Y IW +GV+FTDN+FLYL  Y V SL+G++N FF+A HLLD+A+  KTLRTIL SVTHNGKQL++TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK DTE+TGQE+YVW++YQ+RCWDFFP GDCFRK YE++L
Sbjct: 4427 LSRNFYNLRFLALFLAFAINFILLFYKVCMDDGGGDEDEEEEGP----VYFVLEESTGYMQPTLYMLSVIHTLIAFLCIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLEISSQNGKKQEPDKSLLSWFTSIDIKYQIWNFGVVFTDNSFLYLVWYMVMSLLGHYNNFFYAAHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFENHTLEEHNLANYMFFLMYLINKDDTEHTGQESYVWKMYQERCWDFFPAGDCFRKTYEDQL 4879          

HSP 5 Score: 108.612 bits (270), Expect = 4.174e-22
Identity = 63/226 (27.88%), Postives = 110/226 (48.67%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGY-------RPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K +V     F P+P+ET  + +P  ++   +K AE  H+ WA +KI   W+YG+  D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  +++         QS  Y        P P+DL  I+LS  L+++  QLAEN HN W   + ++      +E+      P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2631 YSSKTEKKASVDAEGNFDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEDDKIEKKTKSRKISQSQTYDPTVQTFSPTPMDLTGITLSRELQSMAEQLAENYHNTWGRKKKQE------LESKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQINGYAV 2850          

HSP 6 Score: 106.686 bits (265), Expect = 1.633e-21
Identity = 64/211 (30.33%), Postives = 110/211 (52.13%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S +   F P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G  +       + +L +I++     +  ++++GY P P DL  V +T     + +KLAEN HN+WA+ +       + +  I    +  LVP+ +L +K K   R    E ++ L   GY
Sbjct:  843 SLSHTSFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGTVRDDNKRLHPCLLDFHNLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEENLKKIKL----PKTYVMSNGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGY 1049          

HSP 7 Score: 74.7146 bits (182), Expect = 6.705e-12
Identity = 52/186 (27.96%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  YG  + ++L+ T       FE L H  ++FD  L    +  + A+   I  +        KT K  +   + N + P+P++ LN+ +   L+  +N+ AE TH+ WA ++I+  WSYG   +   K  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2554 KLLTNHYERCWKYYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAH--KRFDAELYKIAMPCLCAIAGAIPPDYVDASYSSKTEKKASVDAEGN-FDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2736          

HSP 8 Score: 66.6254 bits (161), Expect = 1.651e-9
Identity = 27/92 (29.35%), Postives = 58/92 (63.04%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP P+D SH++L  +  +L+D+ A++ H+ WA + V +G+ Y + ++  NK +P L+ + LL +  +    + + EA++ +I +G+ I+
Sbjct:  961 NGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGYNIE 1052          
BLAST of Ryanodine receptor related vs. Ensembl Xenopus
Match: RYR1 (ryanodine receptor 1 (skeletal) [Source:NCBI gene;Acc:100495378])

HSP 1 Score: 1449.88 bits (3752), Expect = 0.000e+0
Identity = 854/2002 (42.66%), Postives = 1207/2002 (60.29%), Query Frame = 2
Query: 8003 VDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRR----------PTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKM--AATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            V LG AI++FYS L+DLLGRCAPE       K  +LR+RAIL+SLV +EDL GV+SL   +PA        +DG      +  M    +P+HKA +VLFL+RVYGI++ +  L++LE  FL DMRAA  LD  +   ++ ALALNRYL  +VLPL+TK +      E  A ++++ LHT YRLSR RSLTK QR+ + + L+AL + L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIF++LA   +D EL+  A+PCL AI  A+ PDY                 S  S T +                      AS   + +F P+P++T ++ +P  L+  ++++A++ HD WA E ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++     +  +IE   + R+          PT+    ++P P DL G+ +++E+  MAE+LAEN HN W + KK +++S GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                G     LD                          TSS   RFAY  L KLL+ ++ A   I  ++ +  S R  +    S    +IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M      +  +   L   L  LG D    V CL  L +++D R ++K   +  + V+  L  FF   ++D+  +++NL + + S  +  V+  A ++NY  + LLPVL S+F+H+++   G D+++ DVQV+CY+ L ++Y LGT  S Y +++         RP LGEC+A +A   PVAFLE  LN+ N YS+        S   R ILG      E+  ++P+L+ ++++I  LAESG +YTE PHVIEVTLPMLC+YLP WW RGPEN+ +++     S   T+VT++ +N +LGN+L+++ NN+    A WM R+A+  QPIV  A   +L  HF+P  EKLK  A +   EEE  + E KS SE +  +   +  +  +L R+++A YPLLI+YVD +R  W+ +P  D + LF +V E+F+ WSKS +FKREEQNFV QNEI+++S +  D    +KS+ S+S  +D    K   R  + S  TSL VA +K++LPIGL+M    +QELI  AK R                     K+ D ++ E+L+N + L+ + D+ +  WQ  LY K+ GKA+     +S + E ++KRV  ++ VL  L L +HP    K  W KL+S QR+RAV+ACFRM PL++LPRHR  N+FL  Y+  W +S       R+I+++                                      S    E       PDPL QLI    RTA+ + S   +D LY++YA IM+KSC  ED+ ++   + +E   + +E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   ++V  +++LGIS+L GGN+ VQ +ML +LKEK+ +GFF S+  LMQ CSVLDL+ FER NKAEGL   G+    G     + D +FT  LFR LQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD ID  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LEGN+VNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF  +  +  G IS K+F+ AM+ QK Y   EI++++ C +++ +  ++F EF DRF +PAKDIGFN+AVLLTNL EH+PND RL+  +  A  +I  F+PYLG+IEI G   RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2410 VHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPLQIPA------FGKDGN---PIEPKMSASFVPDHKAPMVLFLDRVYGIENQDFLLQVLEVGFLPDMRAAASLDTAAFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTIYRLSRGRSLTKAQRDVIEECLMALCRYLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAHKRFDAELYKIAMPCLCAIAGAIPPDYV--------------DASYSSKTEKK---------------------ASVDAEGNFDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEDDKIEKKTKSRKISQSAQQTYDPTV--QTFSPTPMDLTGITLSRELQSMAEQLAENYHNTWGRKKKQELESKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQINGY------------AVTRGLKDMELD--------------------------TSSIEKRFAYGFLQKLLKLMDTAQEFIAHLEAVVSSGRVEK----SPHEREIKFFAKILLPLINQYFKNHCLYFLSTPAKVLGSGGHASNKEKEMIFVFIFYSSIVIELSVILVFLGTDAPAVVNCLHILARSLDARTVMK---SGPEIVKAGLRSFFEGASEDIEKMVENLKLGKVSQSRTQVKGVAQNINYTTVALLPVLTSLFEHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKSPYVEKQ---------RPALGECLARLAAAMPVAFLEPSLNEYNIYSVYTT----KSPRERAILGLPNSVEEMCPDIPDLETLMKDISMLAESGARYTEMPHVIEVTLPMLCNYLPRWWERGPENIPDDS-----SPCCTSVTSEHLNTLLGNILRIVVNNLGIDEASWMKRLAVFAQPIVSKAKPELLRSHFIPTMEKLKKRAGKVVAEEEQLRMEAKSESEDSESL---IRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNLDAEELFRMVGEVFIFWSKSHNFKREEQNFVVQNEINNMSFLTAD----SKSKMSKSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCSPTDQELITLAKTRYS------------------LKDTDEEVREFLQNNLHLQGKCDNSSMRWQMALYNKMSGKAE-----DSNNPEKIVKRVQEVSAVLFHLELTEHPFKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPRHRACNMFLEGYKQAWIMSEAHDFEDRMIDDL--------------------------------------SVKEEEEEQEEKKPDPLHQLILHFSRTALTEKSKLDEDYLYMAYADIMAKSCHMEDESEEAAEDEEEVELTFEEKEMEKQKLLYQQSRLHNRGAAEMVLQMISACKGEPGSMVSSTLKLGISILNGGNSDVQQKMLDYLKEKREVGFFQSVQALMQTCSVLDLNAFERQNKAEGL---GMVTEDGTREKVMADDQFTQDLFRLLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDIIDDQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNIVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYTTSEIQFLLSCSEADENEMINFEEFADRFQEPAKDIGFNLAVLLTNLSEHVPNDTRLQNFLELADCIINYFKPYLGKIEIMGAGKRIERIYFEISEANKTQWEMPQVKESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMQIASQIS 4231          

HSP 2 Score: 1156.35 bits (2990), Expect = 0.000e+0
Identity = 603/1303 (46.28%), Postives = 860/1303 (66.00%), Query Frame = 2
Query:  200 RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQS-----------GHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTG--GKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHF 4033
            + C+ A GFG+R CFLE+ S  +N PPDL++C FIL+Q+LSVRALQE++A   +T  +G ++           GH+TLLYGHA+LL+H  S+M+L CL+TS S  DKLAFDVGLQE++  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P++SG   + + G V GG VLRLFHG  DECLT+  S  +   Q     YE GAV SHARSLWRLE ++  WSG  + WG   R+RHVT+GRYL+       +  +   +A   +TAF  R SK+ K     + + + MG A+IK+GE+  F+QHVSS  WL+Y A + K   +G ++  +A++  EGHMDD   +++ Q EES+++  I   + +F  FI+ LD    + + S    + +  VI  L+DLI +F  P  + +HE KQ KL +L+NRQ+LFQEEGII+L+L  ID+    +     F +  GE+  E + ++ N LY LLAA+IRGNR+NCA F+  S +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP RDLLLQTRLV+  +S+RPN+F+G  E S  Y+KWYYE+ +D +E  VT     LRVGW+  EG+ P+PG  +GWG+  VGDDL+SFGFDG +LW+G   +P    N   Q +L   D++ C LDLTVP I F  N  PV+G F +FN+DG+F+P VS SA +++R + GG HG  ++ PP GY+ ++EALLP++R+R+EP   + +  ++I    G +++  +  F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +          LK IKLP +++ SNGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGW+Y  +++   KR+P LVPY  +D+  KK+NR +  E V+TL+ Y Y+IE P  +      S +  I+K + +  +R FRA+ ++ V SGKWY+E E +T G MR GWV  +     E+G++  +Y F+     +W++ S P+G+   PGDV+GCM+DL +  I F+LNGE+++   G E+AFK++    G++P  S G  Q  +LN G DV +L+YFT CGLQEG+ PF +NM R +  W+S+  P  FV++  +++ +EV    G+V   P LK+  K FG Q S  +M+F RL +P++  + F
Sbjct:   26 KMCMGAEGFGNRLCFLESTSNAQNVPPDLAICCFILEQSLSVRALQEMLA---NTVEMGNEAPNLDKWSSQGGGHRTLLYGHAILLRHCHSDMYLCCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPITSGC--ELAEGYVTGGHVLRLFHGHMDECLTIA-STDQGEEQRRIPHYEGGAVCSHARSLWRLEPLRISWSGSHMKWGQSFRVRHVTTGRYLARDDEKG-LVVLDAERANTKATAFCFRASKE-KLDVAPKRDVEGMGIAEIKYGESMCFVQHVSSGLWLTYGALDAKVVRLGPLKR-KAILHQEGHMDDALCLSRSQREESQASRMIYSTSGLFNLFIKGLDSLSGKNKPSKPVTLPIDMVILTLQDLIGYFQHPEDELQHEEKQTKLRSLKNRQNLFQEEGIISLVLDCIDRLN-VYSTAAHFSEFAGEEAAESWKEIVNLLYELLAALIRGNRSNCALFS--SNLDWVVSKLDRLEASSGILEVLYCVLIESPEVLNIIKENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQNLITENLLPRRDLLLQTRLVNYVTSMRPNVFLGTCEGSTQYKKWYYEMVVDHVEPFVTAEATHLRVGWAMTEGYSPYPGAGEGWGANGVGDDLYSFGFDGLHLWSGRVCRPVTSHN---QHLLAADDVVSCCLDLTVPSISFRFNGHPVQGMFENFNLDGLFFPVVSFSAGINIRFLLGGRHGDFKFLPPPGYAPVYEALLPRDRMRIEPIKEYKHDFENIRNLLGPTKSLSHTSFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGTVRDDNKRLHPCLLDFHNLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEENLKKIKLPKTYVMSNGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGYNIEPPDQE------STAQGIIKAR-AERMRIFRAEKSYAVKSGKWYFEFEAVTTGEMRVGWVRPEVRPDVELGADELAYVFNGCRGQRWHIGSEPFGRNWLPGDVVGCMIDLTEMNIMFTLNGEMLISDSGSELAFKDIEIGDGFIPVCSLGMSQVGRLNLGQDVSSLRYFTICGLQEGFEPFAINMKRDITTWFSKSLP-QFVNVPTDHAHIEVGRIDGTVDNPPCLKVTHKTFGSQNSNNDMQFFRLSMPVEFHETF 1301          

HSP 3 Score: 545.814 bits (1405), Expect = 2.618e-154
Identity = 279/487 (57.29%), Postives = 357/487 (73.31%), Query Frame = 2
Query: 14597 NPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEE----------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-EASGSRGWLRKK----MIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK-DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            N  E+++I    Y+    ++N YN +  AL LAF INF+LLFY+V   P  + +   S   D++                  + +L +S  YM     +L+ +H+  A   +I Y CLK+PLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +KY + Y    I  LLGM+  S E S   G  ++       + DI+Y IW +GV+FTDN+FLYL  Y V SL+G++N FF+A HLLD+A+  KTLRTIL SVTHNGKQL++TV L +V++YLYTV+AFNFFRKFY K  D  + DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK DTE+TGQE+YVW++YQ+RCWDFFP GDCFRK YE++L
Sbjct: 4508 NELEIQRIKFLNYL----SRNFYNLRFLALFLAFAINFILLFYKVSDSPLGEDDFEGSGIEDEISGMDDGGGDEDEEEEGPVYFVLEESTGYMQPTLYMLSVIHTLIAFLCIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLEISSQNGKKQEPDKSLFTSIDIKYQIWNFGVVFTDNSFLYLVWYMVMSLLGHYNNFFYAAHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFENHTLEEHNLANYMFFLMYLINKDDTEHTGQESYVWKMYQERCWDFFPAGDCFRKTYEDQL 4990          

HSP 4 Score: 387.882 bits (995), Expect = 1.745e-106
Identity = 223/530 (42.08%), Postives = 315/530 (59.43%), Query Frame = 2
Query: 6026 MPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFER----RPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            M L ESVKLQ+C+LL   CD +L+HR+E I+  S   + ++Q +Q +RY E+ Q+  + ++ TA+ T+EFR PP++Q+  +LNF   S       +D     E+++ +++ FH  L+ +CG++         +  +  +     SLH                   + +LNL E+    R  EE +   E  +  +   L ++I  T++ WA+ +FI++ +L+R MFSLL RQY+ LGE+  +L K Y I+  S +D   LL SLG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L     G  D++                                        E++  K      MV  CCRFLCYFCR S QNQ+ MF+HLSY+L+NS + L    +RG+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LLSKGYPDIGW+PV GER+LDFLRF V+VNGE +EENAN+VVRLLIRRPEC GPALRG
Sbjct: 1923 MKLPESVKLQMCNLLQYFCDRELQHRVEAIIAFSERHMESLQTNQRQRYKELMQAFTMTAAETARRTREFRSPPQEQINMLLNFRNLS-------EDDCPIPEDIRDELSEFHTDLLSHCGVQ---------MEGEEEEEHEDTSLH-------------------KRLLNLVEKLKHFRKKEEPEPEPEEKEEPKPSTLQELISHTMVHWAQESFIQSPELVRVMFSLLHRQYDGLGELIRALPKAYTINAVSVEDTMNLLESLGQIRSLLIVQMGPEEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVL-----GGGDSK----------------------------------------EIRFPK------MVTNCCRFLCYFCRISRQNQRAMFDHLSYLLQNSGIGLG---MRGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLSKGYPDIGWNPVGGERYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRG 2363          

HSP 5 Score: 253.062 bits (645), Expect = 9.332e-66
Identity = 159/492 (32.32%), Postives = 248/492 (50.41%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTE--KSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQ-IVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF 5974
            YY+SV +  GQ+   ++IGWVT  + L             +D      K  +   T GD K +                  + +S+  S  Y++   +    FGN     +   + + IGC +D ATG +TF  N +E+   FQV P T L+PA+F  P ++    FELG+ +N +P+ A M R   +   P    RL++QML    WSR+ N    +   +++E +GW +   E + MMA+HIPEE RC+D+LEL E   +L+FH  TL+LY ++C  GN+ VA +L +H+DE+Q  Y I++++L G LR+ ++DLLI++HLES  R +L   NE +VP+         TE  KS   + N  K               H +P    S  + P+L     +         +++    + P I  + LK  ++  L  AV  G Q   +P+GGS E  FVP+LK++  LLIMG+   +D+  IL +++   F
Sbjct: 1421 YYYSVRIFAGQEPTGVWIGWVTPDYHL-------------YDMNFDLSKVRVATITMGDDKGN------------------IFNSIKRSNCYMVWGGE----FGNNTQQARVRKEDLVIGCLIDLATGLMTFTANGKEVNTFFQVEPNTKLFPAVFASPQSQNMFQFELGKLKNIMPISAAMFRSENKNPVPQCPPRLEVQMLTPVVWSRMPNDFLNVESERISERQGWMVECSEPLMMMALHIPEESRCIDVLELSERLNMLKFHYHTLKLYCSVCALGNNRVAHALCSHVDESQLLYTIESNHLSGLLRSGYYDLLISIHLESEKRARLTMNNEFIVPM---------TEETKSITLFPNDNKK--------------HGLPGVGMSTCLKPDL---HFSHTCFVSTSTELY---QLSPFIPLDVLKIKAINMLTEAVLDGGQHTRDPVGGSVEFQFVPVLKLISTLLIMGVFEDDDVRHILKMIEPNVF 1848          

HSP 6 Score: 108.227 bits (269), Expect = 4.784e-22
Identity = 64/228 (28.07%), Postives = 114/228 (50.00%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRL----KTIKLPNSFLQS-----NGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K +V     F P+P+ET  + +P  ++   +K AE  H+ WA +KI   W+YG+  D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  ++    K+ K+  S  Q+       + P P+DL  I+LS  L+++  QLAEN HN W   + ++      +E+      P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2713 YSSKTEKKASVDAEGNFDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEDDKIEKKTKSRKISQSAQQTYDPTVQTFSPTPMDLTGITLSRELQSMAEQLAENYHNTWGRKKKQE------LESKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQINGYAV 2934          

HSP 7 Score: 106.301 bits (264), Expect = 1.968e-21
Identity = 63/205 (30.73%), Postives = 108/205 (52.68%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G  +       + +L +I++     +  ++++GY P P DL  V +T     + +KLAEN HN+WA+ +       + +  I    +  LVP+ +L +K K   R    E ++ L   GY
Sbjct:  850 FVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGTVRDDNKRLHPCLLDFHNLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEENLKKIKL----PKTYVMSNGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGY 1050          

HSP 8 Score: 74.7146 bits (182), Expect = 6.772e-12
Identity = 52/186 (27.96%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  YG  + ++L+ T       FE L H  ++FD  L    +  + A+   I  +        KT K  +   + N + P+P++ LN+ +   L+  +N+ AE TH+ WA ++I+  WSYG   +   K  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2636 KLLTNHYERCWKYYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAH--KRFDAELYKIAMPCLCAIAGAIPPDYVDASYSSKTEKKASVDAEGN-FDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2818          

HSP 9 Score: 66.6254 bits (161), Expect = 1.753e-9
Identity = 27/92 (29.35%), Postives = 58/92 (63.04%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP P+D SH++L  +  +L+D+ A++ H+ WA + V +G+ Y + ++  NK +P L+ + LL +  +    + + EA++ +I +G+ I+
Sbjct:  962 NGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGYNIE 1053          
BLAST of Ryanodine receptor related vs. Ensembl Xenopus
Match: RYR1 (ryanodine receptor 1 (skeletal) [Source:NCBI gene;Acc:100495378])

HSP 1 Score: 1449.49 bits (3751), Expect = 0.000e+0
Identity = 854/2002 (42.66%), Postives = 1211/2002 (60.49%), Query Frame = 2
Query: 8003 VDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRR----------PTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKM--AATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            V LG AI++FYS L+DLLGRCAPE       K  +LR+RAIL+SLV +EDL GV+SL   +PA        +DG      +  M    +P+HKA +VLFL+RVYGI++ +  L++LE  FL DMRAA  LD  +   ++ ALALNRYL  +VLPL+TK +      E  A ++++ LHT YRLSR RSLTK QR+ + + L+AL + L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIF++LA   +D EL+  A+PCL AI  A+ PDY                 S  S T +                      AS   + +F P+P++T ++ +P  L+  ++++A++ HD WA E ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++     +  +IE   + R+          PT+    ++P P DL G+ +++E+  MAE+LAEN HN W + KK +++S GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                G     LD                          TSS   RFAY  L KLL+ ++ A   I  ++ +  S R  +    S    +IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M      +  +   L   L  LG D    V CL  L +++D R ++K   +  + V+  L  FF   ++D+  +++NL + + S  +  V+  A ++NY  + LLPVL S+F+H+++   G D+++ DVQV+CY+ L ++Y LGT  S Y +++         RP LGEC+A +A   PVAFLE  LN+ N YS+        S   R ILG      E+  ++P+L+ ++++I  LAESG +YTE PHVIEVTLPMLC+YLP WW RGPEN+ +++     S   T+VT++ +N +LGN+L+++ NN+    A WM R+A+  QPIV  A   +L  HF+P  EKLK  A +   EEE  + E KS SE +  +   +  +  +L R+++A YPLLI+YVD +R  W+ +P  D + LF +V E+F+ WSKS +FKREEQNFV QNEI+++S +  D    +KS+ S+S  +D    K   R  + S  TSL VA +K++LPIGL+M    +QELI  AK R                     K+ D ++ E+L+N + L+ + D+ +  WQ  LY K+ GKA+     +S + E ++KRV  ++ VL  L L +HP    K  W KL+S QR+RAV+ACFRM PL++LPRHR  N+FL  Y+  W +S       R+I++++ + ++ E  E                                        PDPL QLI    RTA+ + S   +D LY++YA IM+KSC  ED+ ++   + +E   + +E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   ++V  +++LGIS+L GGN+ VQ +ML +LKEK+ +GFF S+  LMQ CSVLDL+ FER NKAEGL   G+    G     + D +FT  LFR LQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD ID  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LEGN+VNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF  +  +  G IS K+F+ AM+ QK Y   EI++++ C +++ +  ++F EF DRF +PAKDIGFN+AVLLTNL EH+PND RL+  +  A  +I  F+PYLG+IEI G   RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2405 VHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPLQIPA------FGKDGN---PIEPKMSASFVPDHKAPMVLFLDRVYGIENQDFLLQVLEVGFLPDMRAAASLDTAAFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTIYRLSRGRSLTKAQRDVIEECLMALCRYLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAHKRFDAELYKIAMPCLCAIAGAIPPDYV--------------DASYSSKTEKK---------------------ASVDAEGNFDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEDDKIEKKTKSRKISQSAQQTYDPTV--QTFSPTPMDLTGITLSRELQSMAEQLAENYHNTWGRKKKQELESKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQINGY------------AVTRGLKDMELD--------------------------TSSIEKRFAYGFLQKLLKLMDTAQEFIAHLEAVVSSGRVEK----SPHEREIKFFAKILLPLINQYFKNHCLYFLSTPAKVLGSGGHASNKEKEMIFVFIFYSSIVIELSVILVFLGTDAPAVVNCLHILARSLDARTVMK---SGPEIVKAGLRSFFEGASEDIEKMVENLKLGKVSQSRTQVKGVAQNINYTTVALLPVLTSLFEHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKSPYVEKQ---------RPALGECLARLAAAMPVAFLEPSLNEYNIYSVYTT----KSPRERAILGLPNSVEEMCPDIPDLETLMKDISMLAESGARYTEMPHVIEVTLPMLCNYLPRWWERGPENIPDDS-----SPCCTSVTSEHLNTLLGNILRIVVNNLGIDEASWMKRLAVFAQPIVSKAKPELLRSHFIPTMEKLKKRAGKVVAEEEQLRMEAKSESEDSESL---IRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNLDAEELFRMVGEVFIFWSKSHNFKREEQNFVVQNEINNMSFLTAD----SKSKMSKSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCSPTDQELITLAKTRYS------------------LKDTDEEVREFLQNNLHLQGKCDNSSMRWQMALYNKMSGKAE-----DSNNPEKIVKRVQEVSAVLFHLELTEHPFKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPRHRACNMFLEGYKQAWIMSEAHDFEDRMIDDLSVTEEEEEEQE-------------------------------------EKKPDPLHQLILHFSRTALTEKSKLDEDYLYMAYADIMAKSCHMEDESEEAAEDEEEVELTFEEKEMEKQKLLYQQSRLHNRGAAEMVLQMISACKGEPGSMVSSTLKLGISILNGGNSDVQQKMLDYLKEKREVGFFQSVQALMQTCSVLDLNAFERQNKAEGL---GMVTEDGTREKVMADDQFTQDLFRLLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDIIDDQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNIVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYTTSEIQFLLSCSEADENEMINFEEFADRFQEPAKDIGFNLAVLLTNLSEHVPNDTRLQNFLELADCIINYFKPYLGKIEIMGAGKRIERIYFEISEANKTQWEMPQVKESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMQIASQIS 4227          

HSP 2 Score: 1142.49 bits (2954), Expect = 0.000e+0
Identity = 601/1303 (46.12%), Postives = 859/1303 (65.92%), Query Frame = 2
Query:  200 RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQS-----------GHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTG--GKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHF 4033
            + C+ A GFG+R CFLE+ S  +N PPDL++C FIL+Q+LSVRALQE++A   +T  +G ++           GH+TLLYGHA+LL+H  S+M+L CL+TS S  DKLAFDVGLQE++  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P++SG   + + G V GG VLRLFHG  DECLT+  S  +   Q     YE GAV SHARSLWRLE ++  WSG  + WG   R+RHVT+GRYL+       +  +   +A   +TAF  R SK+ K     + + + MG A+IK+GE+  F+QHVSS  WL+Y A + K   +G ++  +A++  EGHMDD   +++ Q EES+++  I   + +F  FI+ LD    + + S    + +  VI  L+DLI +F  P  + +HE KQ KL +L+NRQ+LFQEEGII+L+L  ID+    +     F +  GE+  E + ++ N LY LLAA+IRGNR+NCA F+  S +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP RDLLLQTRLV+  +S+RPN+F+G  E S  Y+KWYYE+ +D +E  VT     LRVGW+  EG+ P+PG  +GWG+  VGDDL+SFGFDG +LW+G   +P    N   Q +L   D++ C LDLTVP I F  N  PV+G F +FN+DG+F+P VS SA +++R + GG HG  ++ PP GY+ ++EALLP++R+R+EP   + +  ++I    G +++  +  F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +   M  E +  K  K+   ++ SNGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGW+Y  +++   KR+P LVPY  +D+  KK+NR +  E V+TL+ Y Y+IE P  +      S +  I+K + +  +R FRA+ ++ V SGKWY+E E +T G MR GWV  +     E+G++  +Y F+     +W++ S P+G+   PGDV+GCM+DL +  I F+LNGE+++   G E+AFK++    G++P  S G  Q  +LN G DV +L+YFT CGLQEG+ PF +NM R +  W+S+  P  FV++  +++ +EV    G+V   P LK+  K FG Q S  +M+F RL +P++  + F
Sbjct:   26 KMCMGAEGFGNRLCFLESTSNAQNVPPDLAICCFILEQSLSVRALQEMLA---NTVEMGNEAPNLDKWSSQGGGHRTLLYGHAILLRHCHSDMYLCCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPITSGC--ELAEGYVTGGHVLRLFHGHMDECLTIA-STDQGEEQRRIPHYEGGAVCSHARSLWRLEPLRISWSGSHMKWGQSFRVRHVTTGRYLARDDEKG-LVVLDAERANTKATAFCFRASKE-KLDVAPKRDVEGMGIAEIKYGESMCFVQHVSSGLWLTYGALDAKVVRLGPLKR-KAILHQEGHMDDALCLSRSQREESQASRMIYSTSGLFNLFIKGLDSLSGKNKPSKPVTLPIDMVILTLQDLIGYFQHPEDELQHEEKQTKLRSLKNRQNLFQEEGIISLVLDCIDRLN-VYSTAAHFSEFAGEEAAESWKEIVNLLYELLAALIRGNRSNCALFS--SNLDWVVSKLDRLEASSGILEVLYCVLIESPEVLNIIKENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQNLITENLLPRRDLLLQTRLVNYVTSMRPNVFLGTCEGSTQYKKWYYEMVVDHVEPFVTAEATHLRVGWAMTEGYSPYPGAGEGWGANGVGDDLYSFGFDGLHLWSGRVCRPVTSHN---QHLLAADDVVSCCLDLTVPSISFRFNGHPVQGMFENFNLDGLFFPVVSFSAGINIRFLLGGRHGDFKFLPPPGYAPVYEALLPRDRMRIEPIKEYKHDFENIRNLLGPTKSLSHTSFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGTVRDDNKRLHPCLLDFHNLPEPERNYNLQMSGETLKTLLALGCHVG--MADEKTLKKFWKM---YVMSNGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGYNIEPPDQE------STAQGIIKAR-AERMRIFRAEKSYAVKSGKWYFEFEAVTTGEMRVGWVRPEVRPDVELGADELAYVFNGCRGQRWHIGSEPFGRNWLPGDVVGCMIDLTEMNIMFTLNGEMLISDSGSELAFKDIEIGDGFIPVCSLGMSQVGRLNLGQDVSSLRYFTICGLQEGFEPFAINMKRDITTWFSKSLP-QFVNVPTDHAHIEVGRIDGTVDNPPCLKVTHKTFGSQNSNNDMQFFRLSMPVEFHETF 1296          

HSP 3 Score: 550.051 bits (1416), Expect = 1.342e-155
Identity = 279/490 (56.94%), Postives = 360/490 (73.47%), Query Frame = 2
Query: 14597 NPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEE----------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN----QPSEASGSRGWLRKKMIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK-DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            N  E+++I    Y+    ++N YN +  AL LAF INF+LLFY+V   P  + +   S   D++                  + +L +S  YM     +L+ +H+  A   +I Y CLK+PLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +KY + Y    I  LLGM+    + S  +G +    K +++W    DI+Y IW +GV+FTDN+FLYL  Y V SL+G++N FF+A HLLD+A+  KTLRTIL SVTHNGKQL++TV L +V++YLYTV+AFNFFRKFY K  D  + DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK DTE+TGQE+YVW++YQ+RCWDFFP GDCFRK YE++L
Sbjct: 4501 NELEIQRIKFLNYL----SRNFYNLRFLALFLAFAINFILLFYKVSDSPLGEDDFEGSGIEDEISGMDDGGGDEDEEEEGPVYFVLEESTGYMQPTLYMLSVIHTLIAFLCIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLEISSQNGKKQEPDKSLLSWFTSIDIKYQIWNFGVVFTDNSFLYLVWYMVMSLLGHYNNFFYAAHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFENHTLEEHNLANYMFFLMYLINKDDTEHTGQESYVWKMYQERCWDFFPAGDCFRKTYEDQL 4986          

HSP 4 Score: 387.497 bits (994), Expect = 1.929e-106
Identity = 223/530 (42.08%), Postives = 315/530 (59.43%), Query Frame = 2
Query: 6026 MPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFER----RPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            M L ESVKLQ+C+LL   CD +L+HR+E I+  S   + ++Q +Q +RY E+ Q+  + ++ TA+ T+EFR PP++Q+  +LNF   S       +D     E+++ +++ FH  L+ +CG++         +  +  +     SLH                   + +LNL E+    R  EE +   E  +  +   L ++I  T++ WA+ +FI++ +L+R MFSLL RQY+ LGE+  +L K Y I+  S +D   LL SLG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L     G  D++                                        E++  K      MV  CCRFLCYFCR S QNQ+ MF+HLSY+L+NS + L    +RG+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LLSKGYPDIGW+PV GER+LDFLRF V+VNGE +EENAN+VVRLLIRRPEC GPALRG
Sbjct: 1918 MKLPESVKLQMCNLLQYFCDRELQHRVEAIIAFSERHMESLQTNQRQRYKELMQAFTMTAAETARRTREFRSPPQEQINMLLNFRNLS-------EDDCPIPEDIRDELSEFHTDLLSHCGVQ---------MEGEEEEEHEDTSLH-------------------KRLLNLVEKLKHFRKKEEPEPEPEEKEEPKPSTLQELISHTMVHWAQESFIQSPELVRVMFSLLHRQYDGLGELIRALPKAYTINAVSVEDTMNLLESLGQIRSLLIVQMGPEEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVL-----GGGDSK----------------------------------------EIRFPK------MVTNCCRFLCYFCRISRQNQRAMFDHLSYLLQNSGIGLG---MRGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLSKGYPDIGWNPVGGERYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRG 2358          

HSP 5 Score: 253.062 bits (645), Expect = 9.728e-66
Identity = 159/492 (32.32%), Postives = 248/492 (50.41%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTE--KSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQ-IVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF 5974
            YY+SV +  GQ+   ++IGWVT  + L             +D      K  +   T GD K +                  + +S+  S  Y++   +    FGN     +   + + IGC +D ATG +TF  N +E+   FQV P T L+PA+F  P ++    FELG+ +N +P+ A M R   +   P    RL++QML    WSR+ N    +   +++E +GW +   E + MMA+HIPEE RC+D+LEL E   +L+FH  TL+LY ++C  GN+ VA +L +H+DE+Q  Y I++++L G LR+ ++DLLI++HLES  R +L   NE +VP+         TE  KS   + N  K               H +P    S  + P+L     +         +++    + P I  + LK  ++  L  AV  G Q   +P+GGS E  FVP+LK++  LLIMG+   +D+  IL +++   F
Sbjct: 1416 YYYSVRIFAGQEPTGVWIGWVTPDYHL-------------YDMNFDLSKVRVATITMGDDKGN------------------IFNSIKRSNCYMVWGGE----FGNNTQQARVRKEDLVIGCLIDLATGLMTFTANGKEVNTFFQVEPNTKLFPAVFASPQSQNMFQFELGKLKNIMPISAAMFRSENKNPVPQCPPRLEVQMLTPVVWSRMPNDFLNVESERISERQGWMVECSEPLMMMALHIPEESRCIDVLELSERLNMLKFHYHTLKLYCSVCALGNNRVAHALCSHVDESQLLYTIESNHLSGLLRSGYYDLLISIHLESEKRARLTMNNEFIVPM---------TEETKSITLFPNDNKK--------------HGLPGVGMSTCLKPDL---HFSHTCFVSTSTELY---QLSPFIPLDVLKIKAINMLTEAVLDGGQHTRDPVGGSVEFQFVPVLKLISTLLIMGVFEDDDVRHILKMIEPNVF 1843          

HSP 6 Score: 108.227 bits (269), Expect = 4.905e-22
Identity = 64/228 (28.07%), Postives = 114/228 (50.00%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRL----KTIKLPNSFLQS-----NGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K +V     F P+P+ET  + +P  ++   +K AE  H+ WA +KI   W+YG+  D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  ++    K+ K+  S  Q+       + P P+DL  I+LS  L+++  QLAEN HN W   + ++      +E+      P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2708 YSSKTEKKASVDAEGNFDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEDDKIEKKTKSRKISQSAQQTYDPTVQTFSPTPMDLTGITLSRELQSMAEQLAENYHNTWGRKKKQE------LESKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQINGYAV 2929          

HSP 7 Score: 104.375 bits (259), Expect = 7.961e-21
Identity = 63/199 (31.66%), Postives = 106/199 (53.27%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID-ADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G  +  AD   ++   +  +  ++++GY P P DL  V +T     + +KLAEN HN+WA+ +       + +  I    +  LVP+ +L +K K   R    E ++ L   GY
Sbjct:  850 FVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGTVRDDNKRLHPCLLDFHNLPEPERNYNLQMSGETLKTLLALGCHVGMADEKTLK---KFWKMYVMSNGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGY 1045          

HSP 8 Score: 74.7146 bits (182), Expect = 6.828e-12
Identity = 52/186 (27.96%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  YG  + ++L+ T       FE L H  ++FD  L    +  + A+   I  +        KT K  +   + N + P+P++ LN+ +   L+  +N+ AE TH+ WA ++I+  WSYG   +   K  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2631 KLLTNHYERCWKYYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAH--KRFDAELYKIAMPCLCAIAGAIPPDYVDASYSSKTEKKASVDAEGN-FDPKPIETLNVIIPEKLDGFINKYAEYTHDKWAFEKIQNNWSYGEAVDEEAKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2813          

HSP 9 Score: 66.6254 bits (161), Expect = 1.768e-9
Identity = 27/92 (29.35%), Postives = 58/92 (63.04%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP P+D SH++L  +  +L+D+ A++ H+ WA + V +G+ Y + ++  NK +P L+ + LL +  +    + + EA++ +I +G+ I+
Sbjct:  957 NGYKPAPLDLSHVKLTPAQNTLVDKLAENGHNVWARDRVLQGWTYSIIQDIKNKRNPRLVPYSLLDEKTKKTNRDSLCEAVRTLIGYGYNIE 1048          
BLAST of Ryanodine receptor related vs. Ensembl Mouse
Match: Ryr1 (ryanodine receptor 1, skeletal muscle [Source:MGI Symbol;Acc:MGI:99659])

HSP 1 Score: 1693.71 bits (4385), Expect = 0.000e+0
Identity = 1010/2558 (39.48%), Postives = 1447/2558 (56.57%), Query Frame = 2
Query:  137 ISFLRTDDHVCL--SSVGHGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSG-HKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRS---SLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKAL-LRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFG--NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLG--------KNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIY-PNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK---------------------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRY-VEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            + FLRTDD V L  S+       + CL+A GFG+R CFLE  S  +N PPDL++C FIL+Q+LSVRALQE++A   +      Q G H+TLLYGHA+LL+H  S M+LSCL+TS S  DKLAFDVGLQE+A  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P+ SG       G V GG VLRLFHG  DECLT+  S+ +   Q   V YE G V +HARSLWRLE ++  WSG  + WG   R+RHVT+GRYL ++     +  V  S+A   +T+F  R SK+ K     + + + MG  +IK+GE+  F+QHV+S  WL+Y A    K     V +K+A++  EGHMDD  ++ + Q EES++A  I   A ++ +FI+ LD +  + + S   + S + +  VI  L+DLI +F  P+ + +HE KQ KL +LRNRQ LFQEEG+++L+L  ID+             A  E  + W  ++ N LY LLA++IRGNR NCA F+  + +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP R+LLLQT L++  +S+RPN+F+G  E S  Y KWY+E+ +D +      +A  LRVGW+ +EG+ P+PGG +GWG   VGDDL+S+GFDG +LWTG   + + +  Q  +L   D++ C LDL+VP I F IN  PV+G F  FN+DG+F+P VS SA + VR + GG HG  ++ PP GY+   EA+LP+ERL L+P   +           G S    ++ F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +          LK  KLP +++ SNGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGWSY  V++   +R+P LVPY  +D++ K+SNR +  + V+TLL Y Y+IE P  + S++   +       +G  A R FRA+ ++ V SG+WY+E E +T G MR GW   +     E+G++  +Y F+     +W+L S P+G+  Q GDV+GCM+DL + TI F+LNGE++M   G E AF+++    G++P  S GPGQ   LN G DV +L++F  CGLQEG+ PF +NM RPV  W+S+  P  F  +  E+   EV    G+V   P L+L  + +G Q S  EM FLRL LP++   HF   +     AS         P   P  +D   E   + P T   NL ++      +    +   K+   G          P +    +DA       TT K+KK                +     S+  L  L +  +     DD     PE+ L   +       YY+SV V  GQ+   +++GWVT  +            + SFD                         V  VT+   +   ++ SS+  S  Y++   D    F +    G+     + IGC +D ATG +TF  N +E    FQV P T L+PA+FV PT +    FELG+ +N +P+ A M    R+   P    RL++QML    WSR+ N   ++   +  E  GW++  +E + MMA+HIPEE+RC+DILEL E   L RFH  TL LY+++C  GN+ VA +L +H+D+ Q  + +++  L G LR  ++DLLI++HLES  R +    +E +VPL    ++  +           ++               H +P    + S+  P+  S    +  L   G    P   + P I  E L++ +L+ L  AV  G Q   +P+GGS E  FVP+LK+V  LL+MG+    D+  IL +++   F+                                                +   +L M L ESVKLQ+CHLL   CD +L+HR+E +   +  +V  +Q +Q  RY + +K   + ++ TA+ T+EFR PP++Q+  +L+F   +       D+  C   EE+++++  FH+ L+ +CGI+    L+  E   +   T  SR + LL          E +    +           EE        +  + ++L +++  T++ WA+  F+++ +L+R MFSLL RQY+ LGE+  +L + Y IS  S +D   LL  LG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E++  K      MV  CCRFLCYFCR S QNQ++MF+HLSY+LENS + L    ++G+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LL+KGYPDIGW+P  GER+LDFLRF V+VNGE +EENAN+VVRLLIR+PEC GPALRG
Sbjct:   12 VQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPICSGC----EEGFVTGGHVLRLFHGHMDECLTISPSDSDD--QRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLGLT-EDQGLVVVDASKAHTKATSFCFRISKE-KLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA-PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDSFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQEEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESW-KEIVNLLYELLASLIRGNRTNCALFS--TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYGKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHVARPVTSPGQH-LLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHLVGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQS-------RGDRA-RIFRAEKSYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLP-QFEPVPLEHPHYEVARMDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAS---------PGLQPPAED---EARAAEPDTDYENLRRSAGGWGEAEGGKDGTAKEGTPGGTAQAGVEAQPARAENEKDA-------TTEKNKKRGF-----LFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDD-----PEIILNTTT-------YYYSVRVFAGQEPSCVWVGWVTPDYH---------QHDMSFDLS----------------------KVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD----FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRRAGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNNRVAHALCSHVDQAQLLHALEDARLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSAEDGPRR---------------HGLPGVGVTTSLRPPHHFSPPCFVVALPAAGATEAPA-RLSPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDEDVKQILKMIEPEVFREEEEVEEEGEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEDAAEEEKEELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAECYVDKMQGNQRGRYGLLMKAFTMSAAETARRTREFRSPPQEQINMLLHFKNGA-------DEEECPLPEEIRQELVNFHQDLLAHCGIQ----LEGEEEEPEEESTLGSRLMSLL----------EKVKLVKKT----------EEKPEEEPAPEEHKPQSLQELVSHTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISVSSVEDTMSLLECLGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEIRFPK------MVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLG---MQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENANVVVRLLIRKPECFGPALRG 2371          

HSP 2 Score: 1419.45 bits (3673), Expect = 0.000e+0
Identity = 861/2075 (41.49%), Postives = 1236/2075 (59.57%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIIN---------DGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYV---EQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSC--SXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAA----GGLYDLQ-GITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL A++E I +S                   E+P +   P +  D    +   E        PPE++   V LG AI++FY+ L+DLLGRCAPE       K  +LR+RAIL+SLV ++DL G++SL   +P      T+ +DG      +  M    +P+HKAS+VLFL+RVYGI++ +  L +L+  FL DMRAA  LD  +   ++ ALALNRYL  +VLPL+TK +      E  A ++++ LHT YRLSR RSLTK QR+ + D L+AL + ++P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIFD+LA   YD EL+  A+PCL AI  AL PDY               S+S+++                E++  V+A       + +F P+PV+T ++ +P  L+S +++FA++ H+ WA + ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++      E   E+++   I+         +GYNP P DL  V +++E+  MAE+LAEN HN W + KK ++++ GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                G     LD                          TSS   RFA+  L +LLR++   ++ I  ++ +  S R  ++ P  QE   IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M  +LFCKL +L+R +++  G D    V CL  L +++D R ++K   +  + V+  L  FF + ++D+  +++NL + + S  +  V+    +L Y  + LLPVL ++F H+++   G D+++ DVQV+CY+ L ++Y LGT  + Y ++          RP LGEC+A +A   PVAFLE  LN+ N  S+        S   R ILG      E+  ++P L+ ++ EI  LAESG +YTE PHVIE+TLPMLCSYLP WW RGPE               T VT+  +N++LGN+L++I NN+    A WM R+A+  QPIV  A   +L  HF+P   +L+  A +   EEE  + E K+ +E    +   +  +  +L R+++A YPLLI+YVD +R  W+ +P  + + LF +V EIF+ WSKS +FKREEQNFV QNEI+++S +  D  S   ++  +S  +D    K   R  + S  TSL VA +K++LPIGL+M    +Q+LI  AK R                     K+ D ++ E+L+N ++L+ + +    + WQ  LY+ + G+ +  D  E +     ++RV  ++ VL+ L   +HP    K  W KL+S QR+RAV+ACFRM PL++LP HR  N+FL +Y++ W L+ +     R+I+++                                  S+   +   E       PDPL QL+    RTA+ + S   +D LY++YA IM+KSC      ++ ++ GE +E   S +E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   A+V  +++LGIS+L GGN  VQ +ML +LK+KK +GFF SI  LMQ CSVLDL+ FER NKAEGL      G + + Q G   + D EFT  LFRFLQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD I+  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ELL+E + LQK+M++MLLS+LEGNVVNG I +QMVD LVESS+NVEMILKFFD+FL++KDI  SEAF  +  +  G IS K+F+ AM+ QK +   EI++++ C +++ +  ++  EF +RF +PA+DIGFNVAVLLTNL EH+P+D RL   +  A+ ++E F PYLGRIEI G S RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FV+FCEDTI+EMQ + +IS
Sbjct: 2373 GGSGLLAAIEEAIRIS-------------------EDPARDG-PGVRRDRRREHFGEE--------PPEEN--RVHLGHAIMSFYAALIDLLGRCAPETHLIQAGKGEALRIRAILRSLVPLDDLVGIISLPLQIP------TLGKDGA---LVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIAMPCLCAIAGALPPDYVDA------------SYSSKT----------------EKKATVDA-------EGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGY------------AVTRGLKDMELD--------------------------TSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILARSLDARTVMK---SGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVEK---------LRPALGECLARLAAAMPVAFLEPELNEYNACSVYTT----KSPRERAILGLPNSVEEMCPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAPPP-CTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELL---VRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNPNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSK-MAKVVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR------------------YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKI-----VRRVQEVSAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKASWILTEDHSFEDRMIDDL----------------------------------SKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMEMFVSFCEDTIFEMQIAAQIS 4253          

HSP 3 Score: 545.428 bits (1404), Expect = 2.846e-154
Identity = 277/491 (56.42%), Postives = 351/491 (71.49%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEE--------------------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++  ++N Y  +  AL LAF INF+LLFY+V   P  + + +  +   DM                            +  L +S  YM    + L+ LH+  A   +I Y CLKVPLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +K+ + +    I  LLGM+            +P    G   W+    ++ D++Y IWK+GVIFTDN+FLYLG Y V SL+G++N FFFA HLLD+A+  KTLRTIL SVTHNGKQLV+TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4547 FLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGE-DDIEGSGAGDMSGAGSGDGSGWGSRAGEEVEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHNERKPDPPPGLLTWI----MSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 5032          

HSP 4 Score: 108.612 bits (270), Expect = 2.573e-22
Identity = 66/225 (29.33%), Postives = 109/225 (48.44%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTI------KLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K  V     F PRPVET  + +P  +++  +K AE  HE WA  KI   W+YG+N D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  + +        +   ++    GY PQP DL  ++LS  L+ +  QLAEN HN W   + ++      +E       P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2720 YSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQE------LEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAV 2938          

HSP 5 Score: 107.071 bits (266), Expect = 8.444e-22
Identity = 61/202 (30.20%), Postives = 107/202 (52.97%), Query Frame = 2
Query: 9077 DFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERR---RPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKAD------MDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            DF P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L++F  L + ++   ++   E LK ++A G  +     + E + ++    +  ++++GY P P DL  V +T     + ++LAEN HN+WA+ + A       +  I    +  LVP+ +L +  K   R    + ++ L   GY
Sbjct:  851 DFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGY 1052          

HSP 6 Score: 71.633 bits (174), Expect = 4.445e-11
Identity = 50/186 (26.88%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  +G  + ++L+ T       F+ L H  +++D  L    +  + A+   +  +        KT K      + N + P+P++ LN+ +   L++ +N+ AE TH  WA D+I+  WSYG   +  LK  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2643 KLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAH--KKYDQELYRIAMPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGN-FDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2825          

HSP 7 Score: 60.8474 bits (146), Expect = 6.669e-8
Identity = 29/111 (26.13%), Postives = 65/111 (58.56%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI---DADLSRIEMH--GERRR 9391
            + +KP P+D SH+RL  +  +L+D+ A++ H+ WA + V +G+ Y   ++   + +P L+ + LL +  +    + + +A++ ++ +G+ I   D + S+++    G+R R
Sbjct:  964 NGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRAR 1074          
BLAST of Ryanodine receptor related vs. Ensembl Mouse
Match: Ryr1 (ryanodine receptor 1, skeletal muscle [Source:MGI Symbol;Acc:MGI:99659])

HSP 1 Score: 1692.94 bits (4383), Expect = 0.000e+0
Identity = 1010/2558 (39.48%), Postives = 1447/2558 (56.57%), Query Frame = 2
Query:  137 ISFLRTDDHVCL--SSVGHGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSG-HKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRS---SLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKAL-LRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFG--NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLG--------KNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIY-PNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK---------------------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRY-VEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            + FLRTDD V L  S+       + CL+A GFG+R CFLE  S  +N PPDL++C FIL+Q+LSVRALQE++A   +      Q G H+TLLYGHA+LL+H  S M+LSCL+TS S  DKLAFDVGLQE+A  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P+ SG       G V GG VLRLFHG  DECLT+  S+ +   Q   V YE G V +HARSLWRLE ++  WSG  + WG   R+RHVT+GRYL ++     +  V  S+A   +T+F  R SK+ K     + + + MG  +IK+GE+  F+QHV+S  WL+Y A    K     V +K+A++  EGHMDD  ++ + Q EES++A  I   A ++ +FI+ LD +  + + S   + S + +  VI  L+DLI +F  P+ + +HE KQ KL +LRNRQ LFQEEG+++L+L  ID+             A  E  + W  ++ N LY LLA++IRGNR NCA F+  + +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP R+LLLQT L++  +S+RPN+F+G  E S  Y KWY+E+ +D +      +A  LRVGW+ +EG+ P+PGG +GWG   VGDDL+S+GFDG +LWTG   + + +  Q  +L   D++ C LDL+VP I F IN  PV+G F  FN+DG+F+P VS SA + VR + GG HG  ++ PP GY+   EA+LP+ERL L+P   +           G S    ++ F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +          LK  KLP +++ SNGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGWSY  V++   +R+P LVPY  +D++ K+SNR +  + V+TLL Y Y+IE P  + S++   +       +G  A R FRA+ ++ V SG+WY+E E +T G MR GW   +     E+G++  +Y F+     +W+L S P+G+  Q GDV+GCM+DL + TI F+LNGE++M   G E AF+++    G++P  S GPGQ   LN G DV +L++F  CGLQEG+ PF +NM RPV  W+S+  P  F  +  E+   EV    G+V   P L+L  + +G Q S  EM FLRL LP++   HF   +     AS         P   P  +D   E   + P T   NL ++      +    +   K+   G          P +    +DA       TT K+KK                +     S+  L  L +  +     DD     PE+ L   +       YY+SV V  GQ+   +++GWVT  +            + SFD                         V  VT+   +   ++ SS+  S  Y++   D    F +    G+     + IGC +D ATG +TF  N +E    FQV P T L+PA+FV PT +    FELG+ +N +P+ A M    R+   P    RL++QML    WSR+ N   ++   +  E  GW++  +E + MMA+HIPEE+RC+DILEL E   L RFH  TL LY+++C  GN+ VA +L +H+D+ Q  + +++  L G LR  ++DLLI++HLES  R +    +E +VPL    ++  +           ++               H +P    + S+  P+  S    +  L   G    P   + P I  E L++ +L+ L  AV  G Q   +P+GGS E  FVP+LK+V  LL+MG+    D+  IL +++   F+                                                +   +L M L ESVKLQ+CHLL   CD +L+HR+E +   +  +V  +Q +Q  RY + +K   + ++ TA+ T+EFR PP++Q+  +L+F   +       D+  C   EE+++++  FH+ L+ +CGI+    L+  E   +   T  SR + LL          E +    +           EE        +  + ++L +++  T++ WA+  F+++ +L+R MFSLL RQY+ LGE+  +L + Y IS  S +D   LL  LG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E++  K      MV  CCRFLCYFCR S QNQ++MF+HLSY+LENS + L    ++G+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LL+KGYPDIGW+P  GER+LDFLRF V+VNGE +EENAN+VVRLLIR+PEC GPALRG
Sbjct:   12 VQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPICSGC----EEGFVTGGHVLRLFHGHMDECLTISPSDSDD--QRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLGLT-EDQGLVVVDASKAHTKATSFCFRISKE-KLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA-PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDSFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQEEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESW-KEIVNLLYELLASLIRGNRTNCALFS--TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYGKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHVARPVTSPGQH-LLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHLVGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQS-------RGDRA-RIFRAEKSYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLP-QFEPVPLEHPHYEVARMDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAS---------PGLQPPAED---EARAAEPDTDYENLRRSAGGWGEAEGGKDGTAKEGTPGGTAQAGVEAQPARAENEKDA-------TTEKNKKRGF-----LFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDD-----PEIILNTTT-------YYYSVRVFAGQEPSCVWVGWVTPDYH---------QHDMSFDLS----------------------KVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD----FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRRAGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNNRVAHALCSHVDQAQLLHALEDARLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSAEDGPRR---------------HGLPGVGVTTSLRPPHHFSPPCFVVALPAAGATEAPA-RLSPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDEDVKQILKMIEPEVFREEEEVEEEGEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEDAAEEEKEELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAECYVDKMQGNQRGRYGLLMKAFTMSAAETARRTREFRSPPQEQINMLLHFKNGA-------DEEECPLPEEIRQELVNFHQDLLAHCGIQ----LEGEEEEPEEESTLGSRLMSLL----------EKVKLVKKT----------EEKPEEEPAPEEHKPQSLQELVSHTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISVSSVEDTMSLLECLGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEIRFPK------MVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLG---MQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENANVVVRLLIRKPECFGPALRG 2371          

HSP 2 Score: 1419.83 bits (3674), Expect = 0.000e+0
Identity = 862/2076 (41.52%), Postives = 1236/2076 (59.54%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIIN---------DGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYV---EQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSN-NKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSC--SXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAA----GGLYDLQ-GITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL A++E I +S                   E+P +   P +  D    +   E        PPE++   V LG AI++FY+ L+DLLGRCAPE       K  +LR+RAIL+SLV ++DL G++SL   +P      T+ +DG      +  M    +P+HKAS+VLFL+RVYGI++ +  L +L+  FL DMRAA  LD  +   ++ ALALNRYL  +VLPL+TK +      E  A ++++ LHT YRLSR RSLTK QR+ + D L+AL + ++P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIFD+LA   YD EL+  A+PCL AI  AL PDY               S+S+++                E++  V+A       + +F P+PV+T ++ +P  L+S +++FA++ H+ WA + ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++      E   E+++   I+         +GYNP P DL  V +++E+  MAE+LAEN HN W + KK ++++ GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                G     LD                          TSS   RFA+  L +LLR++   ++ I  ++ +  S R  ++ P  QE   IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M  +LFCKL +L+R +++  G D    V CL  L +++D R ++K   +  + V+  L  FF + ++D+  +++NL + + S  +  V+    +L Y  + LLPVL ++F H+++   G D+++ DVQV+CY+ L ++Y LGT  + Y ++          RP LGEC+A +A   PVAFLE  LN+ N  S+        S   R ILG      E+  ++P L+ ++ EI  LAESG +YTE PHVIE+TLPMLCSYLP WW RGPE               T VT+  +N++LGN+L++I NN+    A WM R+A+  QPIV  A   +L  HF+P   +L+  A +   EEE  + E K+ +E    +   +  +  +L R+++A YPLLI+YVD +R  W+ +P  + + LF +V EIF+ WSKS +FKREEQNFV QNEI+++S +  D  S   K+   +S  +D    K   R  + S  TSL VA +K++LPIGL+M    +Q+LI  AK R                     K+ D ++ E+L+N ++L+ + +    + WQ  LY+ + G+ +  D  E +     ++RV  ++ VL+ L   +HP    K  W KL+S QR+RAV+ACFRM PL++LP HR  N+FL +Y++ W L+ +     R+I+++                                  S+   +   E       PDPL QL+    RTA+ + S   +D LY++YA IM+KSC      ++ ++ GE +E   S +E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   A+V  +++LGIS+L GGN  VQ +ML +LK+KK +GFF SI  LMQ CSVLDL+ FER NKAEGL      G + + Q G   + D EFT  LFRFLQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD I+  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ELL+E + LQK+M++MLLS+LEGNVVNG I +QMVD LVESS+NVEMILKFFD+FL++KDI  SEAF  +  +  G IS K+F+ AM+ QK +   EI++++ C +++ +  ++  EF +RF +PA+DIGFNVAVLLTNL EH+P+D RL   +  A+ ++E F PYLGRIEI G S RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FV+FCEDTI+EMQ + +IS
Sbjct: 2373 GGSGLLAAIEEAIRIS-------------------EDPARDG-PGVRRDRRREHFGEE--------PPEEN--RVHLGHAIMSFYAALIDLLGRCAPETHLIQAGKGEALRIRAILRSLVPLDDLVGIISLPLQIP------TLGKDGA---LVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIAMPCLCAIAGALPPDYVDA------------SYSSKT----------------EKKATVDA-------EGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGY------------AVTRGLKDMELD--------------------------TSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILARSLDARTVMK---SGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVEK---------LRPALGECLARLAAAMPVAFLEPELNEYNACSVYTT----KSPRERAILGLPNSVEEMCPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAPPP-CTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELL---VRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNPNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR------------------YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKI-----VRRVQEVSAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKASWILTEDHSFEDRMIDDL----------------------------------SKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMEMFVSFCEDTIFEMQIAAQIS 4255          

HSP 3 Score: 545.428 bits (1404), Expect = 2.945e-154
Identity = 277/491 (56.42%), Postives = 351/491 (71.49%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEE--------------------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++  ++N Y  +  AL LAF INF+LLFY+V   P  + + +  +   DM                            +  L +S  YM    + L+ LH+  A   +I Y CLKVPLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +K+ + +    I  LLGM+            +P    G   W+    ++ D++Y IWK+GVIFTDN+FLYLG Y V SL+G++N FFFA HLLD+A+  KTLRTIL SVTHNGKQLV+TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4549 FLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGE-DDIEGSGAGDMSGAGSGDGSGWGSRAGEEVEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHNERKPDPPPGLLTWI----MSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 5034          

HSP 4 Score: 108.997 bits (271), Expect = 2.509e-22
Identity = 66/225 (29.33%), Postives = 109/225 (48.44%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTI------KLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K  V     F PRPVET  + +P  +++  +K AE  HE WA  KI   W+YG+N D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  + +        +   ++    GY PQP DL  ++LS  L+ +  QLAEN HN W   + ++      +E       P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2720 YSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQE------LEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAV 2938          

HSP 5 Score: 107.071 bits (266), Expect = 8.445e-22
Identity = 61/202 (30.20%), Postives = 107/202 (52.97%), Query Frame = 2
Query: 9077 DFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERR---RPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKAD------MDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            DF P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L++F  L + ++   ++   E LK ++A G  +     + E + ++    +  ++++GY P P DL  V +T     + ++LAEN HN+WA+ + A       +  I    +  LVP+ +L +  K   R    + ++ L   GY
Sbjct:  851 DFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGY 1052          

HSP 6 Score: 71.633 bits (174), Expect = 4.445e-11
Identity = 50/186 (26.88%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  +G  + ++L+ T       F+ L H  +++D  L    +  + A+   +  +        KT K      + N + P+P++ LN+ +   L++ +N+ AE TH  WA D+I+  WSYG   +  LK  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2643 KLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAH--KKYDQELYRIAMPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGN-FDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2825          

HSP 7 Score: 60.8474 bits (146), Expect = 6.669e-8
Identity = 29/111 (26.13%), Postives = 65/111 (58.56%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI---DADLSRIEMH--GERRR 9391
            + +KP P+D SH+RL  +  +L+D+ A++ H+ WA + V +G+ Y   ++   + +P L+ + LL +  +    + + +A++ ++ +G+ I   D + S+++    G+R R
Sbjct:  964 NGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRAR 1074          
BLAST of Ryanodine receptor related vs. Ensembl Mouse
Match: Ryr1 (ryanodine receptor 1, skeletal muscle [Source:MGI Symbol;Acc:MGI:99659])

HSP 1 Score: 1689.47 bits (4374), Expect = 0.000e+0
Identity = 1011/2567 (39.38%), Postives = 1450/2567 (56.49%), Query Frame = 2
Query:  137 ISFLRTDDHVCL--SSVGHGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDT----------NAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRS---SLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKAL-LRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFG--NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLG--------KNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIY-PNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK---------------------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRY-VEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            + FLRTDD V L  S+       + CL+A GFG+R CFLE  S  +N PPDL++C FIL+Q+LSVRALQE++A   +           ++ GG  GH+TLLYGHA+LL+H  S M+LSCL+TS S  DKLAFDVGLQE+A  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P+ SG       G V GG VLRLFHG  DECLT+  S+ +   Q   V YE G V +HARSLWRLE ++  WSG  + WG   R+RHVT+GRYL ++     +  V  S+A   +T+F  R SK+ K     + + + MG  +IK+GE+  F+QHV+S  WL+Y A    K     V +K+A++  EGHMDD  ++ + Q EES++A  I   A ++ +FI+ LD +  + + S   + S + +  VI  L+DLI +F  P+ + +HE KQ KL +LRNRQ LFQEEG+++L+L  ID+             A  E  + W  ++ N LY LLA++IRGNR NCA F+  + +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP R+LLLQT L++  +S+RPN+F+G  E S  Y KWY+E+ +D +      +A  LRVGW+ +EG+ P+PGG +GWG   VGDDL+S+GFDG +LWTG   + + +  Q  +L   D++ C LDL+VP I F IN  PV+G F  FN+DG+F+P VS SA + VR + GG HG  ++ PP GY+   EA+LP+ERL L+P   +           G S    ++ F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +          LK  KLP +++ SNGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGWSY  V++   +R+P LVPY  +D++ K+SNR +  + V+TLL Y Y+IE P  + S++   +       +G  A R FRA+ ++ V SG+WY+E E +T G MR GW   +     E+G++  +Y F+     +W+L S P+G+  Q GDV+GCM+DL + TI F+LNGE++M   G E AF+++    G++P  S GPGQ   LN G DV +L++F  CGLQEG+ PF +NM RPV  W+S+  P  F  +  E+   EV    G+V   P L+L  + +G Q S  EM FLRL LP++   HF   +     AS         P   P  +D   E   + P T   NL ++      +    +   K+   G          P +    +DA       TT K+KK                +     S+  L  L +  +     DD     PE+ L   +       YY+SV V  GQ+   +++GWVT  +            + SFD                         V  VT+   +   ++ SS+  S  Y++   D    F +    G+     + IGC +D ATG +TF  N +E    FQV P T L+PA+FV PT +    FELG+ +N +P+ A M    R+   P    RL++QML    WSR+ N   ++   +  E  GW++  +E + MMA+HIPEE+RC+DILEL E   L RFH  TL LY+++C  GN+ VA +L +H+D+ Q  + +++  L G LR  ++DLLI++HLES  R +    +E +VPL    ++  +           ++               H +P    + S+  P+  S    +  L   G    P   + P I  E L++ +L+ L  AV  G Q   +P+GGS E  FVP+LK+V  LL+MG+    D+  IL +++   F+                                                +   +L M L ESVKLQ+CHLL   CD +L+HR+E +   +  +V  +Q +Q  RY + +K   + ++ TA+ T+EFR PP++Q+  +L+F   +       D+  C   EE+++++  FH+ L+ +CGI+    L+  E   +   T  SR + LL          E +    +           EE        +  + ++L +++  T++ WA+  F+++ +L+R MFSLL RQY+ LGE+  +L + Y IS  S +D   LL  LG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E++  K      MV  CCRFLCYFCR S QNQ++MF+HLSY+LENS + L    ++G+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LL+KGYPDIGW+P  GER+LDFLRF V+VNGE +EENAN+VVRLLIR+PEC GPALRG
Sbjct:   12 VQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFILEQSLSVRALQEMLANTVEAGVEALNLDKWSSQGG--GHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPICSGC----EEGFVTGGHVLRLFHGHMDECLTISPSDSDD--QRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLGLT-EDQGLVVVDASKAHTKATSFCFRISKE-KLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA-PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDSFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQEEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESW-KEIVNLLYELLASLIRGNRTNCALFS--TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYGKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHVARPVTSPGQH-LLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHLVGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQS-------RGDRA-RIFRAEKSYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLP-QFEPVPLEHPHYEVARMDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAS---------PGLQPPAED---EARAAEPDTDYENLRRSAGGWGEAEGGKDGTAKEGTPGGTAQAGVEAQPARAENEKDA-------TTEKNKKRGF-----LFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDD-----PEIILNTTT-------YYYSVRVFAGQEPSCVWVGWVTPDYH---------QHDMSFDLS----------------------KVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD----FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRRAGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNNRVAHALCSHVDQAQLLHALEDARLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSAEDGPRR---------------HGLPGVGVTTSLRPPHHFSPPCFVVALPAAGATEAPA-RLSPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDEDVKQILKMIEPEVFREEEEVEEEGEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEDAAEEEKEELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAECYVDKMQGNQRGRYGLLMKAFTMSAAETARRTREFRSPPQEQINMLLHFKNGA-------DEEECPLPEEIRQELVNFHQDLLAHCGIQ----LEGEEEEPEEESTLGSRLMSLL----------EKVKLVKKT----------EEKPEEEPAPEEHKPQSLQELVSHTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISVSSVEDTMSLLECLGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEIRFPK------MVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLG---MQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENANVVVRLLIRKPECFGPALRG 2378          

HSP 2 Score: 1409.43 bits (3647), Expect = 0.000e+0
Identity = 863/2095 (41.19%), Postives = 1236/2095 (59.00%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIIN---------DGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYV---EQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSN-NKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSC--SXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAA----GGLYDLQ-GITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKL-------------------SKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL A++E I +S                   E+P +   P +  D    +   E        PPE++   V LG AI++FY+ L+DLLGRCAPE       K  +LR+RAIL+SLV ++DL G++SL   +P      T+ +DG      +  M    +P+HKAS+VLFL+RVYGI++ +  L +L+  FL DMRAA  LD  +   ++ ALALNRYL  +VLPL+TK +      E  A ++++ LHT YRLSR RSLTK QR+ + D L+AL + ++P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIFD+LA   YD EL+  A+PCL AI  AL PDY               S+S+++                E++  V+A       + +F P+PV+T ++ +P  L+S +++FA++ H+ WA + ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++      E   E+++   I+         +GYNP P DL  V +++E+  MAE+LAEN HN W + KK ++++ GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                G     LD                          TSS   RFA+  L +LLR++   ++ I  ++ +  S R  ++ P  QE   IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M  +LFCKL +L+R +++  G D    V CL  L +++D R ++K   +  + V+  L  FF + ++D+  +++NL + + S  +  V+    +L Y  + LLPVL ++F H+++   G D+++ DVQV+CY+ L ++Y LGT  + Y ++          RP LGEC+A +A   PVAFLE  LN+ N  S+        S   R ILG      E+  ++P L+ ++ EI  LAESG +YTE PHVIE+TLPMLCSYLP WW RGPE               T VT+  +N++LGN+L++I NN+    A WM R+A+  QPIV  A   +L  HF+P   +L+  A +   EEE  + E K+ +E    +   +  +  +L R+++A YPLLI+YVD +R  W+ +P  + + LF +V EIF+ WSKS +FKREEQNFV QNEI+++S +  D  S   K+   +S  +D    K   R  + S  TSL VA +K++LPIGL+M    +Q+LI  AK R                     K+ D ++ E+L+N ++L+ + +    + WQ  LY+ + G+ +  D  E +     ++RV  ++ VL+ L   +HP    K  W KL+S QR+RAV+ACFRM PL++LP HR  N+FL +Y++ W L+ +     R+I+++                                  S+   +   E       PDPL QL+    RTA+ + S   +D LY++YA IM+KSC      ++ ++ GE +E   S +E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   A+V  +++LGIS+L GGN  VQ +ML +LK+KK +GFF SI  LMQ CSVLDL+ FER NKAEGL      G + + Q G   + D EFT  LFRFLQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD I+  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL                   S+D  Q+ELL+E + LQK+M++MLLS+LEGNVVNG I +QMVD LVESS+NVEMILKFFD+FL++KDI  SEAF  +  +  G IS K+F+ AM+ QK +   EI++++ C +++ +  ++  EF +RF +PA+DIGFNVAVLLTNL EH+P+D RL   +  A+ ++E F PYLGRIEI G S RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FV+FCEDTI+EMQ + +IS
Sbjct: 2380 GGSGLLAAIEEAIRIS-------------------EDPARDG-PGVRRDRRREHFGEE--------PPEEN--RVHLGHAIMSFYAALIDLLGRCAPETHLIQAGKGEALRIRAILRSLVPLDDLVGIISLPLQIP------TLGKDGA---LVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIAMPCLCAIAGALPPDYVDA------------SYSSKT----------------EKKATVDA-------EGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGY------------AVTRGLKDMELD--------------------------TSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILARSLDARTVMK---SGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVEK---------LRPALGECLARLAAAMPVAFLEPELNEYNACSVYTT----KSPRERAILGLPNSVEEMCPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAPPP-CTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELL---VRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNPNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR------------------YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKI-----VRRVQEVSAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKASWILTEDHSFEDRMIDDL----------------------------------SKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQKTPVPSTHDEHVWTRVPSEDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMEMFVSFCEDTIFEMQIAAQIS 4281          

HSP 3 Score: 545.428 bits (1404), Expect = 2.912e-154
Identity = 277/491 (56.42%), Postives = 351/491 (71.49%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEE--------------------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++  ++N Y  +  AL LAF INF+LLFY+V   P  + + +  +   DM                            +  L +S  YM    + L+ LH+  A   +I Y CLKVPLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +K+ + +    I  LLGM+            +P    G   W+    ++ D++Y IWK+GVIFTDN+FLYLG Y V SL+G++N FFFA HLLD+A+  KTLRTIL SVTHNGKQLV+TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4575 FLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGE-DDIEGSGAGDMSGAGSGDGSGWGSRAGEEVEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHNERKPDPPPGLLTWI----MSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 5060          

HSP 4 Score: 108.997 bits (271), Expect = 2.449e-22
Identity = 66/225 (29.33%), Postives = 109/225 (48.44%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTI------KLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K  V     F PRPVET  + +P  +++  +K AE  HE WA  KI   W+YG+N D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  + +        +   ++    GY PQP DL  ++LS  L+ +  QLAEN HN W   + ++      +E       P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2727 YSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQE------LEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAV 2945          

HSP 5 Score: 107.071 bits (266), Expect = 8.309e-22
Identity = 61/202 (30.20%), Postives = 107/202 (52.97%), Query Frame = 2
Query: 9077 DFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERR---RPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKAD------MDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            DF P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L++F  L + ++   ++   E LK ++A G  +     + E + ++    +  ++++GY P P DL  V +T     + ++LAEN HN+WA+ + A       +  I    +  LVP+ +L +  K   R    + ++ L   GY
Sbjct:  858 DFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGY 1059          

HSP 6 Score: 71.633 bits (174), Expect = 4.373e-11
Identity = 50/186 (26.88%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  +G  + ++L+ T       F+ L H  +++D  L    +  + A+   +  +        KT K      + N + P+P++ LN+ +   L++ +N+ AE TH  WA D+I+  WSYG   +  LK  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2650 KLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAH--KKYDQELYRIAMPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGN-FDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2832          

HSP 7 Score: 61.2326 bits (147), Expect = 6.505e-8
Identity = 29/111 (26.13%), Postives = 65/111 (58.56%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI---DADLSRIEMH--GERRR 9391
            + +KP P+D SH+RL  +  +L+D+ A++ H+ WA + V +G+ Y   ++   + +P L+ + LL +  +    + + +A++ ++ +G+ I   D + S+++    G+R R
Sbjct:  971 NGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRAR 1081          
BLAST of Ryanodine receptor related vs. Ensembl Mouse
Match: Ryr2 (ryanodine receptor 2, cardiac [Source:MGI Symbol;Acc:MGI:99685])

HSP 1 Score: 1511.12 bits (3911), Expect = 0.000e+0
Identity = 893/2075 (43.04%), Postives = 1244/2075 (59.95%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQ-GIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA--DLSRIEMHGERRRPTIIND-------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRY-SRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-------AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEK---NLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGL------------YLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEP-ITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQA---SDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+E I         K+A++      +  +   KTL     D E                 E++ D + +G AI+TFY+ L+DLLGRCAPE       K  ++R+R+IL+SL+ + DL GV+S+ F +P      T+ +DG+    D   M  G  P+HKA++VLFL+RVYGI+  +  L LLE  FL D+RAA  LD  +   +D ALALNRYL  +VLPLLT+ +      E  AS++++ LHT YRLS+  SLTK QR+ +   L+++  QL+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   G  G  G A+EEE  L+ +LF GIFD L++  Y+ ELF  ALPCL+A+  AL PDY     + S  +S +   S+    G                              +F PQPVDTS+I +P  LE  ++++A+H HD W+++ +  G++YG   +D +K  P +  + LLS+ ++  Y  P+ E+LK M+AWGW I+   +   + ++   RR +  +        GY+P   D+  V +++++  MAE +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK++ R+   ++ K+LQ +GY                G     LD PS  I++                        RFAY  L +L+RYV++A   + +    SR    + P+ QE   IKFF KVVLPL+++YF  H+ YF+   S        A N+EK+M  +LFCKL  L+R +++  G+D    V CL  L Q +D R ++K   T  D V+  L  F  N A+DL   ++NL   +F+H +   +     +NY  + LLP+L S+F+H+ +   G DL++ DVQV+CY+IL +LY LGT  S Y +R+         R  LGEC+AA A  FP+AFLE+HL+K+N YSI YN        A  +   +E    N+P+L+ ++ EI++LAESG +YT+ P+++EV LPMLCSY+  WW  GPEN  E A         T + ++ +N +LGN+LK+I NN+      WM R+A+ +QPI+      +L  HFLP+ EKLK  A     EE+  +AE +     A  +   +  +   L R+++AFYPLLI++VD +R  W+K+P  + + LF +VAE+F+ WSKS +FKREEQNFV QNEI+++S ++ D     KS+ S++A +D   KK   +  + S  TSL VA +KRLLPIGL++    +QELI  AK R                     K+ + ++ + +++ I L+ + +D    WQ  LYK +       + +    E  ++RVL +A VL  L             LV+HP    K  W KL+S QRKRAV+ACFRM PL++LPRHR VNLFL  Y   W+  EE     +LIE++ +                       P  + P E+                  DPL QLI    RTA+ +     +D LY++YA IM+KSC  E+DDD +E       KS +E+EMEK ++L +Q RL DRGAAEMVL  I   +G    +V  +++LGI++L GGN++VQ +ML +LKEKK +GFF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G     L D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+E M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS ++F  AME  K Y   E E+++ C +++ +  +D+ EF  RFH+PAKDIGFNVAVLLTNL EHMPND RL+  +  A+ ++  F+P+LGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG+KEK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2338 GGNGLLAAMEEAI---------KIAEDPSRDGPSPTSGSSKTL-----DIE-----------------EEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMP------TIAKDGKVVEPD---MSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDY-----MESNYVSMMEKQSSMDSEG------------------------------NFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDIFKFLQISGY------------VVSRGFKDLDLDTPS--IEK------------------------RFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQE---IKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMK---TGLDSVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQ---------RSALGECLAAFAGAFPIAFLETHLDKHNVYSI-YNTRSSRERAALSLPANVEDVCPNIPSLEKLMTEIIELAESGIRYTQMPYMMEVVLPMLCSYMSRWWEHGPENHPERA-----EMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELL---ILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITD----TKSKMSKAAISDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFS------------------LKDTEEEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNR----TEDPSDPERTVERVLGIANVLFHLEQKSKYTGRGYFSLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAK-----------------------PGAELPEEDEA------------MKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEE-----VKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGL---GMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDIIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS 4206          

HSP 2 Score: 1180.24 bits (3052), Expect = 0.000e+0
Identity = 630/1335 (47.19%), Postives = 866/1335 (64.87%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYDTN---------------AIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSP-QHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYA----GNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQ--KSEMEFLRLGLPIKCKDHFT 4036
            E+EI FLRTDD V L      H    + CL+A GFG+R CFLE+ S   N PPDLS+C F+L+Q+LSVRALQE++A   + +               A GG  GH+TLLYGHA+LL+H+ S M+L CLSTS SS DKLAFDVGLQE+   EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  N       V A+FQQTLW+V P+SSG+  + + G + GGDVLRL HG  DECLTVP  +GEH   Q  +V YE GAVS HARSLWRLE ++  WSG  I WG   RLRHVT+G+YLS+    N +  + + +A   STAF  R SK+ K       E D MG+++IK+G++  ++QHV +  WL+Y+A    K       +++A++  EGHMDDG  +++ Q EES++A  IR    +F RFI+ LD    + +  ++  + +  V   L+DLI +F  P+   EHE KQ +L AL+NRQ+LFQEEG+INL+L  ID+    +     F    G +  E +  + N LY LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  SS+RPN+F+GV E SA Y+KWYYE+ +D  E  VT     LRVGW++ EG+ P+PGG + WG   VGDDLFS+GFDG +LW+G   + + +   Q +L   D+I C LDL+ P I F IN +PV+G F +FNIDG+F+P VS SA + VR + GG HG  ++ PP GY+A +EA+LPKE+L++E    +   ++  Y     G + +     F P PV+T++I LP ++E IR++LAENIHE+W M KI+ GW YG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +         ++K +KLP ++  ++GY+P P+DL  I L+   E +V++LAEN HN+WA DRI+QGW+YG  ++   +R+P LVPY  +DD  KKSN+ +  E V+TLL Y Y +E P  D +  A   S            R FRA+ T+ V +G+WY+E E +T G MR GW     +   E+GS+ +++AFD   A +W+  +  YG+  Q GDV+GCM+D+ + T+ F+LNGE+++D  G E+AFK+     G++P  S G  Q  ++NFG DV TLKYFT CGLQEGY PF VN +R + +W S+  P  F+ +   +  +EV    G++   P LK+  K FG Q   +++ F RL +PI+C + F+
Sbjct:    8 EDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQLKTSQWPRIINTAQGG--GHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNS---SWHVDAAFQQTLWSVAPISSGS--EAAQGYLIGGDVLRLLHGHMDECLTVP--SGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKN-LLLMDKEKADVKSTAFAFRSSKE-KLDVGVRKEVDGMGTSEIKYGDSICYIQHVDTGLWLTYQA-VDVKSARMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKLPTID-LPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLH-VYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC-HGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSP-NQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLPKEKLKVEHSREYK--QERTYTRDLLGPTVSLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCS------GTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDLELGSDDRAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLP-QFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNNNTDIMFYRLSMPIECAEVFS 1315          

HSP 3 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 406/1103 (36.81%), Postives = 582/1103 (52.77%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK-------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDIS-C-CAEELKRKINIFHRKLMDNCGIEPPE--GLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENK--NLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHT 7717
            YY+SV + PGQ+   +++GW+TS F               +DT     +      T GD K                    +  S+  S  Y++   + ++        G+  S G+ IGC +D A+G LTF  N +EL   +QV P T L+PA+F + T+     FELGR +N +P+ AG+ +   +   P    RL +Q L    WSR+ N   K+ + +++E +GW +   + +Q M++HIPEE+R +DILEL E  +LL+FH  TL LY  +C  GNH VA +L +H+DE Q  Y I+N Y+ G LR  ++DLLI +HL S++  +L   NE +VP+    +S  +     +K                     H +P    S S+ P +     +   +  +           PE   + LK  +++ L  AV +G+    +P+GG+ E +FVPL+K+   LLIMG+  + D+  IL +++ + FK                          + A    R    +L M L E VKLQ+C LL  LCD Q+RHRIE IV  S+DFV+ +Q++Q  RY E+ Q+ ++ +++TA+ T+EFR PP++Q+  +LNF          KDD S C C EE++ ++  FH  LM +CGIE  E   LD +  L     T R R                        +L+L E+    + K   +    D  K  +L Q+I  T++ WA+ + IE+ +L+R MF LL RQY+ +G +  +L KTY I+  S +D   LL SLG++R LL V++G+ EE L+   L DIMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E+   K      MV  CCRFLCYFCR S QNQK MF+HLSY+LENSS+ LA P++RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+  G+QS   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENAN+VVRLLIRRPEC GPALRG        +    A E  +  +   + +G +   G+S T
Sbjct: 1426 YYYSVRIFPGQEPANVWVGWITSDF-------------HQYDTGFDLDRVRTVTVTLGDEKGK------------------VHESIKRSNCYMVCAGESMS-----PGQGRNNSNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKK---------------------HGLPGIGLSTSLRPRMRFSSPSFVSISNDC------YQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAVPEEEGGTPEKEISIEDAKLEGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTREFRSPPQEQINMLLNF----------KDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGSNDL-----TIRGR------------------------LLSLVEKVTYLKKKQAEKPVASDSRKCSSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEITFPK------MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEG-----GNGLLAAMEEAIKIAEDPSRDGPSPTSGSSKT 2370          

HSP 4 Score: 558.525 bits (1438), Expect = 3.093e-158
Identity = 284/488 (58.20%), Postives = 366/488 (75.00%), Query Frame = 2
Query: 14603 FEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFY-----------EVEQKPSSDPEKMNSTDPDDMEEFI----ILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-EASGSRGWLRKK--------MIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDG-VKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            F  K I     +++ FA+N YN ++ AL +AF INF+LLFY           E+  + SSD  K+ ++        I    +L +S  YM    +ILA LH+  +   +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD+LV++T SFP NYWDKFVK+KV +KY E Y  + I  LLGM++ + + S +R   + K        + + D++Y +WK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD YE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD +PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCW+FFP GDCFRKQYE++L
Sbjct: 4478 FWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRTSSDTAKVTNSLDSSPHRIIAVHYVLEESSGYMEPTLRILAILHTIISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQL 4965          

HSP 5 Score: 105.531 bits (262), Expect = 2.341e-21
Identity = 65/207 (31.40%), Postives = 104/207 (50.24%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID-ADLSRIEMHGERRRPT--IINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDTS I LP  LE + ++ A+++H+ W +  +E G+ YG  R+D  + HP L+ F  L + ++   ++  +E LK ++A G  +  AD    E   + + P    +  GY P P DL  + +T     M +KLAENAHN+WA+ +            +    +  LVP+ +L D+ K   +    E ++ L   GY
Sbjct:  856 SLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGY 1062          

HSP 6 Score: 102.449 bits (254), Expect = 2.205e-20
Identity = 63/211 (29.86%), Postives = 108/211 (51.18%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRL----KTIKLPN----SFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F P+PV+T+ I +P  +E   +K AE+ H+ W+M K+  GW YG+   D +K  P +  ++ L   E++       E+L+T++A G+ I  E   EG  +    +T ++      S   ++GY P+ +D+ N++LS  L  +   +AEN HNIWA  +  +  S G   +      P LVPY+ +    K  +R+ + +  K L    Y +
Sbjct: 2700 FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRI--ERTREGDSMALYNRTRRISQTSQVSIDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNH------PLLVPYDTLTAKEKAKDREKAQDIFKFLQISGYVV 2902          

HSP 7 Score: 75.0998 bits (183), Expect = 3.577e-12
Identity = 35/98 (35.71%), Postives = 62/98 (63.27%), Query Frame = 2
Query: 2990 SFLQSNG-YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            S + S G + PQP+D  NI++   LE  +N+ AE++H+ W+MD++  GW YG + +++ K  P + PY+ + +  K+  R    E++KT+LA+ + IE
Sbjct: 2692 SSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIE 2789          

HSP 8 Score: 66.2402 bits (160), Expect = 2.017e-9
Identity = 33/111 (29.73%), Postives = 66/111 (59.46%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA----DLSRIEM---HGERRR 9391
            +KP P+D S I+L  S E+++D+ A++ H+ WA + + +G+ YG+ ++  N+ +P L+ + LL    +    + + EA++ ++ +G+ ++A      SR E+    GER R
Sbjct:  976 YKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCSGTGERFR 1086          
BLAST of Ryanodine receptor related vs. Ensembl Mouse
Match: Ryr2 (ryanodine receptor 2, cardiac [Source:MGI Symbol;Acc:MGI:99685])

HSP 1 Score: 1510.74 bits (3910), Expect = 0.000e+0
Identity = 893/2075 (43.04%), Postives = 1244/2075 (59.95%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQ-GIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA--DLSRIEMHGERRRPTIIND-------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRY-SRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-------AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEK---NLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGL------------YLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEP-ITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQA---SDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+E I         K+A++      +  +   KTL     D E                 E++ D + +G AI+TFY+ L+DLLGRCAPE       K  ++R+R+IL+SL+ + DL GV+S+ F +P      T+ +DG+    D   M  G  P+HKA++VLFL+RVYGI+  +  L LLE  FL D+RAA  LD  +   +D ALALNRYL  +VLPLLT+ +      E  AS++++ LHT YRLS+  SLTK QR+ +   L+++  QL+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   G  G  G A+EEE  L+ +LF GIFD L++  Y+ ELF  ALPCL+A+  AL PDY     + S  +S +   S+    G                              +F PQPVDTS+I +P  LE  ++++A+H HD W+++ +  G++YG   +D +K  P +  + LLS+ ++  Y  P+ E+LK M+AWGW I+   +   + ++   RR +  +        GY+P   D+  V +++++  MAE +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK++ R+   ++ K+LQ +GY                G     LD PS  I++                        RFAY  L +L+RYV++A   + +    SR    + P+ QE   IKFF KVVLPL+++YF  H+ YF+   S        A N+EK+M  +LFCKL  L+R +++  G+D    V CL  L Q +D R ++K   T  D V+  L  F  N A+DL   ++NL   +F+H +   +     +NY  + LLP+L S+F+H+ +   G DL++ DVQV+CY+IL +LY LGT  S Y +R+         R  LGEC+AA A  FP+AFLE+HL+K+N YSI YN        A  +   +E    N+P+L+ ++ EI++LAESG +YT+ P+++EV LPMLCSY+  WW  GPEN  E A         T + ++ +N +LGN+LK+I NN+      WM R+A+ +QPI+      +L  HFLP+ EKLK  A     EE+  +AE +     A  +   +  +   L R+++AFYPLLI++VD +R  W+K+P  + + LF +VAE+F+ WSKS +FKREEQNFV QNEI+++S ++ D     KS+ S++A +D   KK   +  + S  TSL VA +KRLLPIGL++    +QELI  AK R                     K+ + ++ + +++ I L+ + +D    WQ  LYK +       + +    E  ++RVL +A VL  L             LV+HP    K  W KL+S QRKRAV+ACFRM PL++LPRHR VNLFL  Y   W+  EE     +LIE++ +                       P  + P E+                  DPL QLI    RTA+ +     +D LY++YA IM+KSC  E+DDD +E       KS +E+EMEK ++L +Q RL DRGAAEMVL  I   +G    +V  +++LGI++L GGN++VQ +ML +LKEKK +GFF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G     L D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+E M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS ++F  AME  K Y   E E+++ C +++ +  +D+ EF  RFH+PAKDIGFNVAVLLTNL EHMPND RL+  +  A+ ++  F+P+LGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG+KEK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2338 GGNGLLAAMEEAI---------KIAEDPSRDGPSPTSGSSKTL-----DIE-----------------EEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMP------TIAKDGKVVEPD---MSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDY-----MESNYVSMMEKQSSMDSEG------------------------------NFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDIFKFLQISGY------------VVSRGFKDLDLDTPS--IEK------------------------RFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQE---IKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMK---TGLDSVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQ---------RSALGECLAAFAGAFPIAFLETHLDKHNVYSI-YNTRSSRERAALSLPANVEDVCPNIPSLEKLMTEIIELAESGIRYTQMPYMMEVVLPMLCSYMSRWWEHGPENHPERA-----EMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELL---ILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITD----TKSKMSKAAISDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFS------------------LKDTEEEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNR----TEDPSDPERTVERVLGIANVLFHLEQKSKYTGRGYFSLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAK-----------------------PGAELPEEDEA------------MKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEE-----VKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGL---GMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDIIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS 4206          

HSP 2 Score: 1180.24 bits (3052), Expect = 0.000e+0
Identity = 630/1335 (47.19%), Postives = 866/1335 (64.87%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYDTN---------------AIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSP-QHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYA----GNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQ--KSEMEFLRLGLPIKCKDHFT 4036
            E+EI FLRTDD V L      H    + CL+A GFG+R CFLE+ S   N PPDLS+C F+L+Q+LSVRALQE++A   + +               A GG  GH+TLLYGHA+LL+H+ S M+L CLSTS SS DKLAFDVGLQE+   EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  N       V A+FQQTLW+V P+SSG+  + + G + GGDVLRL HG  DECLTVP  +GEH   Q  +V YE GAVS HARSLWRLE ++  WSG  I WG   RLRHVT+G+YLS+    N +  + + +A   STAF  R SK+ K       E D MG+++IK+G++  ++QHV +  WL+Y+A    K       +++A++  EGHMDDG  +++ Q EES++A  IR    +F RFI+ LD    + +  ++  + +  V   L+DLI +F  P+   EHE KQ +L AL+NRQ+LFQEEG+INL+L  ID+    +     F    G +  E +  + N LY LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  SS+RPN+F+GV E SA Y+KWYYE+ +D  E  VT     LRVGW++ EG+ P+PGG + WG   VGDDLFS+GFDG +LW+G   + + +   Q +L   D+I C LDL+ P I F IN +PV+G F +FNIDG+F+P VS SA + VR + GG HG  ++ PP GY+A +EA+LPKE+L++E    +   ++  Y     G + +     F P PV+T++I LP ++E IR++LAENIHE+W M KI+ GW YG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +         ++K +KLP ++  ++GY+P P+DL  I L+   E +V++LAEN HN+WA DRI+QGW+YG  ++   +R+P LVPY  +DD  KKSN+ +  E V+TLL Y Y +E P  D +  A   S            R FRA+ T+ V +G+WY+E E +T G MR GW     +   E+GS+ +++AFD   A +W+  +  YG+  Q GDV+GCM+D+ + T+ F+LNGE+++D  G E+AFK+     G++P  S G  Q  ++NFG DV TLKYFT CGLQEGY PF VN +R + +W S+  P  F+ +   +  +EV    G++   P LK+  K FG Q   +++ F RL +PI+C + F+
Sbjct:    8 EDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGG--GHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNS---SWHVDAAFQQTLWSVAPISSGS--EAAQGYLIGGDVLRLLHGHMDECLTVP--SGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKN-LLLMDKEKADVKSTAFAFRSSKE-KLDVGVRKEVDGMGTSEIKYGDSICYIQHVDTGLWLTYQA-VDVKSARMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKLPTID-LPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLH-VYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC-HGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSP-NQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLPKEKLKVEHSREYK--QERTYTRDLLGPTVSLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCS------GTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDLELGSDDRAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLP-QFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNNNTDIMFYRLSMPIECAEVFS 1315          

HSP 3 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 406/1103 (36.81%), Postives = 582/1103 (52.77%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK-------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDIS-C-CAEELKRKINIFHRKLMDNCGIEPPE--GLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENK--NLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHT 7717
            YY+SV + PGQ+   +++GW+TS F               +DT     +      T GD K                    +  S+  S  Y++   + ++        G+  S G+ IGC +D A+G LTF  N +EL   +QV P T L+PA+F + T+     FELGR +N +P+ AG+ +   +   P    RL +Q L    WSR+ N   K+ + +++E +GW +   + +Q M++HIPEE+R +DILEL E  +LL+FH  TL LY  +C  GNH VA +L +H+DE Q  Y I+N Y+ G LR  ++DLLI +HL S++  +L   NE +VP+    +S  +     +K                     H +P    S S+ P +     +   +  +           PE   + LK  +++ L  AV +G+    +P+GG+ E +FVPL+K+   LLIMG+  + D+  IL +++ + FK                          + A    R    +L M L E VKLQ+C LL  LCD Q+RHRIE IV  S+DFV+ +Q++Q  RY E+ Q+ ++ +++TA+ T+EFR PP++Q+  +LNF          KDD S C C EE++ ++  FH  LM +CGIE  E   LD +  L     T R R                        +L+L E+    + K   +    D  K  +L Q+I  T++ WA+ + IE+ +L+R MF LL RQY+ +G +  +L KTY I+  S +D   LL SLG++R LL V++G+ EE L+   L DIMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E+   K      MV  CCRFLCYFCR S QNQK MF+HLSY+LENSS+ LA P++RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+  G+QS   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENAN+VVRLLIRRPEC GPALRG        +    A E  +  +   + +G +   G+S T
Sbjct: 1426 YYYSVRIFPGQEPANVWVGWITSDF-------------HQYDTGFDLDRVRTVTVTLGDEKGK------------------VHESIKRSNCYMVCAGESMS-----PGQGRNNSNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKK---------------------HGLPGIGLSTSLRPRMRFSSPSFVSISNDC------YQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAVPEEEGGTPEKEISIEDAKLEGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTREFRSPPQEQINMLLNF----------KDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGSNDL-----TIRGR------------------------LLSLVEKVTYLKKKQAEKPVASDSRKCSSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEITFPK------MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEG-----GNGLLAAMEEAIKIAEDPSRDGPSPTSGSSKT 2370          

HSP 4 Score: 558.525 bits (1438), Expect = 3.225e-158
Identity = 284/488 (58.20%), Postives = 366/488 (75.00%), Query Frame = 2
Query: 14603 FEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFY-----------EVEQKPSSDPEKMNSTDPDDMEEFI----ILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-EASGSRGWLRKK--------MIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDG-VKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            F  K I     +++ FA+N YN ++ AL +AF INF+LLFY           E+  + SSD  K+ ++        I    +L +S  YM    +ILA LH+  +   +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD+LV++T SFP NYWDKFVK+KV +KY E Y  + I  LLGM++ + + S +R   + K        + + D++Y +WK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD YE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD +PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCW+FFP GDCFRKQYE++L
Sbjct: 4478 FWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRTSSDTAKVTNSLDSSPHRIIAVHYVLEESSGYMEPTLRILAILHTIISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQL 4965          

HSP 5 Score: 105.531 bits (262), Expect = 2.503e-21
Identity = 65/207 (31.40%), Postives = 104/207 (50.24%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID-ADLSRIEMHGERRRPT--IINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDTS I LP  LE + ++ A+++H+ W +  +E G+ YG  R+D  + HP L+ F  L + ++   ++  +E LK ++A G  +  AD    E   + + P    +  GY P P DL  + +T     M +KLAENAHN+WA+ +            +    +  LVP+ +L D+ K   +    E ++ L   GY
Sbjct:  856 SLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGY 1062          

HSP 6 Score: 102.449 bits (254), Expect = 2.261e-20
Identity = 63/211 (29.86%), Postives = 108/211 (51.18%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRL----KTIKLPN----SFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F P+PV+T+ I +P  +E   +K AE+ H+ W+M K+  GW YG+   D +K  P +  ++ L   E++       E+L+T++A G+ I  E   EG  +    +T ++      S   ++GY P+ +D+ N++LS  L  +   +AEN HNIWA  +  +  S G   +      P LVPY+ +    K  +R+ + +  K L    Y +
Sbjct: 2700 FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRI--ERTREGDSMALYNRTRRISQTSQVSIDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNH------PLLVPYDTLTAKEKAKDREKAQDIFKFLQISGYVV 2902          

HSP 7 Score: 75.0998 bits (183), Expect = 3.608e-12
Identity = 35/98 (35.71%), Postives = 62/98 (63.27%), Query Frame = 2
Query: 2990 SFLQSNG-YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            S + S G + PQP+D  NI++   LE  +N+ AE++H+ W+MD++  GW YG + +++ K  P + PY+ + +  K+  R    E++KT+LA+ + IE
Sbjct: 2692 SSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIE 2789          

HSP 8 Score: 65.855 bits (159), Expect = 2.051e-9
Identity = 33/111 (29.73%), Postives = 66/111 (59.46%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA----DLSRIEM---HGERRR 9391
            +KP P+D S I+L  S E+++D+ A++ H+ WA + + +G+ YG+ ++  N+ +P L+ + LL    +    + + EA++ ++ +G+ ++A      SR E+    GER R
Sbjct:  976 YKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCSGTGERFR 1086          
BLAST of Ryanodine receptor related vs. UniProt/SwissProt
Match: sp|Q24498|RYR_DROME (Ryanodine receptor OS=Drosophila melanogaster OX=7227 GN=RyR PE=1 SV=3)

HSP 1 Score: 2057.34 bits (5329), Expect = 0.000e+0
Identity = 1136/2589 (43.88%), Postives = 1604/2589 (61.95%), Query Frame = 2
Query:  125 DEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSL--SKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAM--GEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEG--VLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVV-QQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNS-FLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLES-GPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCD-MGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIF-GVQKSEMEFLRLGLPIKCKDHFTTKSLQER------HASIELMRRQLDPIQVPT-TQDLILEQM----------------------------------PSYPGTLNRNLT------KNLQNM--SSSTLDINKKGKKM----RLGKNPFK--KNRSRDASPDIVAGTT---------TKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGML-RRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDM--CPEINYERLKNISLKELANAVN-KGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTR-SILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNC---GIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFER-RPIEES-KLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRA 7624
            +++++SFLRT+D V LS    G  +R CL+A GFG+R CFLEN++ +N PPDLS CVF+++QALSVRALQE+V         G  SGH+TLLYG+A+LL+H  S+M+L+CLSTSSS DKL+FDVGLQE +  EACWWTVHPA+KQRSEGEKVR+GDDLILVSV++ERYLH T +N ++I   V ASF  T W+V P  +G  R K +G VFGGDVLR FHG DECLT+P + G  + Q+  V+YE G V + ARSLWRLEL +TKW+GGFI W    R+RH+T+GRYL V+ S NE+  V + +A  ++T F +RQ KDD+K   E+ + + +GS  IK+G+TTV +QH  ++ WLSY++YE KK+GVGKVEEKQA++  EG MDD    ++ Q+EESK+A  IR+C+S+FT+FI  L E +   +R S+   K+NL+E++ CLEDLI++F +P  D EHE KQ +  ALRNRQDLFQEEG++NL+L  IDK        + F+ +   G++  + +D +S YLY LLAA+I+GN  NCAQFA  +R++W+F RL S  S+EG  +LDVLHCVL DS EALN++ D HI+++I LL+K GRDP+VL VLCSLC+G  G AVR +Q  I D LLP ++LLLQT LVD  +S+RPN+F+G  + S+ YQKWY+E+ +D IE  T+    LR+GW+N  G+ P+PGG + WG   VGDDL+SFGFDG  LWTGG+   + + + ++P +  GD+IG  +DL+VP+I F  N   V+G FRDFN+DGMF+P +S S+K+S R +FGG HGRL++ PP G+SA+ + L+P++ L L+PCF FGNL K++ AG    +++  F+P+PV+T  + LP+ V+ I++KLAENIHEMWA+ KI+ GW++G++RDD ++ HPCLT FE+LP  E+++D  LA +TL+TI++LGY I  + P   +R++ ++LPN  F+Q NGY+P PLDL  ++L+  LE LV+QLAENTHN+WA +RI+QGW+YG  E++   RSPHLVPY KVD++IKK+NR T+ ETV+TLL Y Y ++ P  + +E  ++ +    +R   +  RT+R +  + VTSGKWY+E E+LT G MR GW   D   G  +GS   S+AFD  + TK +  S   +G   + GDVIGC +D+++QTI+FSLNGEL+MD +G E  F +++ + +G+VP  + G GQ A+L +G DV +LK+FT CGLQEGY PFCVNM RPV  WY+++ P      +  + +++V    G     P LK+    F  ++K+  EFLRL LP+ C   F ++  + R      +    LMR      Q+   TQ   ++ M                                  P   G+L RN+T        L  M  S+S LD+N  G++M    + G++PFK    +SRD S + +   T         T +   +V          T  L+      + +   G   ++ S +          ++ +   ++L+++Y++ V + PGQD   +++GWVT+ + L                                S+E N   V   ++  +E+D  +    +D     +  AD L N   QD  GK  SQG+ +GCF+D ATG + F    ++    + + P T L+PA+FV+ T++E    ELGRT  TLP+ A +L    +   P    RLK+Q L+   W+RV N   ++H LKL++VRGWS+L E+ V M+A+HIPEEDRC+DILEL E  +LL FH  +L LY  +C   N+  A +L  H+D+ Q  Y I++ Y+ G LR  F+DLLIA+HLESH+      +NE + PL   L+         + Y + +      S + E       +  Q     I P +I+   T  M   + E I P +D    P+   E ++   ++ L +AV        +PIG + EN+F+PL+K+ D LL++G++   D+  +L ++D  T+            R  +L M + E  KLQ+C+LLH L D QLRHR+E I+  S+DFV ++Q DQLRRY+EIKQSDLPS+V AK TKEFRCPP +QM  IL F         +  D   C  EL+ ++  FH  LM       ++ P+G++   +                       EE ++ P  +  I N     + +EE  K   E  K    +   +V+  T+++WA+ + IEN  L+REMFSLL RQY+ +GE+  +L+KTYVI+ +++DDV ++   L ++R LL VQ+ + EE L++  LW ++NN  FFQHP+L R L VHE VM +M++TL R     +D                                  P   E       K+ D   EMVV CCRFLCYFCRT  QNQK MF+H  ++L+N+++LLARPSLRG+ PLDVAYSSLM+N ELALA+RE  LEK+AVYLSR G+QSN EL+ KGYPD+GWDPVEGER+LDFLR+ VWVNGE +EENANLV+RLLIRRPECLGPALRG    + RA
Sbjct:    9 EQDDVSFLRTEDMVTLSCTATG--ERVCLAAEGFGNRHCFLENIADKNVPPDLSQCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKENEQSI---VNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAGQN-IVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDS-NELILVKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYKSYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITAL-ETLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEEGVLNLILEAIDKIN--IITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQFANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVG-NGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGSSMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFDGAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDFNLDGMFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLAKNVLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPP--ARIRPVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEA----QRLKFAGFRTYRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFADVTAEGVGFVPACTLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMPDCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWDEIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMMRGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFSKKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQ-GPKQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLH-------------------------------SREFNKNKVRRGSV-YIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGCFVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLALHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELK---------ELYSDEEMQHSLRSLVTE------SVRPQLRMTEITPPVIA---TSSMPSVSSEPI-PDIDQLYSPKFPLEVVRQFVMEALKDAVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREGKDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFK----NLEPDDQDNCTCGLELRGRLGDFHDSLMQKVSLNALQEPDGVEGTAI-----------------------EEVKTGP--ITKIYNFINTVKELEEGPKEVEEPEKKTPEEVFRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSD---------------------------------APTQSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLFRA 2466          

HSP 2 Score: 1733.38 bits (4488), Expect = 0.000e+0
Identity = 958/2103 (45.55%), Postives = 1341/2103 (63.77%), Query Frame = 2
Query: 7964 NF-HNLPP-EDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSST-GMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSL-APGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMH--GERRR---PTI---INDG----YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFN------EEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSY--------TSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKIGKAKFVDSSESVSK-------------EIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS----DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTK----SLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITS----------LLNWTNVKHSWKFLRSVSVKDIVVGVFR 14077
            NF H LP  E+D DY+D GAAIL FY  LVDLLGRCAP+    +  K+ SLR RAIL+SLV +EDL+GVLSL+F         T+++    E K K+ MP GLLP +K S+VLFLERVYGI+  + F RLLE+AFL D+R AT+LD     +SD ALA+NRY+GNS+LPLL KHS +  E E  AS+L+ TLHT YRLS+ R LTKGQRE VSDFLVALT Q+QP M+ KLLRKL +DV  L+  + V LRLLT  + RC  YY ST G    G +++EEK+LT  LFS IFD+L+ + YDPELF KALPCL AIGCAL PDYS            +  ++ +   G+ + AP  P                       + P P+DT+++ L N L SL+ +F++H HD+WA   +E G+ YG  R+D ++ HP L  +++LS+ ++ +Y +PV E LK ++A GWT++     + ++  G  RR   P I    N+G    YNP+P D+  + +++EM +MAE+LAEN+H+IWA+ K  +++  GG +H  LVP+++LTDKEK + R+ + E LKY+QY GY+                     L +PS           K      G  ++ + E  RF+Y LL KL++Y+++A + ++ ++PS+ +SR   F   T DIKFF KVVLPL+E+YF  H+NYF+   +   N      +EK+M A++FCKL +LLR +L+A G D+ I+VRCLQ LV+ ID R + K      +F+R  +L FF   +DDL   + NL   ++SHL+GT  + + SL Y++ V+LPVL +MFDH++  + G DLL+ ++QVA YKIL ALY LGT  +   DR+ +  E  RHRP LG C+ A +  FPVAFLE HLNK+N+YS+L N   ++SLEA++I+ ++E  +PNL+ I+ E+    ES   Y +APH+I+V LP+LC+YLP WWS+GP+N+   +        VT VTA  +N +L NVLK+I+ NI + +APWMTRIA  TQ I+ N +  +L + FLP+AE++K        +E+  +   KS ++  +++E +L +   +LVR++++FYPLLIKYVDL R  W+K    + + L+  VAEIF IWSKS +F +EEQNF+  NEID+++LIMP   +  +S  S  A   ++G K   +K               SL VAC+KRLLP+GL++F GREQEL+Q  K R +                  +K  + D+ E+ +N + L ++ D   ++ WQ  LY K+GK +     +++ K             +  + R++ +AKVL GL+++DHP    K  ++ ++S QRKRAV+ACFR   LHSLPRHR  N+F  +Y   WL  E      ++E++T++ +D E                    K  +E  E DS+           PDPL+QL+T   R AM + S    +D LY+SYA I +KS   E+++  DE  G+ G +    S+ EQEMEK ++L  Q RLS+RG AEMVLL I   +G+ + +V  ++ LGI++L GGN  +Q  ML  LKEKK +GFF SI+GLM  CSVLDLD FER  KAEGL  G      G  N++DAEFTC LFRF+QL CEGHNL +Q+YLR+QAGNTTTVN++ICTVDYLLRLQESIMDFYWHY+ K+ ID AGK N  KAI++  Q+F TLTE IQGPC  NQ ALAHSRLWDA+ GFLF+F+HMQDKLSK   Q++LL+E + LQK+M+ M+LSMLEGNVVNG IGKQMVDTLVES++NVE+ILK+FD+FL++ D+  S +F   D+  +GW++ K+FR  MEQ K Y PEE+++++ C + N++GK+D+  F + FH+P+K+IGFN+AVLLTNL EHMPN+ RL R +  A  ++  FEP+LGRIEI G S RIERVYFEI+ S+I+QWEKPQI++SKR+F +S+V EGGDKEKLE+FVNFCED I+EM H+  +    +G   ++         + +            +IT+          +L+  N+KH    +++ S+ +++VG F+
Sbjct: 2495 NFTHPLPEGEEDEDYIDTGAAILNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKF---------TLSQTAPGEEKPKSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYS------------LSKNTDEDYYGRQMGAPDQP----------------------QYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYK---------------------LHKPS-----------KGGAVEEGGATQAAVEL-RFSYSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGIDARTLTK---NCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHRPALGSCLGAYSSCFPVAFLEPHLNKHNQYSLL-NRIADHSLEAQDIMVKMESCMPNLETILAEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNH-----VTMVTADHMNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPT--ATRRSAISEGA--PAVGGKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYL------------------KKMPEYDVIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQETVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACNIFARSYYEQWLQEENVGQEVMVEDLTQTFEDSE--------------------KSKKEGEETDSK-----------PDPLTQLVTTFCRGAMTERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGS-EGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPANIKHQIGVMQTKSIPELIVGFFK 4458          

HSP 3 Score: 576.244 bits (1484), Expect = 1.038e-162
Identity = 313/500 (62.60%), Postives = 369/500 (73.80%), Query Frame = 2
Query: 14609 MKKIDTGTYI---ISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ------------------------------KPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            + +ID   Y    +S  A+N YN K  ALVLAF INFMLLFY+V                                  S D    +    D++ E + +++   YM  + +I A LHS  +L+MLIAYY LKVPL +FKREKEI+R LEFEG++I EQP DD+ K+HWDKLV+S  SFP NYWDKFVKKKVR KYSE YDF+ I NLLGM       Q SE +G    + K ++  D +Y +WK GV FTDNAFLY   YF  S++GNFN FFFA HLLDVA+ FKTLRTILQSVTHNGKQLVLTVML ++I+Y+YTVIAFNFFRKFYI++ D   D KCH+MLTCFVFHL+ G+RAGGGIGDEI  PDGD YE YRI+FDITFFFFVI+ILLAIIQGLIIDAFGELRDQLE VK++MES CFICG+GK++FD +PHGF+ HV+KEHN ANYM+FLMH+INKPDTEYTGQETYVW +YQQR WDFFPVGDCFRKQYE+EL
Sbjct: 4625 VHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTEEADSSAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHVLRIAACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETG----IFKYIMNIDWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRSWDFFPVGDCFRKQYEDEL 5120          

HSP 4 Score: 121.324 bits (303), Expect = 2.776e-25
Identity = 70/242 (28.93%), Postives = 125/242 (51.65%), Query Frame = 2
Query: 2591 LEPCFSFG-NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYE-----MPSEGSRLKTIKLPNSFLQSNG----YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETP 3286
            L P +S   N ++  Y       +   ++P P++TN + L N + ++  K +E+ H+ WA ++++ GWTYG  R D ++ HP L  +  L   ER+       E L+ ++A+G+T+ +      +   GS  +  K   +  Q+ G    Y P P+D+ N++LS  ++ +  +LAEN+H+IWA  + ++    G V +      P LVPY+ + D  KK +R+ S E +K +    Y +  P
Sbjct: 2804 LPPDYSLSKNTDEDYYGRQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKPQINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVIH------PQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKP 3039          

HSP 5 Score: 103.99 bits (258), Expect = 4.795e-20
Identity = 62/206 (30.10%), Postives = 110/206 (53.40%), Query Frame = 2
Query: 9071 DDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGW--TIDADLSRIEMHGERRRPTII---NDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIG------GGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            D  F P+PVDT+ + LP+S++ + ++ A+++H+ WAL  +E G+ +G  R+D ++ HP L  F+ L   ++    +  ++ LK +I+ G+  T+D   +RI      R P  I    +GY P P DL  V +T ++ ++ ++LAEN HN+WA+ +     + G            LVP+  + +  K   R   +E ++ L   GY
Sbjct:  851 DTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHRDDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIR---PVRLPNEIFMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGY 1053          

HSP 6 Score: 68.5514 bits (166), Expect = 2.300e-9
Identity = 30/97 (30.93%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 3011 YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVS 3301
            Y P P+D  N+ L + L +LV + +E+ H+ WA  R++ GW+YG + ++  ++ P L PY  + +  ++  R    E +K LLA  +++E    +V+
Sbjct: 2831 YMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDNDRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVA 2927          

HSP 7 Score: 62.3882 bits (150), Expect = 1.682e-7
Identity = 25/90 (27.78%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            +KP P+D S + L   LE L+DQ A++ H+ WA E +++G+ YG+  +  N   P+L+ +  + +  +    +   E ++ ++ +G+ +D
Sbjct:  967 YKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRSPHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLD 1056          
BLAST of Ryanodine receptor related vs. UniProt/SwissProt
Match: sp|E9PZQ0|RYR1_MOUSE (Ryanodine receptor 1 OS=Mus musculus OX=10090 GN=Ryr1 PE=1 SV=1)

HSP 1 Score: 1692.94 bits (4383), Expect = 0.000e+0
Identity = 1010/2558 (39.48%), Postives = 1447/2558 (56.57%), Query Frame = 2
Query:  137 ISFLRTDDHVCL--SSVGHGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSG-HKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRS---SLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKAL-LRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFG--NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLG--------KNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIY-PNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK---------------------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRY-VEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            + FLRTDD V L  S+       + CL+A GFG+R CFLE  S  +N PPDL++C FIL+Q+LSVRALQE++A   +      Q G H+TLLYGHA+LL+H  S M+LSCL+TS S  DKLAFDVGLQE+A  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P+ SG       G V GG VLRLFHG  DECLT+  S+ +   Q   V YE G V +HARSLWRLE ++  WSG  + WG   R+RHVT+GRYL ++     +  V  S+A   +T+F  R SK+ K     + + + MG  +IK+GE+  F+QHV+S  WL+Y A    K     V +K+A++  EGHMDD  ++ + Q EES++A  I   A ++ +FI+ LD +  + + S   + S + +  VI  L+DLI +F  P+ + +HE KQ KL +LRNRQ LFQEEG+++L+L  ID+             A  E  + W  ++ N LY LLA++IRGNR NCA F+  + +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP R+LLLQT L++  +S+RPN+F+G  E S  Y KWY+E+ +D +      +A  LRVGW+ +EG+ P+PGG +GWG   VGDDL+S+GFDG +LWTG   + + +  Q  +L   D++ C LDL+VP I F IN  PV+G F  FN+DG+F+P VS SA + VR + GG HG  ++ PP GY+   EA+LP+ERL L+P   +           G S    ++ F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +          LK  KLP +++ SNGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGWSY  V++   +R+P LVPY  +D++ K+SNR +  + V+TLL Y Y+IE P  + S++   +       +G  A R FRA+ ++ V SG+WY+E E +T G MR GW   +     E+G++  +Y F+     +W+L S P+G+  Q GDV+GCM+DL + TI F+LNGE++M   G E AF+++    G++P  S GPGQ   LN G DV +L++F  CGLQEG+ PF +NM RPV  W+S+  P  F  +  E+   EV    G+V   P L+L  + +G Q S  EM FLRL LP++   HF   +     AS         P   P  +D   E   + P T   NL ++      +    +   K+   G          P +    +DA       TT K+KK                +     S+  L  L +  +     DD     PE+ L   +       YY+SV V  GQ+   +++GWVT  +            + SFD                         V  VT+   +   ++ SS+  S  Y++   D    F +    G+     + IGC +D ATG +TF  N +E    FQV P T L+PA+FV PT +    FELG+ +N +P+ A M    R+   P    RL++QML    WSR+ N   ++   +  E  GW++  +E + MMA+HIPEE+RC+DILEL E   L RFH  TL LY+++C  GN+ VA +L +H+D+ Q  + +++  L G LR  ++DLLI++HLES  R +    +E +VPL    ++  +           ++               H +P    + S+  P+  S    +  L   G    P   + P I  E L++ +L+ L  AV  G Q   +P+GGS E  FVP+LK+V  LL+MG+    D+  IL +++   F+                                                +   +L M L ESVKLQ+CHLL   CD +L+HR+E +   +  +V  +Q +Q  RY + +K   + ++ TA+ T+EFR PP++Q+  +L+F   +       D+  C   EE+++++  FH+ L+ +CGI+    L+  E   +   T  SR + LL          E +    +           EE        +  + ++L +++  T++ WA+  F+++ +L+R MFSLL RQY+ LGE+  +L + Y IS  S +D   LL  LG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E++  K      MV  CCRFLCYFCR S QNQ++MF+HLSY+LENS + L    ++G+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LL+KGYPDIGW+P  GER+LDFLRF V+VNGE +EENAN+VVRLLIR+PEC GPALRG
Sbjct:   12 VQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPICSGC----EEGFVTGGHVLRLFHGHMDECLTISPSDSDD--QRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLGLT-EDQGLVVVDASKAHTKATSFCFRISKE-KLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA-PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDSFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQEEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESW-KEIVNLLYELLASLIRGNRTNCALFS--TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYGKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHVARPVTSPGQH-LLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHLVGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQS-------RGDRA-RIFRAEKSYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLP-QFEPVPLEHPHYEVARMDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAS---------PGLQPPAED---EARAAEPDTDYENLRRSAGGWGEAEGGKDGTAKEGTPGGTAQAGVEAQPARAENEKDA-------TTEKNKKRGF-----LFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDD-----PEIILNTTT-------YYYSVRVFAGQEPSCVWVGWVTPDYH---------QHDMSFDLS----------------------KVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD----FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRRAGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNNRVAHALCSHVDQAQLLHALEDARLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPGRSAEDGPRR---------------HGLPGVGVTTSLRPPHHFSPPCFVVALPAAGATEAPA-RLSPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDEDVKQILKMIEPEVFREEEEVEEEGEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEDAAEEEKEELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAECYVDKMQGNQRGRYGLLMKAFTMSAAETARRTREFRSPPQEQINMLLHFKNGA-------DEEECPLPEEIRQELVNFHQDLLAHCGIQ----LEGEEEEPEEESTLGSRLMSLL----------EKVKLVKKT----------EEKPEEEPAPEEHKPQSLQELVSHTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISVSSVEDTMSLLECLGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEIRFPK------MVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLG---MQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENANVVVRLLIRKPECFGPALRG 2371          

HSP 2 Score: 1419.83 bits (3674), Expect = 0.000e+0
Identity = 862/2076 (41.52%), Postives = 1236/2076 (59.54%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIIN---------DGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYV---EQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSN-NKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSC--SXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAA----GGLYDLQ-GITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL A++E I +S                   E+P +   P +  D    +   E        PPE++   V LG AI++FY+ L+DLLGRCAPE       K  +LR+RAIL+SLV ++DL G++SL   +P      T+ +DG      +  M    +P+HKAS+VLFL+RVYGI++ +  L +L+  FL DMRAA  LD  +   ++ ALALNRYL  +VLPL+TK +      E  A ++++ LHT YRLSR RSLTK QR+ + D L+AL + ++P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIFD+LA   YD EL+  A+PCL AI  AL PDY               S+S+++                E++  V+A       + +F P+PV+T ++ +P  L+S +++FA++ H+ WA + ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++      E   E+++   I+         +GYNP P DL  V +++E+  MAE+LAEN HN W + KK ++++ GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                G     LD                          TSS   RFA+  L +LLR++   ++ I  ++ +  S R  ++ P  QE   IKFF K++LPL+ +YF  H  YF+       G    A N+EK+M  +LFCKL +L+R +++  G D    V CL  L +++D R ++K   +  + V+  L  FF + ++D+  +++NL + + S  +  V+    +L Y  + LLPVL ++F H+++   G D+++ DVQV+CY+ L ++Y LGT  + Y ++          RP LGEC+A +A   PVAFLE  LN+ N  S+        S   R ILG      E+  ++P L+ ++ EI  LAESG +YTE PHVIE+TLPMLCSYLP WW RGPE               T VT+  +N++LGN+L++I NN+    A WM R+A+  QPIV  A   +L  HF+P   +L+  A +   EEE  + E K+ +E    +   +  +  +L R+++A YPLLI+YVD +R  W+ +P  + + LF +V EIF+ WSKS +FKREEQNFV QNEI+++S +  D  S   K+   +S  +D    K   R  + S  TSL VA +K++LPIGL+M    +Q+LI  AK R                     K+ D ++ E+L+N ++L+ + +    + WQ  LY+ + G+ +  D  E +     ++RV  ++ VL+ L   +HP    K  W KL+S QR+RAV+ACFRM PL++LP HR  N+FL +Y++ W L+ +     R+I+++                                  S+   +   E       PDPL QL+    RTA+ + S   +D LY++YA IM+KSC      ++ ++ GE +E   S +E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   A+V  +++LGIS+L GGN  VQ +ML +LK+KK +GFF SI  LMQ CSVLDL+ FER NKAEGL      G + + Q G   + D EFT  LFRFLQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD I+  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ELL+E + LQK+M++MLLS+LEGNVVNG I +QMVD LVESS+NVEMILKFFD+FL++KDI  SEAF  +  +  G IS K+F+ AM+ QK +   EI++++ C +++ +  ++  EF +RF +PA+DIGFNVAVLLTNL EH+P+D RL   +  A+ ++E F PYLGRIEI G S RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FV+FCEDTI+EMQ + +IS
Sbjct: 2373 GGSGLLAAIEEAIRIS-------------------EDPARDG-PGVRRDRRREHFGEE--------PPEEN--RVHLGHAIMSFYAALIDLLGRCAPETHLIQAGKGEALRIRAILRSLVPLDDLVGIISLPLQIP------TLGKDGA---LVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIAMPCLCAIAGALPPDYVDA------------SYSSKT----------------EKKATVDA-------EGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGY------------AVTRGLKDMELD--------------------------TSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILARSLDARTVMK---SGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVEK---------LRPALGECLARLAAAMPVAFLEPELNEYNACSVYTT----KSPRERAILGLPNSVEEMCPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAPPP-CTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELL---VRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNPNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR------------------YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKI-----VRRVQEVSAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKASWILTEDHSFEDRMIDDL----------------------------------SKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENGEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMEMFVSFCEDTIFEMQIAAQIS 4255          

HSP 3 Score: 545.428 bits (1404), Expect = 2.060e-153
Identity = 277/491 (56.42%), Postives = 351/491 (71.49%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEE--------------------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++  ++N Y  +  AL LAF INF+LLFY+V   P  + + +  +   DM                            +  L +S  YM    + L+ LH+  A   +I Y CLKVPLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +K+ + +    I  LLGM+            +P    G   W+    ++ D++Y IWK+GVIFTDN+FLYLG Y V SL+G++N FFFA HLLD+A+  KTLRTIL SVTHNGKQLV+TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4549 FLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGE-DDIEGSGAGDMSGAGSGDGSGWGSRAGEEVEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHNERKPDPPPGLLTWI----MSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 5034          

HSP 4 Score: 108.997 bits (271), Expect = 1.755e-21
Identity = 66/225 (29.33%), Postives = 109/225 (48.44%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTI------KLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K  V     F PRPVET  + +P  +++  +K AE  HE WA  KI   W+YG+N D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  + +        +   ++    GY PQP DL  ++LS  L+ +  QLAEN HN W   + ++      +E       P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2720 YSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQE------LEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAV 2938          

HSP 5 Score: 107.071 bits (266), Expect = 5.907e-21
Identity = 61/202 (30.20%), Postives = 107/202 (52.97%), Query Frame = 2
Query: 9077 DFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERR---RPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKAD------MDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            DF P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L++F  L + ++   ++   E LK ++A G  +     + E + ++    +  ++++GY P P DL  V +T     + ++LAEN HN+WA+ + A       +  I    +  LVP+ +L +  K   R    + ++ L   GY
Sbjct:  851 DFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGY 1052          

HSP 6 Score: 71.633 bits (174), Expect = 3.109e-10
Identity = 50/186 (26.88%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  +G  + ++L+ T       F+ L H  +++D  L    +  + A+   +  +        KT K      + N + P+P++ LN+ +   L++ +N+ AE TH  WA D+I+  WSYG   +  LK  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2643 KLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAH--KKYDQELYRIAMPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGN-FDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2825          

HSP 7 Score: 60.8474 bits (146), Expect = 4.665e-7
Identity = 29/111 (26.13%), Postives = 65/111 (58.56%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI---DADLSRIEMH--GERRR 9391
            + +KP P+D SH+RL  +  +L+D+ A++ H+ WA + V +G+ Y   ++   + +P L+ + LL +  +    + + +A++ ++ +G+ I   D + S+++    G+R R
Sbjct:  964 NGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRAR 1074          
BLAST of Ryanodine receptor related vs. UniProt/SwissProt
Match: sp|F1LMY4|RYR1_RAT (Ryanodine receptor 1 OS=Rattus norvegicus OX=10116 GN=Ryr1 PE=1 SV=1)

HSP 1 Score: 1607.04 bits (4160), Expect = 0.000e+0
Identity = 988/2561 (38.58%), Postives = 1420/2561 (55.45%), Query Frame = 2
Query:  137 ISFLRTDDHVCL--SSVGHGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSG-HKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRS---SLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKAL-LRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFG--NLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLG--------KNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDR----CLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF---------------------------------------KSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRY-VEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            + FLRTDD V L  S+       + CL+A GFG+R CFLE  S  +N PPDL++C FIL+Q+LSVRALQE++A   +      Q G H+TLLYGHA+LL+H  S M+LSCL+TS S  DKLAFDVGLQE+A  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +GE     V ASF QTLW + P+ S        G V GG VLRLFHG  DECLT+  S+ +   Q   V YE G V +HARSLWRLE ++  WSG  + WG   R+RHVT+GRYL+++     +  V  S+A   +T+F  R SK+ K     + + + MG  +IK+GE+  F+QHV+S  WL+Y A    K     V +K+A++  EGHMDD  ++ + Q EES++A  I   A ++ +FI+ LD +  + + S   + S + +  VI  L+DLI +F  P+ + +HE KQ KL +LRNRQ LFQEEG+++L+L  ID+             A  E  + W  ++ N LY LLA++IRGNR NCA F+  + +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP R+LLLQT L++  +S+RPN+F+G  E S  Y KWY+E+ +D +      +A  LRVGW+ +EG+ P+PGG +GWG   VGDDL+S+GFDG +LWTG   + + +  Q  +L   D++ C LDL+VP I F IN  PV+G F  FN+DG+F+P VS SA + VR + GG HG  ++ PP GY+   EA+LP+ERL L+P   +           G S    ++ F+P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYG  RDD  + HPCL  F  LP  ER +++ ++ ETL+T++ALG  +          LK  KLP +++ +NGY+P PLDL ++ L+    TLV++LAEN HN+WA DR+ QGWSY  V++   +R+P LVPY  +D++ K+SNR +  + V+TLL Y Y+IE P  + S++   +       +G  A R FRA+ ++ V SG+WY+E E +T G    GW   +     E+G++  +Y F+     +W+L S P+G+  Q GDV+GCM+DL + TI F+LNGE++M   G E AF+ +    G++P  S GPGQ   LN G DV +L++F  CGLQEG+ PF +NM RPV  W+S+  P  F  +  E+   EV    G+V   P L+L  + +G Q S  EM FLRL LP++   HF   +     AS         P   P  +D   E   + P T   NL ++      +    +   K+   G          P +    +DA       TT K+KK                +     S+  L  L +  +     DD     PE+ L   +       YY+SV V  GQ+   +++GWVT  +            + SFD                         V  VT+   +   ++ SS+  S  Y++   D    F +    G+     + IGC +D ATG +TF  N +E    FQV P T L+PA+FV PT +    F+L    N +P+ A M    R+   P    RL++QML    WSR+ N    +   +  E  GW++  +E + MMA+HIPEE+      L   +LD  P+ LR + +T    ++     +    Q    H+D+ Q  + +++ +L G LR  ++DLLI++HLES  R +    +E +VPL    ++  +           ++               H +P    + S+ P          +             + P I  E L++ +L+ L  AV  G Q   +P+GGS E  FVP+LK+V  LL+MG+    D+  IL +++   F                                       +         +   +L M L ESVKLQ+CHLL   CD +L+HR+E +   +  +V  +Q++Q  RY + +K   + ++ TA+ T+EFR PP++Q+  +L F   +       D+  C   EE++  +  FH+ L+ +CGI+    L+  E   +   T  SR + LL          E +    +      E    EE K           ++L +++  T++ WA+  F+++ +L+R MFSLL RQY+ LGE+  +L + Y IS  S +D   LL  LG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E++  K      MV  CCRFLCYFCR S QNQ++MF+HLSY+LENS + L    ++G+ PLDVA +S++DNNELALA++E+ LEKV  YL+  G+QS   LL+KGYPDIGW+P  GER+LDFLRF V+VNGE +EENAN+VVRLLIR+PEC GPALRG
Sbjct:   12 VQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSTASGEL---QVDASFMQTLWNMNPICSCC----EEGFVTGGHVLRLFHGHMDECLTISPSDSDD--QRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALT-EDQGLVVVDASKAHTKATSFCFRISKE-KLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA-PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDSFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQEEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESW-KEIVNLLYELLASLIRGNRTNCALFS--TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYGKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHVARPVTSPGQH-LLGPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHLVGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMNNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQS-------RGDRA-RIFRAEKSYAVQSGRWYFEFEAVTTG-RELGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLP-QFEPVPLEHPHYEVARMDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAS---------PGLQPPAED---EARAAEPDTDYENLRRSAGGWGEAEAGKDGTAKEGTPGGAAQPGVEAQPARAENEKDA-------TTEKNKKRGF-----LFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDD-----PEIILNTTT-------YYYSVRVFAGQEPSCVWVGWVTPDYH---------QHDMSFDLS----------------------KVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD----FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVVQFDLRPGANIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLHVDTRRAGERLGWAVQCQEPLMMMALHIPEENSEPYIHLKRAQLD--PRDLRDYRDTKFDSES---SDSDQTPQPGCYHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTEETRAITLFPPGRSAEDGPRR---------------HGLPGVGVTTSLRPPHHFSPPCFVVALPAAGAAEAPARLSPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDEDVKQILKMIEPEVFTEEEEVEEEEEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEEAAEEEKEELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQSNQRGRYGLLMKAFTMSAAETARRTREFRSPPQEQINMLLQFKNGA-------DEEDCPLPEEIREDLVNFHQDLLAHCGIQ----LEGEEEEPEEESTLGSRLMSLL----------EKVRLVKKKEEKPEEEPAAEEHK----------PQSLQELVSHTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISLSSVEDTMSLLECLGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEIRFPK------MVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLG---MQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENANVVVRLLIRKPECFGPALRG 2369          

HSP 2 Score: 1322.38 bits (3421), Expect = 0.000e+0
Identity = 834/2084 (40.02%), Postives = 1208/2084 (57.97%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIIN---------DGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYV---EQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYF-------VGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVH-FKREEQNFVCQNEIDHLSLIMPDQGSNNKSEA------SRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQI-WQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMW-LSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSC--SXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGL----AAGGLYDL---QGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL A++E I +S                   E+P +   P +  D    +   E        PPE++   V LG AI++FY+ L+DLLGRCAPE       K  +LR+RAIL+SLV ++DL G++SL   +P      T+ +DG      +  M    +P+HKAS+VLFL+RVYGI++ +  L +L+  FL DMRAA  LD  ++    +ALAL RYL  +VLPL+TK +  L   E  A ++++ LHT YRLSR RSLTK QR+ + D L+AL + ++P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   TG    G+ +EEE  LT +LF GIFD+LA   YD EL+  A+PCL AI  AL PDY               S+S+++                E++  V+A       + +F P+PV+T ++ +P  L+S +++FA++ H+ WA + ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E+LKAMIAW WT++      E   E+++   I+         +GYNP P DL  V +++E+  MAE+LAEN HN W + KK ++++ GGG H +LVP++ LT KEK+R R+   ELLK+LQ NGY                   RHG D   D                      TSS   RFA+  L +LLR++   ++ I  ++ +  S R  ++ P  QE   IKFF K++LPL+ +YF  H  YF       +G    A N+EK+M  +LFCKL +L+R +++  G D    V CL  L +++D R ++K   +  + V+  L  FF + ++D+  +++NL + + S  +  V+    +L Y  + LLPVL ++F H+++   G D+++ DVQV+CY+ L ++Y LGT  + Y +         + RP LGEC+A +A   PVAFLE  LN+ N  S+        S   R ILG      E+  ++P L+ ++ EI  LAESG +YTE PHVIE+TLPMLCSYLP WW RG       A       P T VT+  +N++LGN+L++I NN+    A WM R+A+  QPIV  A   +L  HF+P   +L+  A +   EEE  +         A E E  +  +  +L R+++A YPLLI+YVD +R+AW + P   + +           W    H  +  E++F     +D+ +  +    + N+S A       RS  +D    K   R  + S  TSL VA +K++LPIGL+M    +Q+LI  AK R                     K+ D ++ E+L+N ++L+ + +    + WQ  LY+ + G+ +  D  E +     ++RV  ++ VL+ L   +HP    K  W KL+S QR+RAV+ACFRM PL++LP HR  N+FL +Y++ W L+ +     R+I+++                                  S+   +   E       PDPL QL+    RTA+ + S   +D LY++YA IM+KSC      ++ ++ GE +E   S +E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   A+V  +++LGIS+L GGN  VQ +ML +LK+KK +GFF SI  LMQ C        +R  + E +     +G L  +    G   + D EFT  LFRFLQLLCEGHN  FQ+YLR+Q GNTTT+NIIICTVDYLLRLQESI DFYW+Y+GKD I+  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ELL+E + LQK+M++MLLS+LEGNVVNG I +QMVD LVESS+NVEMILKFFD+FL++KDI  SEAF  +  +  G IS K+F+ AM+ QK +   EI++++ C +++ +  ++  EF +RF +PA+DIGFNVAVLLTNL EH+P+D RL   +  A+ +++ F PYLGRIEI G S RIER+YFEI +++  QWE PQ+K+SKR F+  VVNEGG+ EK+E FV+FCEDTI+EMQ + +IS
Sbjct: 2371 GGSGLLAAIEEAIRIS-------------------EDPARDG-PGVRRDRRREHFGEE--------PPEEN--RVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLDDLVGIISLPLQIP------TLGKDGA---LVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLPDMRAAASLDT-ATFSRRWALALTRYL-CAVLPLITKCAPLLRGTEHRAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIAMPCLCAIAGALPPDYVDA------------SYSSKT----------------EKKATVDA-------EGNFDPRPVETLNVIIPEKLDSFINKFAEYAHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGY----------------AVTRHGKDMELD----------------------TSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILARSLDARTVMK---SGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVE---------KLRPALGECLARLAAAMPVAFLEPELNEYNACSVYTT----KSPRERAILGLPNSVEEMCPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERG-PEAPPPALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPTIGRLRKRAGKVVAEEEQLR---LEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRSAWPRLPPSPSSSFSLPSPSELGRWLMKDHGHQLYEESFTVPLILDNAAFPL----ARNQSRAIGCAGVVRSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR------------------YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKI-----VRRVQEVSAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKASWILTEDHSFEDRMIDDL----------------------------------SKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAKSCHLEEGGENVEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCRWPHKTLSQREGQEERVMKVQTSGTLVIINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILDYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQIS 4255          

HSP 3 Score: 546.969 bits (1408), Expect = 7.097e-154
Identity = 278/490 (56.73%), Postives = 351/490 (71.63%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNST-------------------------DPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN------------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++  ++N Y  +  AL LAF INF+LLFY+V   P  + +   S                          D D+   +  L +S  YM    + L+ LH+  A   +I Y CLKVPLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPSFP NYWDKFVK+KV +K+ + +    I  LLGM+            +P    G   W+    ++ D++Y IWK+GVIFTDN+FLYLG Y V SL+G++N FFFA HLLD+A+  KTLRTIL SVTHNGKQLV+TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4549 FLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGEDDIEGSGAGDMSGAGSGDGSGWGSRASEEVEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHNERKPDPPPGLLTWI----MSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 5034          

HSP 4 Score: 108.612 bits (270), Expect = 1.941e-21
Identity = 66/225 (29.33%), Postives = 109/225 (48.44%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTI------KLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            Y+  +E K  V     F PRPVET  + +P  +++  +K AE  HE WA  KI   W+YG+N D+  KTHP L  ++     +++       E+L+ ++A  +T+      E  + +        +   ++    GY PQP DL  ++LS  L+ +  QLAEN HN W   + ++      +E       P LVPY+ +    K  +R+ + E +K L    Y++
Sbjct: 2716 YSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYAHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAENYHNTWGRKKKQE------LEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAV 2934          

HSP 5 Score: 108.227 bits (269), Expect = 2.392e-21
Identity = 62/202 (30.69%), Postives = 106/202 (52.48%), Query Frame = 2
Query: 9077 DFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERR---RPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKAD------MDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            DF P PVDT  I LP  LE + ++ A+++H+ WAL  +E+G+ YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G  +     + E + ++    +  ++N+GY P P DL  V +T     + ++LAEN HN+WA+ + A       +  I    +  LVP+ +L +  K   R    + ++ L   GY
Sbjct:  851 DFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMNNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGY 1052          

HSP 6 Score: 69.707 bits (169), Expect = 1.082e-9
Identity = 49/186 (26.34%), Postives = 90/186 (48.39%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            KL  N +E  W    +  GW  +G  + ++L+ T       F+ L H  +++D  L    +  + A+   +  +        KT K      + N + P+P++ LN+ +   L++ +N+ AE  H  WA D+I+  WSYG   +  LK  P L PY+   +  K+  R    E++K ++A+ +++E
Sbjct: 2639 KLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAH--KKYDQELYRIAMPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGN-FDPRPVETLNVIIPEKLDSFINKFAEYAHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVE 2821          

HSP 7 Score: 61.2326 bits (147), Expect = 3.784e-7
Identity = 29/112 (25.89%), Postives = 66/112 (58.93%), Query Frame = 2
Query: 9071 DDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI---DADLSRIEMH--GERRR 9391
            ++ +KP P+D SH+RL  +  +L+D+ A++ H+ WA + V +G+ Y   ++   + +P L+ + LL +  +    + + +A++ ++ +G+ I   D + S+++    G+R R
Sbjct:  963 NNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRAR 1074          
BLAST of Ryanodine receptor related vs. UniProt/SwissProt
Match: sp|Q92736|RYR2_HUMAN (Ryanodine receptor 2 OS=Homo sapiens OX=9606 GN=RYR2 PE=1 SV=3)

HSP 1 Score: 1536.93 bits (3978), Expect = 0.000e+0
Identity = 904/2075 (43.57%), Postives = 1248/2075 (60.14%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQ-GIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA--DLSRIEMHGERRRPTIIND-------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSR-YSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-------AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEK---NLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGL------------YLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEP-ITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQA---SDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+E I         K+A++      +  +   KTL     D E                 E++ D + +G AI+TFYS L+DLLGRCAPE       K  ++R+R+IL+SL+ + DL GV+S+ F +P      T+ +DG     D   M  G  P+HKA++VLFL+RVYGI+  +  L LLE  FL D+RAA  LD  +   +D ALALNRYL  +VLPLLT+ +      E  AS++++ LHT YRLS+  SLTK QR+ +   L+++  QL+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   G  G  G A+EEE  L+ +LF GIFD L++  Y+ ELF  ALPCL+A+  AL PDY     + S  +S +   S+    G                              +F PQPVDTS+I +P  LE  ++++A+H HD W+++ +  G++YG   +D +K  P +  + LLS+ ++  Y  P+ E+LK M+AWGW I+   +   + ++   RR +  +        GY+P   D+  V +++++  MAE +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK++ R+   ++LK+LQ NGY                G     LD PS  I++                        RFAY  L +L+RYV++A   + +    SR    + P+ QE   IKFF KVVLPL+++YF  H+ YF+   S        A N+EK+M  +LFCKL  L+R +++  G+D    V CL  L Q +D R ++K   T  + V+  L  F  N A+DL   ++NL   +F+H +   +     +NY  + LLP+L S+F+H+ +   G DL++ DVQV+CY+IL +LY LGT  S Y +R+         R  LGEC+AA A  FPVAFLE+HL+K+N YSI YN        A  +   +E    N+P+L+ ++EEIV+LAESG +YT+ PHV+EV LPMLCSY+  WW  GPEN  E A         T + ++ +N +LGN+LK+I NN+      WM R+A+ +QPI+      +L  HFLP+ EKLK  A     EE+  +AE +     A  +   +  +   L R+++AFYPLLI++VD +R  W+K+P  + + LF +VAE+F+ WSKS +FKREEQNFV QNEI+++S ++ D     KS+ S++A +D   KK   +  + S  TSL VA +KRLLPIGL++    +QELI  AK R                     K+ + ++ + +++ I L+ + +D    WQ  LYK +       + ++   E  ++RVL +A VL  L             LV+HP    K  W KL+S QRKRAV+ACFRM PL++LPRHR VNLFL  Y   W+  EE     +LIE++ +                         G EP E  EG           T   DPL QLI    RTA+ +     +D LY++YA IM+KSC  E+DDD +E       KS +E+EMEK ++L +Q RL DRGAAEMVL  I   +G    +V  +++LGI++L GGN++VQ +ML +LKEKK +GFF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G     L D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+E M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS ++F  AME  K Y   E E+++ C +++ +  +D+ EF  RFH+PAKDIGFNVAVLLTNL EHMPND RL+  +  A+ ++  F+P+LGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG+KEK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2339 GGNGLLAAMEEAI---------KIAEDPSRDGPSPNSGSSKTL-----DTE-----------------EEEDDTIHMGNAIMTFYSALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMP------TIAKDGNVVEPD---MSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDY-----MESNYVSMMEKQSSMDSEG------------------------------NFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGY------------AVSRGFKDLELDTPS--IEK------------------------RFAYSFLQQLIRYVDEAHQYILEFDGGSRGKGEHFPYEQE---IKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMK---TGLESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQ---------RSALGECLAAFAGAFPVAFLETHLDKHNIYSI-YNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSRWWEHGPENNPERA-----EMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSEAELL---ILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITD----TKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFS------------------LKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNR----TDDTSDPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKP------------------------GAEPPEEDEG-----------TKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEE-----VKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGL---GMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS 4207          

HSP 2 Score: 1186.79 bits (3069), Expect = 0.000e+0
Identity = 632/1335 (47.34%), Postives = 870/1335 (65.17%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYDTN---------------AIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSP-QHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYA----GNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFT 4036
            E+EI FLRTDD V L      H    + CL+A GFG+R CFLE+ S   N PPDLS+C F+L+Q+LSVRALQE++A   + +               A GG  GH+TLLYGHA+LL+H+ S M+L CLSTS SS DKLAFDVGLQE+   EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  NG      V A+FQQTLW+V P+SSG+  + + G + GGDVLRL HG  DECLTVP  +GEH   Q  +V YE GAVS HARSLWRLE ++  WSG  I WG   RLRHVT+G+YLS+    N +  + + +A   STAF  R SK+ K       E D MG+++IK+G++  ++QHV +  WL+Y++    K       +++A++  EGHMDDG ++++ Q EES++A  IR    +F RFI+ LD  + ++ ++S   + +  V   L+DLI +F  P+   EHE KQ +L AL+NRQ+LFQEEG+INL+L  ID+    +     F    G +  E +  + N LY LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  SS+RPN+F+GV E SA Y+KWYYE+ +D  E  VT     LRVGW++ EG+ P+PGG + WG   VGDDLFS+GFDG +LW+G   + + +   Q +L   D+I C LDL+ P I F IN +PV+G F +FNIDG+F+P VS SA + VR + GG HG  ++ PP GY+  +EA+LPKE+L++E    +   ++  Y     G + +     F P PV+T++I LP ++E IR+KLAENIHE+W M KI+ GW YG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +         ++K +KLP ++  ++GY+P P+DL  I L+   E +V++LAEN HN+WA DRI+QGW+YG  ++   +R+P LVPY  +DD  KKSN+ +  E V+TLL Y Y++E P  D +  A   S            R FRA+ T+ V +G+WY+E E +T G MR GW     +   E+GS+ +++AFD   A +W+  +  YG+  Q GDV+GCM+D+ + T+ F+LNGE+++D  G E+AFK+     G++P  S G  Q  ++NFG DV TLKYFT CGLQEGY PF VN +R + +W S+  P  F+ +   +  +EV    G++   P LK+  K FG Q S  ++ F RL +PI+C + F+
Sbjct:    8 EDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGG--GHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSL---HVDAAFQQTLWSVAPISSGS--EAAQGYLIGGDVLRLLHGHMDECLTVP--SGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKN-LLLMDKEKADVKSTAFTFRSSKE-KLDVGVRKEVDGMGTSEIKYGDSVCYIQHVDTGLWLTYQS-VDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIRSTVFLFNRFIRGLDA-LSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLH-VYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC-HGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSP-NQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYK--QERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCS------GTGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLP-QFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFS 1315          

HSP 3 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 407/1105 (36.83%), Postives = 584/1105 (52.85%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK---------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDIS-C-CAEELKRKINIFHRKLMDNCGIEPPE--GLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKN--LSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHT 7717
            YY+SV + PGQ+   +++GW+TS F               +DT     +      T GD K                    +  S+  S  Y++   + ++    +++       G+ IGC +D A+G LTF  N +EL   +QV P T L+PA+F + T+     FELGR +N +P+ AG+ +   +   P    RL +Q L    WSR+ N   K+ + +++E +GW +   + +Q M++HIPEE+R +DILEL E  +LL+FH  TL LY  +C  GNH VA +L +H+DE Q  Y I+N Y+ G LR  ++DLLI +HL S++  +L   NE +VP+    +S  +     +K                     H +P    S S+ P +     +   +              PE   + LK+ +++ L  AV +G+    +P+GG+ E +FVPL+K+   LLIMG+  + D+  IL +++ + FK                            + A    R    +L M L E VKLQ+C LL  LCD Q+RHRIE IV  S+DFV+ +Q++Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF          KDD S C C EE++ ++  FH  LM +CGIE  E   LD N  L     T R R                        +L+L E+    + K   +  + D  K+  L Q+I  T++ WA+ + IE+ +L+R MF LL RQY+ +G +  +L KTY I+  S +D   LL SLG++R LL V++G+ EE L+   L DIMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E+   K      MV  CCRFLCYFCR S QNQK MF+HLSY+LENSS+ LA P++RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+  G+QS   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENAN+VVRLLIRRPEC GPALRG        +    A E  +  +   + +G + N G+S T
Sbjct: 1426 YYYSVRIFPGQEPANVWVGWITSDF-------------HQYDTGFDLDRVRTVTVTLGDEKGK------------------VHESIKRSNCYMVCAGESMSPGQGRNN------NGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFPDENKK---------------------HGLPGIGLSTSLRPRMQFSSPSFVSISNEC------YQYSPEFPLDILKSKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEESDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNF----------KDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDL-----TIRGR------------------------LLSLVEKVTYLKKKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEITFPK------MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEG-----GNGLLAAMEEAIKIAEDPSRDGPSPNSGSSKT 2371          

HSP 4 Score: 559.296 bits (1440), Expect = 1.125e-157
Identity = 284/487 (58.32%), Postives = 366/487 (75.15%), Query Frame = 2
Query: 14603 FEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ-----------KPSSDPEKMNSTDPDD---MEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-EASGSRGWLRKK--------MIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDG-VKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            F  K I     +++ FA+N YN ++ AL +AF INF+LLFY+V             + SS+  K+ S D      +    +L +S  YM    +ILA LH+  +   +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD+LV++T SFP NYWDKFVK+KV +KY E Y  + I  LLGM++ + + S +R   + K        + + D++Y +WK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD YE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD +PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCW+FFP GDCFRKQYE++L
Sbjct: 4480 FWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQL 4966          

HSP 5 Score: 106.686 bits (265), Expect = 8.039e-21
Identity = 61/211 (28.91%), Postives = 106/211 (50.24%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQS--------NGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F P+PV+T+ I +P  +E   +K AE+ H+ W+M K+  GW YG+   D +K  P +  ++ L   E++       E+L+T++A G+ I  E   EG  +          Q+        +GY P+ +D+ N++LS  L  +   +AEN HNIWA  +  +      +E+      P LVPY+ +    K  +R+ + + +K L    Y++
Sbjct: 2701 FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRI--ERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKME------LESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAV 2903          

HSP 6 Score: 105.145 bits (261), Expect = 2.195e-20
Identity = 63/211 (29.86%), Postives = 103/211 (48.82%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-------INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDTS I LP  LE + ++ A+++H+ W +  +E G+ YG  R+D  + HP L+ F  L + ++   ++  +E LK ++A G  +       + H E +   +       +  GY P P DL  + +T     M +KLAENAHN+WA+ +            +    +  LVP+ +L D+ K   +    E ++ L   GY
Sbjct:  856 SLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIS----DEHAEDKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGY 1062          

HSP 7 Score: 75.0998 bits (183), Expect = 2.321e-11
Identity = 35/98 (35.71%), Postives = 62/98 (63.27%), Query Frame = 2
Query: 2990 SFLQSNG-YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            S + S G + PQP+D  NI++   LE  +N+ AE++H+ W+MD++  GW YG + +++ K  P + PY+ + +  K+  R    E++KT+LA+ + IE
Sbjct: 2693 SSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIE 2790          

HSP 8 Score: 66.6254 bits (161), Expect = 1.027e-8
Identity = 26/91 (28.57%), Postives = 58/91 (63.74%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA 9352
            +KP P+D S I+L  S E+++D+ A++ H+ WA + + +G+ YG+ ++  N+ +P L+ + LL    +    + + EA++ ++ +G+ ++A
Sbjct:  976 YKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEA 1066          
BLAST of Ryanodine receptor related vs. UniProt/SwissProt
Match: sp|P30957|RYR2_RABIT (Ryanodine receptor 2 OS=Oryctolagus cuniculus OX=9986 GN=RYR2 PE=1 SV=3)

HSP 1 Score: 1526.15 bits (3950), Expect = 0.000e+0
Identity = 905/2075 (43.61%), Postives = 1247/2075 (60.10%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQ-GIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA--DLSRIEMHGERRRPTIIND-------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRY-SRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-------AFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEK---NLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLY------------LVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEP-ITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQA---SDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+E I         K+A++      +  +   KTL     D E                 E++ D + +G AI+TFY+ L+DLLGRCAPE       K  ++R+R+IL+SL+ + DL GV+S+ F +P      T+ +DG     D   M  G  P+HKA++VLFL+RVYGI+  +  L LLE  FL D+RAA  LD  +   +D ALALNRYL  +VLPLLT+ +      E  AS++++ LHT YRLS+  SLTK QR+ +   L+++  QL+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY   G  G  G A+EEE  L+ +LF GIFD L++  Y+ ELF  ALPCL+A+  AL PDY     + S  +S +   S+    G                              +F PQPVDTS+I +P  LE  ++++A+H HD W+++ +  G++YG   +D +K  P +  + LLS+ ++  Y  P+ E+LK M+AWGW I+   +   + ++   RR +  +        GY+P   D+  V +++++  MAE +AEN HNIWA+ KK +++S GGG H +LVP++ LT KEK++ R+   ++LK+LQ NGY                G     LD PS  I++                        RFAY  L +L+RYV++A   + +    SR    + P+ QE   IKFF KVVLPL+++YF  H+ YF+   S        A N+EK+M  +LFCKL  L+R +++  G+D    V CL  L Q +D R ++K   T  + V+  L  F  N A+DL   ++NL   +F+H +         +NY  + LLP+L S+F+H+ +   G DL++ DVQV+CY+IL +LY LGT  S Y +R+         R  LGEC+AA A  FPVAFLE+HLNK+N YSI YN        A  +   +E    N+P+L+ ++EEIV+LAESG +YT+ PHV+EV LPMLCSY+  WW  GPE+   N    E+    T + ++ +N +LGN+LK+I NN+      WM R+A+ +QPI+      +L  HFLP+ EKLK  A     EE+  +AE +     A  +   +  +   L R+++AFYPLLI++VD +R  W+K+PT + + LF +VAE+F+ WSKS +FKREEQNFV QNEI+++S ++ D     KS+ S++A +D   KK   +  + S  TSL VA +KRLLPIGL++    +QELI  AK R                     K  + ++ + ++N I L+ + +D    WQ  LYK +       + E+   E  ++RVL +A VL  L             LV+HP    K  W KL+S QRKRAV+ACFRM PL++LPRHR VNLFL  Y   W+  EE     +LIE++ +                         G EP E  E            T   DPL QLI    RTA+ +     +D LY++YA IM+KSC  E+DDD +E       KS +E+EMEK ++L +Q RL DRGAAEMVL  I   +G    +V  +++LGI++L GGN++VQ +ML +LKEKK +GFF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G     L D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q+ELL+E M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS NVEMILKFFD+FL++KD+TSS+ F  +D +  G IS ++F  AME  K Y   E E+++ C +++ +  +D+ EF  RFH+PAKDIGFNVAVLLTNL EHMPND RL+  +  A+ ++  F+P+LGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG+KEK+E FVNFCEDTI+EMQ + +IS
Sbjct: 2340 GGNGLLAAMEEAI---------KIAEDPSRDGPSPTSGSSKTL-----DTE-----------------EEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMP------TIAKDGNVVEPD---MSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDY-----MESNYVSMMEKQSSMDSEG------------------------------NFNPQPVDTSNIIIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGY------------AVSRGFKDLELDTPS--IEK------------------------RFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQE---IKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMK---TGLESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPRGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQ---------RSALGECLAAFAGAFPVAFLETHLNKHNIYSI-YNTKSSRERAALSLPANVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSRWWEHGPES---NPGRAEMC--CTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELL---ILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPTPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITD----TKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFS------------------LKATEDEVRDIIRNNIHLQGKLEDPAIRWQMALYKDLPNR----TEETSDPEKTVERVLDIANVLFHLEQKSKFIGRRYYNLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKP------------------------GAEPPEEDE-----------VTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEE-----VKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGL---GMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQIS 4208          

HSP 2 Score: 1182.55 bits (3058), Expect = 0.000e+0
Identity = 632/1335 (47.34%), Postives = 867/1335 (64.94%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYDTN---------------AIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSP-QHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYA----GNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFT 4036
            E+EI FLRTDD V L      H    + CL+A GFG+R CFLE+ S   N PPDLS+C F+L+Q+L VRALQE++A   + +               A GG  GH+TLLYGHA+LL+H+ S M+L CLSTS SS DKLAFDVGLQE+   EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  NG      V A+FQQTLW+V P+SSG+  + + G + GGDVLRL HG  DECLTVP  +GEH   Q  +V YE GAVS HARSLWRLE ++  WSG  I WG   RLRHVT+G+YLS+    N +  + + +A   STAF  R SK+ K       E D MG+++IK+G++  ++QHV +  WL+Y++    K       +++A++  EGHMDDG  +++ Q EES++A  IR    +F RFI+ LD    + + SS+  + +  V   L+DLI +F  P+   EHE KQ +L AL+NRQ+LFQEEG+INL+L  ID+    +     F    G +  E +  + N LY LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  SS+RPN+F+GV E SA Y+KWYYE+ +D  E  VT     LRVGW++ EG+ P+PGG + WG   VGDDLFS+GFDG +LW+G   + + +   Q +L   D+I C LDL+ P I F IN +PV+G F +FNIDG+F+P VS SA + VR + GG HG  ++ PP GY+  +EA+LPKE+L++E    +   ++  Y     G + +     F P PV+T++I LP ++E IR+KLAENIHE+W M KI+ GW YG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +         ++K +KLP ++  ++GY+P P+DL  I L+   E +V++LAEN HN+WA DRI+QGW+YG  ++   +R+P LVPY  +DD  KKSN+ +  E V+TLL Y Y++E P  D +  A   S            R FRA+ T+ V +G+WY+E E +T G MR GW     +   E+GS+ +++AFD   A +W+  +  YG+  Q GDV+GCM+D+ + T+ F+LNGE+++D  G E+AFK+     G++P  S G  Q  ++NFG DV TLKYFT CGLQEGY PF VN +R + +W S+  P  F+ +   +  +EV    G++   P LK+  K FG Q S  ++ F RL +PI+C + F+
Sbjct:    8 EDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLLVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGG--GHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSL---HVDAAFQQTLWSVAPISSGS--EAAQGYLIGGDVLRLLHGHMDECLTVP--SGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKN-LLLMDKEKADVKSTAFTFRSSKE-KLDGGVRKEVDGMGTSEIKYGDSICYIQHVDTGLWLTYQS-VDVKSVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKAKASSVD-LPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLH-VYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC-HGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSP-NQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYK--QERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCS------GTGERFRIFRAEKTYAVKAGRWYFEFEAVTSGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLP-QFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFS 1315          

HSP 3 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 408/1106 (36.89%), Postives = 584/1106 (52.80%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFK---------------------------SKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDIS-C-CAEELKRKINIFHRKLMDNCGIEPPE--GLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKN--LSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAV-YLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHT 7717
            YY+SV + PGQ+   +++GW+TS F               +DT     +      T GD K                    +  S+  S  Y++   + ++    +++       G+ IGC +D A+G LTF  N +EL   +QV P T L+PA+F + T+     FELGR +N +P+ AG+ +   +   P    RL +Q L    WSR+ N   K+ + +++E +GW +   + +Q M++HIPEE+R +DILEL E  +LL+FH  TL LY  +C  GNH VA +L +H+DE Q  Y I+N Y+ G LRT ++DLLI +HL S++  +L   NE +VP+    +S  +     +K                     H +P    S S+ P +     +   +              PE   + LK  +++ L  AV +G+    +P+GG+ E +FVPL+K+   LLIMG+  + D+  IL +++ + FK                            + A    R    +L M L E VKLQ+C LL  LCD Q+RHRIE IV  S+DFV+ +Q++Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF          KDD S C C EE++ ++  FH  LM +CGIE  E   LD N  L     T R R                        +L+L E+    + K   +  + D  K+  L Q+I  T++ WA+ + IE+ +L+R MF LL RQY+ +G +  +L KTY I+  S +D   LL SLG++R LL V++G+ EE L+   L DIMNNKVF+QHPNL R L +HETVM++MV+ L                                                E+ E+   K      MV  CCRFLCYFCR S QNQK MF+HLSY+LENSS+ LA P++RG+ PLDVA +S+MDNNELALA+RE  LEKV V YL+  G+QS   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENAN+VVRLLIRRPEC GPALRG        +    A E  +  +   + +G +   G+S T
Sbjct: 1426 YYYSVRIFPGQEPANVWVGWITSDF-------------HQYDTGFDLDRVRTVTVTLGDEKGK------------------VHESIKRSNCYMVCAGESMSPGQGRNN------NGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRTGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKK---------------------HGLPGIGLSTSLRPRMQFSSPSFVSINNEC------YQYSPEFPLDILKAKTIQMLTEAVKEGSLHGRDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLRHILQLIEPSVFKDAATPEEEGDTLEEEPSVEDTKLEGAGEEEAKVGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNF----------KDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDL-----TIRGR------------------------LLSLVEKVTYLKKKQTEKPVESDSRKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGG---------------------------------------------ESKEITFPK------MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEG-----GNGLLAAMEEAIKIAEDPSRDGPSPTSGSSKT 2372          

HSP 4 Score: 554.288 bits (1427), Expect = 3.754e-156
Identity = 281/488 (57.58%), Postives = 365/488 (74.80%), Query Frame = 2
Query: 14603 FEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVE-----------QKPSSDPEKMNSTDPDDMEEFI----ILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-EASGSRGWLRKK--------MIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDG-VKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            F  K I     +++  A+N YN ++ AL +AF INF+LLFY+V             + +S+  K+ ++        I    +L +S  YM    +ILA LH+  +   +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD+LV++T SFP NYWDKFVK+KV +KY E Y  + I  LLGM++ + + S +R   + K        + + D++Y +WK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD YE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD +PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCW+FFP GDCFRKQYE++L
Sbjct: 4481 FWKKIIAYQQKLLNYLARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPSRSTSENAKVTTSLDSSSHRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQL 4968          

HSP 5 Score: 105.916 bits (263), Expect = 1.494e-20
Identity = 63/211 (29.86%), Postives = 103/211 (48.82%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-------INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDTS I LP  LE + ++ A+++H+ W +  +E G+ YG  R+D  + HP L+ F  L + ++   ++  +E LK ++A G  +       + H E +   +       +  GY P P DL  + +T     M +KLAENAHN+WA+ +            +    +  LVP+ +L D+ K   +    E ++ L   GY
Sbjct:  856 SLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIS----DEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGY 1062          

HSP 6 Score: 102.834 bits (255), Expect = 1.113e-19
Identity = 62/211 (29.38%), Postives = 106/211 (50.24%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQS--------NGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F P+PV+T+ I +P  +E   +K AE+ H+ W+M K+  GW YG+   D +K  P +  ++ L   E++       E+L+T++A G+ I  E   EG  +          Q+        +GY P+ +D+ N++LS  L  +   +AEN HNIWA  +  +  S G   +      P LVPY+ +    K  +R+ + + +K L    Y++
Sbjct: 2702 FNPQPVDTSNIIIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRI--ERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNH------PLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAV 2904          

HSP 7 Score: 73.559 bits (179), Expect = 7.365e-11
Identity = 35/98 (35.71%), Postives = 61/98 (62.24%), Query Frame = 2
Query: 2990 SFLQSNG-YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            S + S G + PQP+D  NI +   LE  +N+ AE++H+ W+MD++  GW YG + +++ K  P + PY+ + +  K+  R    E++KT+LA+ + IE
Sbjct: 2694 SSMDSEGNFNPQPVDTSNIIIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIE 2791          

HSP 8 Score: 66.6254 bits (161), Expect = 1.044e-8
Identity = 26/91 (28.57%), Postives = 58/91 (63.74%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA 9352
            +KP P+D S I+L  S E+++D+ A++ H+ WA + + +G+ YG+ ++  N+ +P L+ + LL    +    + + EA++ ++ +G+ ++A
Sbjct:  976 YKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEA 1066          
BLAST of Ryanodine receptor related vs. TrEMBL
Match: A0A5K4EV29 (Ryanodine receptor related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 3908.99 bits (10136), Expect = 0.000e+0
Identity = 2172/4223 (51.43%), Postives = 2807/4223 (66.47%), Query Frame = 2
Query: 4394 AVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRS--------ILMKCSDNQSFDT-----RVHKGKSTLDHKTKGDSKESNDWD---VPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGR-TRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVT----EKSYQKYHNHQKNSDFA--SSMEEIDFDFHKIPSQTESCSIYPNLISD----------------------------DVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFH---YTSLTCHEEKDDISC--------------------CAEELKRKINIFHRKLMDNCGIEPPEG----------------LDINEL-LNQCFKTKRSRS---------------------LHLLPMGIGHPEEGESIPQFLQNIL-NLFERRPIEESKLCIETAKIDENKNLSQ-----------VIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKI----GNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEE---------------TTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVI----FSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLP--MIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPG--QG-------------------------------------------IANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQS---------LAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRI-EMHGER---RRPTIIND---GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCT-GEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGK-YTEAPHVIEVTLPMLCSYLPIWWSRGPENM---------------------------HENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSN-----NKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGK-----AKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTES------TKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDS-------ETSLELLPFTTTPDP-------------------------------------------LSQLITALKRTAMEQASDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDIV-------------VGVFRXXXXXXXXXXXXXXXXXCFGGRFFLALVSGPKT----SGDRLEYQESLQKRKA--------------WLLPPEEQLILERLDPAEIALLDEYQEEGMYQPVTIHNVPDNTYYFNKIDDQDN-ISITEIDKQEINARLRSSTIVGPQRCQLDITDNKP-------SSDNTKQPDSSERQDFNIYQDNDKQXXXXXXXXXINPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ-KPSSDPEKMNS---------TDPD-DMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIA-WDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEELK 15994
              LGD+  T    +++DD D  LP      + L  L+D++ F+V+VLPGQD   + IGWVTS FKL+++         L   S    FDT       H  ++ L   T G   +    D   V    +C LE+DL+LKS+V +   +++N+  +LN     +D+GK+MSQG+++ C++D A+G L F+LN R+  I FQV P T L+ A+F +PT +E   FE GR  R TLP+ A MLR PR  + +L  RL++Q L++ HW+RV     KI  +K++E+RGW    E  V  +A+ +PE DRC   LEL+E P+LL++H  TLELY+ +CC+ NHNVA  LT H+DE Q  + +    + G LR+ F DL++ MH+ SH +LK  T  E +VP+  +    +      ++   +    + N D       E+ ++DF +IP+  E  SI P L +D                               L + G NG     KL  CP     +LK + L  L ++V KG  I +P GGS E++ +PL+K ++ LL+MG++   DI+ +L++LD  +FK+   LR      S+L+  L ESVKL++C LLH LCD+QLR+R+E +V+ ++ FV  +Q DQ  RY+ IK+S+LPSSV A+ T+EFRCP   QM  +L  H     +    E + + S                     C+EE+K  +  FH+ L +  G+  PE                 +  +EL L+    T+ S +                     L L+P  +GHPEEG   P ++  +L N+  R P+      IE  + +E  +++Q           +I  T++ WAK  FIE+++LIREMFS L RQYNA  E++N+L+KTYVIS  S+D+V++LLRSLGRVR LLGVQ+G  EE+LLKNCLWD+MNNKVFFQHP+LTR LAVHETVMQLMV TLT++      GNT ++  +         + ++ +    +VT    +S+P L EE                   Q++ + GP EMVVQCCRFLCYFCRTS  NQK MFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALA+REKQLEKVA+YLSR GVQSN ELL+KGYPDIGWDPVEGERFLDFLRFTVWVNGE +EENANLVVRLLIRRPECLGPALRG S  + +   G T  +   I        HA  G+T  + +    + N+                 GGGLLKAMKEG+VMSAQIKL K+AQE E   +A  NP+++ L    +  DYEDANLF  LPYNF +LPPEDDPDY+DLGAAILTF+S+LV+LLG CAP+ +T KS S+R R+ILQSLVSM DLEGVLSLRFILP P++E+  NEDGE+EW DKAGMPPGLLPEHKASVVLFLERVYGI D  TFLRLLEN FL D+RAAT+LD     DSD ALALNRYL NSVLPLLT+H+ YLGE      + E TL TAYRLS+CRS+T  QRE V DFLVAL QQ++PPM++ LL+K++ D+ +L+ ESVV LR LT FYQRCG YYSS G  G  QG                                            A+EEE+ +T  LF  IF+ L++ PY+PELFS ALPCL +I CAL PDY    S+  +     ++ S     GQS         L PG P       +L+   ++      D F+PQP+DTS +RLP +L SL+ +FA+H HDSWAL+++E+GY +G   +++ +THPNL SF  L   +QM+YI PV + LK M+A GW++D D +R  +  G+    RR TI +D    YNP+PKDLRGVNVTKEML+MAE+LA+NAHNIWA+ K +D+++IGGGVHQ+LVP++ILTD E+ RYR+LT+EL+KYLQYNGYRL               T R G +  + + ++ N      +   N    +  + T+RFAY LL+KLL YV+ A+ +V++  PS+RYS +  +   ++D+KFF KVVLPLVERYF   + YF+ P + A  +EKKMAATLFCKLFSLLR KL   GHD+ I+V CLQGLVQ ID++AI+K+  T+EDFVR R+LPFF+N ADDL ++++NL   R+SH+KGT++RGA S++Y+HMVLLPVLKSMF+H+ K   G  LLVG+VQV CY+ILNALY+LGT SS++ +R+   +E NRHR L+G+C+AA+A  FPVAFLE++LN NN  SI +N   G+YSLEAR++L +L K + +L +I++++  LAESG    +EAP++IEVTLPMLCSYLP WW +GPE M                             N+     + P+TTVTA L+N VLG+VL+LI+ NIDSPHAPWMTRIA RTQPIV N+T +MLG++FLPV+E+L  HAL  ++ EE Y+AEK++GSE+  E EEEL+  VEILVRN+FAFYPLLIK+VD HR+AW+K+PT +T  LF+ VA +F++W ++  FKREE+NFV  +EID LSLI+P  G N     N+S    +  N+S   K + +KAK   +TSL VACIKRLLP+GLS  GGREQEL+  AK++LI++   ++ D    +E ++Q+E+D  IE +L NA+D E + D +TQ WQK+LYKKI +      +  + + S   EI + ++ +L+KV+HGLYLVDHPP++ KGSWKKL+SSQRKRAVMACFRM+PL+++P HR +NLF+  Y + WL  EE + V+LIE+VT        +K +E S    ++   A      +G +   +SE  +       +++LEL   TTT DP                                           L+QL+TAL R+A +QA DD LYL+YA IMSKSCS  +D++++E   +E   S QEQE +K Q+L+EQNRL++RGAAEMVLL++   +G  T V Q SIELGI+LLLGGN  VQ RML +L +KKL GFF S++GL Q+CSVLDLDTFERCNKAEGLA  GL D++GITNLYDA+FTCK+FRFLQLLCEGHNLAFQDYLR+QAGNT +VN+II TVDYLLRLQESIMDFYWHY+ KD+ID +GK + V+AIKIGKQ+FR+LTEYIQGPC+GNQLALAHSRLWDA++GF+++ A MQDKLS+DPDQL+LLREF+ LQKE+MIMLLSMLEGNVVNGPI KQMVDTL+ESSANVEMIL+FFDIFLRMK IT+SEAFLAFD+N DGWISH+EFR A+EQQK Y+PEEI YI+ CVD+N DGKVDF EFT+RF++PA+DIGFN+A+LLTNL EH+P+D RLERL+ KA+ +++ FEP+LGRIEITG +GRIERVYFEIRQ HIDQWE PQIK+SKRSFLHSVV E GDKEKLE FVNFCEDTI+EMQH+Q I+G+   + L +V+A    +  + L  +      ++ I   +  + +  +W  LR +++ DI+             VG F   L      +++         R      S  +T    S DR+ Y +      A              WLL  ++QL++ER DP  +A + E           I N   +T+  ++ +   N +S       + N  + S   +     +   T + P       S  NT  P S      N  Q+++ +                K +T  Y+ISLFA N Y FKI AL+LAF INF+LLF +V Q  P++  ++  S         TD D ++ E++   D+ +Y+G L  +LA +HS  + S L+AYY LKVPLV+FKREKEI RMLEFEGMWI+ QP +DNL+AHWDKLVLST SFPQ YWDKFVKKKVRNKYS QYD+++I  LLGM++ S  + + G    K     DIQYL+WKWGV+FTD +FLYL +YF  S  GN NYF +ACHLLDVA+SFKTLRTI+QSVTHNGKQLVLTVMLTS++IYLYTV+AFNFFRKFY+KDNDGV D KC++M TCF+FHLHTGLRAGGGIGDEIE+PDGD  ENYRILFD+TFFFFVI+ILLAIIQGLIIDAFG+LRDQLEQVKED+ESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP+GDCFRKQYEEEL+
Sbjct: 1538 GALGDMKSTGAGATSLDDVDLFLPTSSGHTSPLANLVDEFSFTVLVLPGQDPGLVHIGWVTSYFKLAKTSKPDHISGFLHNVSSQLQFDTTHGQLHGHSNQNPLLGDTSGSGIQPYAADLFTVRQAAVCLLESDLTLKSAVAERASFMVNLGQLLNQMATAEDLGKRMSQGLSLTCWVDIASGTLGFDLNGRDSGIRFQVEPSTRLFAAVFYRPTVKEAIHFEFGRRNRYTLPITASMLRPPRYTSTVLPHRLRVQALERVHWARVPPKAIKIFSMKISELRGWGTSIEYPVSEIAIRLPESDRCFIALELEEMPELLKYHSHTLELYRALCCHDNHNVAHYLTNHVDEYQLLHAMTASDMPGPLRSGFIDLMLVMHISSHVKLKQVTGKEFIVPMFKTEPKPKKNIFDFDERTGELDGKKINDDGGKVGDKEDEEYDFDRIPAVEEHISIRPELKTDPHLLIPGADGTGNLPVTSPEKTKEDNAMSTALNIAGSNG---LLKLSDCPPFPLNKLKLLCLDCLVDSVYKGGSIRDPAGGSYEHLLLPLVKTINSLLVMGVLDQKDIHTLLAILDPKSFKASLPLRGDSTYESLLEFHLPESVKLEICRLLHNLCDLQLRNRVEQVVKFASKFVQALQEDQNFRYMAIKKSNLPSSVAARRTREFRCPASVQMKSLLQIHGPGGPTGRAQETQAEPSTNETVSGNEEDDELEDVETNPCSEEVKEMLRSFHKLLCNKLGVMLPENNENNSANKSDSDKSADIGFDELHLHSPLLTRPSDTLSLASFGPSYPSDELQTALAQLQLVPPDMGHPEEGSGTPPWILKLLWNMIIRHPLTNDS-TIEVNEKNEQTSVTQFCHSGKRSLDGLIVYTIVKWAKEGFIESLELIREMFSALHRQYNATEELKNALEKTYVISGSSQDEVSRLLRSLGRVRSLLGVQLGSNEEILLKNCLWDLMNNKVFFQHPDLTRCLAVHETVMQLMVQTLTKATFEQPGGNTISKDVLH--------SSNQAVTTDITVTSVTGSSLPVLHEEGLNPNTGHGSHHQQQQQSQQQRGSTGPTEMVVQCCRFLCYFCRTSRDNQKAMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALALREKQLEKVAIYLSRCGVQSNAELLAKGYPDIGWDPVEGERFLDFLRFTVWVNGETVEENANLVVRLLIRRPECLGPALRGGS-KVMKHSAGNTGTDGLEIPPGGPDGLHAARGSTGQLISDTDCQPNL----------------AGGGLLKAMKEGLVMSAQIKLVKMAQEAE---AAGLNPEEEDLGWRTVLMDYEDANLFTPLPYNFESLPPEDDPDYIDLGAAILTFHSILVNLLGYCAPDMETVKSESIRARSILQSLVSMADLEGVLSLRFILPPPKLEVQTNEDGEDEWVDKAGMPPGLLPEHKASVVLFLERVYGISDAATFLRLLENGFLPDLRAATLLDSTVVPDSDMALALNRYLCNSVLPLLTRHTKYLGEEGTAGGLFEATLQTAYRLSKCRSITNHQREVVCDFLVALMQQIKPPMMSALLKKMVSDLRTLSKESVVSLRALTEFYQRCGTYYSSDGWTGGSQGSPGHSATSADDDPGCTSNGNGNNGSGSSGGADNVGGRSGDGETSASEEERSITAHLFILIFEKLSRQPYEPELFSYALPCLCSIACALPPDY----SISQLNAMGQQNDSLGQNVGQSVFTDQMNSLLVPGAP-------RLEANDSLDELVHHDVFRPQPIDTSQVRLPAALNSLIQRFAEHCHDSWALDLIEQGYTFGAQVDEVRRTHPNLRSFSQLPPQEQMRYIHPVTDTLKTMLACGWSVDGDENRYRDAPGDTKHLRRQTITSDNLLNYNPSPKDLRGVNVTKEMLNMAERLADNAHNIWARQKMSDLEAIGGGVHQLLVPYDILTDNERKRYRRLTHELIKYLQYNGYRL---------------TVRTGSNSTNTNTNKGNGGTGGVRHHDN----RNLAPTSRFAYGLLNKLLDYVDSAMSSVREPMPSTRYSTSRSWLSSSQDMKFFVKVVLPLVERYFETQQAYFLDPVAGASIDEKKMAATLFCKLFSLLRIKLNTFGHDVKIAVSCLQGLVQTIDVKAILKM-GTAEDFVRSRILPFFVNAADDLCVVVRNLDASRYSHVKGTIKRGACSIDYIHMVLLPVLKSMFEHLGKNECGEYLLVGNVQVTCYRILNALYKLGTTSSKHANRQSFVDELNRHRALIGDCLAALASAFPVAFLEANLNSNNPLSITFNNRGGDYSLEARDVLEKLSKTIGDLQSIIKQVELLAESGATGASEAPYLIEVTLPMLCSYLPNWWRKGPECMSLTSCNDGSNEGGLGQDTKTGNLLPKTKGNSILANATGPLTTVTADLMNRVLGSVLQLIQTNIDSPHAPWMTRIATRTQPIVANSTADMLGQYFLPVSERLLEHALIVERVEEAYRAEKRAGSESVGEREEELSCLVEILVRNLFAFYPLLIKFVDRHRSAWLKKPTYETQRLFSAVARMFLVWIRATKFKREEENFVSAHEIDRLSLIVP-SGENLTPGINRSRTHTNGRNESSSLKNV-KKAKTGPHTSLTVACIKRLLPVGLSQLGGREQELVLSAKRKLIKETLSLTGDKG--LEHLMQRESDTAIEAFLNNALDQEGDLDHRTQNWQKLLYKKIDRTIAATGRHAELAISTRSEI-VDKIQILSKVMHGLYLVDHPPAVSKGSWKKLVSSQRKRAVMACFRMVPLYAMPTHRVMNLFIKGYITEWLDYEESLGVKLIEDVTSGALLKDLSKSNELSSTGGTNEAIAGTVHAIEGVQKSTDSETGAAQDLDMMDSTLELDLSTTTNDPGTAISSDSNKSASLLQTGSLQTSNSSSSQHTYGQDSSSCQPDPLTQLLTALCRSASDQAPDDPLYLAYAKIMSKSCS-GEDEEEEEENSNEEGSSFQEQEEQKQQLLSEQNRLAERGAAEMVLLQLAASKGESTPVAQASIELGIALLLGGNIGVQGRMLDYLMKKKLSGFFTSLAGLTQKCSVLDLDTFERCNKAEGLAV-GLSDMEGITNLYDADFTCKIFRFLQLLCEGHNLAFQDYLRTQAGNTVSVNLIISTVDYLLRLQESIMDFYWHYSNKDTIDESGKNSFVRAIKIGKQVFRSLTEYIQGPCIGNQLALAHSRLWDAVAGFIYVSAQMQDKLSRDPDQLDLLREFLNLQKELMIMLLSMLEGNVVNGPIAKQMVDTLIESSANVEMILRFFDIFLRMKVITTSEAFLAFDVNGDGWISHREFRLALEQQKTYSPEEINYIIACVDNNADGKVDFKEFTERFYNPAEDIGFNLALLLTNLSEHVPSDPRLERLIDKARGVLDVFEPHLGRIEITGSNGRIERVYFEIRQQHIDQWEAPQIKESKRSFLHSVVGESGDKEKLECFVNFCEDTIFEMQHAQSINGDEADIALNRVAAFNRFLEITHLAFIGHI---LSVILHCVRPSQLCATWNTLRQMTLPDILLTILGIIVGLIICVGRFGSHLLHLLWYIIVALASDISQKRSLTHCNSAVRTMVPWSVDRISYSKVATTTTAIQHHSSEIDTEQPWWLLSEDQQLLIERADPVHLATIKE--------EYAITNFATSTHLSHESEKSGNEMSPKPSGNWKNNNNITSPNCLTSPNLKKTSTSSAPPGTRIPTSVMNTSSPTSPT---VNQKQEDECKT---------------KFNTRNYVISLFASNFYRFKISALILAFVINFLLLFSKVNQISPNALGDEDASGNELGGNDGTDTDEELVEWVTSGDTSSYIGPLIALLAAVHSILSFSTLVAYYYLKVPLVIFKREKEICRMLEFEGMWISSQPAEDNLRAHWDKLVLSTSSFPQMYWDKFVKKKVRNKYSIQYDYDEITKLLGMDKTSSDTETGGTSLSKFFGDIDIQYLVWKWGVVFTDISFLYLAVYFAASAFGNLNYFLYACHLLDVAVSFKTLRTIIQSVTHNGKQLVLTVMLTSIVIYLYTVVAFNFFRKFYVKDNDGVPDPKCNDMKTCFIFHLHTGLRAGGGIGDEIEAPDGDESENYRILFDLTFFFFVIIILLAIIQGLIIDAFGDLRDQLEQVKEDLESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPIGDCFRKQYEEELQ 5661          

HSP 2 Score: 1640.17 bits (4246), Expect = 0.000e+0
Identity = 835/1453 (57.47%), Postives = 1058/1453 (72.81%), Query Frame = 2
Query:  122 PDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQS-VIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVP----------------HSNGEHSPQHE-----------------SVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSV-----SGSGN-EVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLD------EWVMEEQRSSLSKMNLH---EVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQS-AEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRI---------RNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAG--NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKL-ISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDI-NKKGKKMRLGKNPFKKNRSRDASPDI 4291
            P EEE SFLRT+D +CLS   HGSS+R CL+A GFG+R C LE +S E+ PP++  CVF+LDQALSVRALQE+++  + ++   GQSGH+TLLYGHA+ LKH  SNM+LSCLSTS+S DKLAFDVGLQ+ A +EACWWT+HPA+KQRS GEKVRIGDDLILVSVSSERYLH+    GE I  + VIASFQQTLWTV+PVSSGAIRQKS+ MV GGDV+RLFHGDE LT                  + +   SP ++                 +VMYEIGAVS+ ARSLWR+E  KTKWS GF +WGS+ RLRHVT+GRYL V     +G+G+ +V T+   +A  +++ F +R +KDDKK R EEHE + MG  D++ GET  +LQH +S RWLSYEAYE +KRGVG+VEEK+AV+L+EGHMDD F++ + QDEE +SA+AIRRC SVF  FI  L+         +  Q+S  +  N H   EV +CLEDLI+FF +P+  EEHEI+Q+KLTALRNRQ+LFQ EG+I  +L+TI++FTG F+ RR+F QA+GEDK + F++L NYLYLLLAA+IRGNR NCAQFA  +R+DW+F+RLE  Q  AEGVLD LHCVLTDSDEAL +IT+ HIR LI LLDK+GRDPRVLQ LCSLC+GRQGGAVRLNQ LIY+ LLP +DLLLQT+LVD C SVRPN+F+G ++  A Y KWY+E+ IDS+E VT+  A +RVGW+N EG+   P G  GWG+  +GDDLFS+ FDG  LW GGKPKR                  L  GDIIGC+LDLT PVIQF +N   V+GYF+DFNI G+FYPC+S +AK S R + G   GRL +GPP GYS +  A  P ++LRLEP F+FG L+K ++ G  NS T +  VF+PR V T+ IQLPNYVE +RD+LAEN+HEMW+M+KIDQGW YG+ RDD N  HPCLTTF++LP +++Q++VTLAYETLRTI++LGY I YE   EG+R++T+KL N F Q NGY+PQPLDL  I LS  +E LV+QLAENTHN+WA DRI  GW+YG VE+ + KRSPHLVPY +VD  I++SN+ T++ETVKTL+AY YS+E   +D S+    +S        S   RT+R Q+T  VT GKWYYE E+LT GF+R GW          IGS++ SYAF    A KWN     YG IC+PGDVIGCM+DL D+TI+FSLNGELMMDP+G EIAFK++  D GYVP FS G GQ  K+N+GNDV +LK+FT CGLQEGY P  VNM RP+P+WYSREDP LFVD+D+++  ++V + +G+ PT K+ + ++  +   E +FLRL L  +CKDHFT+KSL ERHA ++ +RRQL+P  + T    + +         + NL    Q+MS+STL++ +++GKK+RLG N FKK RSRD SP++
Sbjct:    5 PAEEETSFLRTEDFICLSCFSHGSSERLCLAAEGFGNRMCSLEIISRESPPPNMPPCVFVLDQALSVRALQEMLSIQHQSSDGSGQSGHRTLLYGHAIRLKHRESNMYLSCLSTSTSQDKLAFDVGLQQNAETEACWWTIHPASKQRSVGEKVRIGDDLILVSVSSERYLHVY---GEVISSNGVIASFQQTLWTVLPVSSGAIRQKSMNMVLGGDVVRLFHGDESLTAACATESEEFSSSVAMTVNGSAPGSPPNKVQRPSIVNSDLLSGSRHAVMYEIGAVSTSARSLWRIEHTKTKWSAGFFSWGSEIRLRHVTTGRYLGVLPSEANGNGHCDVVTLSAHEATNAASIFLIRPTKDDKK-RSEEHETEGMGEPDLRLGETLAYLQHAASGRWLSYEAYETRKRGVGRVEEKKAVLLIEGHMDDLFSLVRAQDEEIRSASAIRRCTSVFNNFIHALNYISSPQNITLPSQQSQCNLSNGHLLGEVTQCLEDLIEFFAQPHPHEEHEIQQSKLTALRNRQNLFQNEGMIGHVLSTIERFTGTFQTRREFSQAVGEDKADQFNELGNYLYLLLAALIRGNRENCAQFATPTRLDWLFNRLELQQGFAEGVLDALHCVLTDSDEALYLITERHIRTLIGLLDKQGRDPRVLQALCSLCLGRQGGAVRLNQELIYETLLPQKDLLLQTKLVDQCGSVRPNIFVGYKDGGAMYPKWYFEVIIDSLETVTHQPAKIRVGWANTEGYNAHPCGGPGWGAAGLGDDLFSYAFDGSCLWAGGKPKRATIGTDEATNEEATSNVPLKRGDIIGCLLDLTGPVIQFNVNGRLVRGYFQDFNISGLFYPCMSMNAKASARFLLGSNQGRLHHGPPPGYSPICYARQPGQKLRLEPVFTFGQLDKYVFTGPLNSPTPQQYVFVPRTVRTSHIQLPNYVEMVRDRLAENLHEMWSMRKIDQGWRYGERRDDENNLHPCLTTFDKLPPSDKQYNVTLAYETLRTIISLGYNITYEPLPEGTRMRTMKLSNGFTQVNGYKPQPLDLTQIRLSVRIEALVDQLAENTHNMWARDRIALGWTYGFVEDQSQKRSPHLVPYSEVDPIIQQSNKDTAIETVKTLIAYGYSLEPISSDSSDPGRGSS----NMDYSGPTRTYRGQATRAVTRGKWYYEAEILTSGFIRIGWAKKSAPPDLIIGSSNSSYAFAAHQARKWNRNGSVYGTICRPGDVIGCMMDLVDKTISFSLNGELMMDPLGLEIAFKHIKVDEGYVPAFSLGSGQQVKINYGNDVQSLKFFTYCGLQEGYKPLGVNMCRPLPMWYSREDPSLFVDVDRQHPSLKVNVSSGTTPTFKVTVKQVDYMSPEETQFLRLSLGTQCKDHFTSKSLNERHAHLDALRRQLEPEPIYTHGVGVGD---------SSNLVMMGQDMSASTLEVRDRRGKKIRLG-NMFKKARSRDPSPEV 1439          

HSP 3 Score: 110.923 bits (276), Expect = 1.110e-19
Identity = 59/210 (28.10%), Postives = 117/210 (55.71%), Query Frame = 2
Query: 2666 VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTIN------YEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            VF P+P++T++++LP  + ++  + AE+ H+ WA+  I+QG+T+G   D++ +THP L +F +LP  E+   +    +TL+T++A G++++       + P +   L+   + +  L +  Y P P DL  ++++  +  +  +LA+N HNIWA  ++    + G   +        LVPY+ + D+ +K  R+ + E +K L    Y +
Sbjct: 3259 VFRPQPIDTSQVRLPAALNSLIQRFAEHCHDSWALDLIEQGYTFGAQVDEVRRTHPNLRSFSQLPPQEQMRYIHPVTDTLKTMLACGWSVDGDENRYRDAPGDTKHLRRQTITSDNLLN--YNPSPKDLRGVNVTKEMLNMAERLADNAHNIWARQKMSDLEAIGGGVHQL------LVPYDILTDNERKRYRRLTHELIKYLQYNGYRL 3460          

HSP 4 Score: 101.293 bits (251), Expect = 9.505e-17
Identity = 52/153 (33.99%), Postives = 88/153 (57.52%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKA 9526
            F P+ V TSHI+LPN +E + D+ A++LH+ W++  +++G+ YG  R+D N  HP L +FD L   D+   +    E L+ +I+ G+ I      + +R+         T +N GY P P DL  + ++  +  + ++LAEN HN+WA+ + A
Sbjct:  911 FVPRTVRTSHIQLPNYVEMVRDRLAENLHEMWSMRKIDQGWRYGERRDDENNLHPCLTTFDKLPPSDKQYNVTLAYETLRTIISLGYNITYEPLPEGTRMRTMKLSNGFTQVN-GYKPQPLDLTQIRLSVRIEALVDQLAENTHNMWARDRIA 1062          

HSP 5 Score: 68.9366 bits (167), Expect = 5.515e-7
Identity = 29/92 (31.52%), Postives = 55/92 (59.78%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KPQP+D + IRL   +E+L+DQ A++ H+ WA + +  G+ YG   +   K  P+L+ +  +    Q    +  IE +K +IA+G++++
Sbjct: 1023 NGYKPQPLDLTQIRLSVRIEALVDQLAENTHNMWARDRIALGWTYGFVEDQSQKRSPHLVPYSEVDPIIQQSNKDTAIETVKTLIAYGYSLE 1114          
BLAST of Ryanodine receptor related vs. TrEMBL
Match: A0A3Q0KS03 (Ryanodine receptor related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 3906.29 bits (10129), Expect = 0.000e+0
Identity = 2172/4229 (51.36%), Postives = 2807/4229 (66.38%), Query Frame = 2
Query: 4394 AVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRS--------ILMKCSDNQSFDT-----RVHKGKSTLDHKTKGDSKESNDWD---VPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGR-TRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVT----EKSYQKYHNHQKNSDFA--SSMEEIDFDFHKIPSQTESCSIYPNLISD----------------------------------DVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYT---SLTCHEEKDDISC--------------------CAEELKRKINIFHRKLMDNCGIEPPEG----------------LDINEL-LNQCFKTKRSRSL---------------------HLLPMGIGHPEEGESIPQFLQNIL-NLFERRPIEESKLCIETAKIDENKNLSQ-----------VIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKI----GNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEE---------------TTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIF----SATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLP--MIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPG--QGI-------------------------------------------ANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQS---------LAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRI-EMHGER---RRPTIINDG---YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCT-GEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGK-YTEAPHVIEVTLPMLCSYLPIWWSRGPENM---------------------------HENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSN-----NKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGK-----AKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTES------TKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDS-------ETSLELLPFTTTPDP-------------------------------------------LSQLITALKRTAMEQASDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDIV-------------VGVFRXXXXXXXXXXXXXXXXXCFGGRFFLALVSGPKT----SGDRLEYQESLQKRKA--------------WLLPPEEQLILERLDPAEIALLDEYQEEGMYQPVTIHNVPDNTYYFNKIDDQDN-ISITEIDKQEINARLRSSTIVGPQRCQLDITDNKP-------SSDNTKQPDSSERQDFNIYQDNDKQXXXXXXXXXINPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ-KPSSDPEKMNS---------TDPD-DMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIA-WDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEELK 15994
              LGD+  T    +++DD D  LP      + L  L+D++ F+V+VLPGQD   + IGWVTS FKL+++         L   S    FDT       H  ++ L   T G   +    D   V    +C LE+DL+LKS+V +   +++N+  +LN     +D+GK+MSQG+++ C++D A+G L F+LN R+  I FQV P T L+ A+F +PT +E   FE GR  R TLP+ A MLR PR  + +L  RL++Q L++ HW+RV     KI  +K++E+RGW    E  V  +A+ +PE DRC   LEL+E P+LL++H  TLELY+ +CC+ NHNVA  LT H+DE Q  + +    + G LR+ F DL++ MH+ SH +LK  T  E +VP+  +    +      ++   +    + N D       E+ ++DF +IP+  E  SI P L +D                                     L + G NG     KL  CP     +LK + L  L ++V KG  I +P GGS E++ +PL+K ++ LL+MG++   DI+ +L++LD  +FK+   LR      S+L+  L ESVKL++C LLH LCD+QLR+R+E +V+ ++ FV  +Q DQ  RY+ IK+S+LPSSV A+ T+EFRCP   QM  +L  H     +    E + + S                     C+EE+K  +  FH+ L +  G+  PE                 +  +EL L+    T+ S +L                      L+P  +GHPEEG   P ++  +L N+  R P+      IE  + +E  +++Q           +I  T++ WAK  FIE+++LIREMFS L RQYNA  E++N+L+KTYVIS  S+D+V++LLRSLGRVR LLGVQ+G  EE+LLKNCLWD+MNNKVFFQHP+LTR LAVHETVMQLMV TLT++      GNT ++  +         + ++ +    +VT    +S+P L EE                   Q++ + GP EMVVQCCRFLCYFCRTS  NQK MFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALA+REKQLEKVA+YLSR GVQSN ELL+KGYPDIGWDPVEGERFLDFLRFTVWVNGE +EENANLVVRLLIRRPECLGPALRG S  + +   G T  +   I        HA  G+T  + +    + N+                 GGGLLKAMKEG+VMSAQIKL K+AQE E   +A  NP+++ L    +  DYEDANLF  LPYNF +LPPEDDPDY+DLGAAILTF+S+LV+LLG CAP+ +T KS S+R R+ILQSLVSM DLEGVLSLRFILP P++E+  NEDGE+EW DKAGMPPGLLPEHKASVVLFLERVYGI D  TFLRLLEN FL D+RAAT+LD     DSD ALALNRYL NSVLPLLT+H+ YLGE      + E TL TAYRLS+CRS+T  QRE V DFLVAL QQ++PPM++ LL+K++ D+ +L+ ESVV LR LT FYQRCG YYSS G  G  QG                                            A+EEE+ +T  LF  IF+ L++ PY+PELFS ALPCL +I CAL PDYS    +  +     ++ S     GQS         L PG P       +L+   ++      D F+PQP+DTS +RLP +L SL+ +FA+H HDSWAL+++E+GY +G   +++ +THPNL SF  L   +QM+YI PV + LK M+A GW++D D +R  +  G+    RR TI +D    YNP+PKDLRGVNVTKEML+MAE+LA+NAHNIWA+ K +D+++IGGGVHQ+LVP++ILTD E+ RYR+LT+EL+KYLQYNGYRL               T R G +  + + ++ N      +   N    +  + T+RFAY LL+KLL YV+ A+ +V++  PS+RYS +  +   ++D+KFF KVVLPLVERYF   + YF+ P + A  +EKKMAATLFCKLFSLLR KL   GHD+ I+V CLQGLVQ ID++AI+K+  T+EDFVR R+LPFF+N ADDL ++++NL   R+SH+KGT++RGA S++Y+HMVLLPVLKSMF+H+ K   G  LLVG+VQV CY+ILNALY+LGT SS++ +R+   +E NRHR L+G+C+AA+A  FPVAFLE++LN NN  SI +N   G+YSLEAR++L +L K + +L +I++++  LAESG    +EAP++IEVTLPMLCSYLP WW +GPE M                             N+     + P+TTVTA L+N VLG+VL+LI+ NIDSPHAPWMTRIA RTQPIV N+T +MLG++FLPV+E+L  HAL  ++ EE Y+AEK++GSE+  E EEEL+  VEILVRN+FAFYPLLIK+VD HR+AW+K+PT +T  LF+ VA +F++W ++  FKREE+NFV  +EID LSLI+P  G N     N+S    +  N+S   K + +KAK   +TSL VACIKRLLP+GLS  GGREQEL+  AK++LI++   ++ D    +E ++Q+E+D  IE +L NA+D E + D +TQ WQK+LYKKI +      +  + + S   EI + ++ +L+KV+HGLYLVDHPP++ KGSWKKL+SSQRKRAVMACFRM+PL+++P HR +NLF+  Y + WL  EE + V+LIE+VT        +K +E S    ++   A      +G +   +SE  +       +++LEL   TTT DP                                           L+QL+TAL R+A +QA DD LYL+YA IMSKSCS  +D++++E   +E   S QEQE +K Q+L+EQNRL++RGAAEMVLL++   +G  T V Q SIELGI+LLLGGN  VQ RML +L +KKL GFF S++GL Q+CSVLDLDTFERCNKAEGLA  GL D++GITNLYDA+FTCK+FRFLQLLCEGHNLAFQDYLR+QAGNT +VN+II TVDYLLRLQESIMDFYWHY+ KD+ID +GK + V+AIKIGKQ+FR+LTEYIQGPC+GNQLALAHSRLWDA++GF+++ A MQDKLS+DPDQL+LLREF+ LQKE+MIMLLSMLEGNVVNGPI KQMVDTL+ESSANVEMIL+FFDIFLRMK IT+SEAFLAFD+N DGWISH+EFR A+EQQK Y+PEEI YI+ CVD+N DGKVDF EFT+RF++PA+DIGFN+A+LLTNL EH+P+D RLERL+ KA+ +++ FEP+LGRIEITG +GRIERVYFEIRQ HIDQWE PQIK+SKRSFLHSVV E GDKEKLE FVNFCEDTI+EMQH+Q I+G+   + L +V+A    +  + L  +      ++ I   +  + +  +W  LR +++ DI+             VG F   L      +++         R      S  +T    S DR+ Y +      A              WLL  ++QL++ER DP  +A + E           I N   +T+  ++ +   N +S       + N  + S   +     +   T + P       S  NT  P S      N  Q+++ +                K +T  Y+ISLFA N Y FKI AL+LAF INF+LLF +V Q  P++  ++  S         TD D ++ E++   D+ +Y+G L  +LA +HS  + S L+AYY LKVPLV+FKREKEI RMLEFEGMWI+ QP +DNL+AHWDKLVLST SFPQ YWDKFVKKKVRNKYS QYD+++I  LLGM++ S  + + G    K     DIQYL+WKWGV+FTD +FLYL +YF  S  GN NYF +ACHLLDVA+SFKTLRTI+QSVTHNGKQLVLTVMLTS++IYLYTV+AFNFFRKFY+KDNDGV D KC++M TCF+FHLHTGLRAGGGIGDEIE+PDGD  ENYRILFD+TFFFFVI+ILLAIIQGLIIDAFG+LRDQLEQVKED+ESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP+GDCFRKQYEEEL+
Sbjct: 1538 GALGDMKSTGAGATSLDDVDLFLPTSSGHTSPLANLVDEFSFTVLVLPGQDPGLVHIGWVTSYFKLAKTSKPDHISGFLHNVSSQLQFDTTHGQLHGHSNQNPLLGDTSGSGIQPYAADLFTVRQAAVCLLESDLTLKSAVAERASFMVNLGQLLNQMATAEDLGKRMSQGLSLTCWVDIASGTLGFDLNGRDSGIRFQVEPSTRLFAAVFYRPTVKEAIHFEFGRRNRYTLPITASMLRPPRYTSTVLPHRLRVQALERVHWARVPPKAIKIFSMKISELRGWGTSIEYPVSEIAIRLPESDRCFIALELEEMPELLKYHSHTLELYRALCCHDNHNVAHYLTNHVDEYQLLHAMTASDMPGPLRSGFIDLMLVMHISSHVKLKQVTGKEFIVPMFKTEPKPKKNIFDFDERTGELDGKKINDDGGKVGDKEDEEYDFDRIPAVEEHISIRPELKTDPHLLILQCQECPGADGTGNLPVTSPEKTKEDNAMSTALNIAGSNG---LLKLSDCPPFPLNKLKLLCLDCLVDSVYKGGSIRDPAGGSYEHLLLPLVKTINSLLVMGVLDQKDIHTLLAILDPKSFKASLPLRGDSTYESLLEFHLPESVKLEICRLLHNLCDLQLRNRVEQVVKFASKFVQALQEDQNFRYMAIKKSNLPSSVAARRTREFRCPASVQMKSLLQIHGPGGPTGRAQETQAEPSTNETVSGNEEDDELEDVETNPCSEEVKEMLRSFHKLLCNKLGVMLPENNENNSANKSDSDKSADIGFDELHLHSPLLTRPSDTLSLASFGPSYPSDELQTALAQLQLVPPDMGHPEEGSGTPPWILKLLWNMIIRHPLTNDS-TIEVNEKNEQTSVTQFCHSGKRSLDGLIVYTIVKWAKEGFIESLELIREMFSALHRQYNATEELKNALEKTYVISGSSQDEVSRLLRSLGRVRSLLGVQLGSNEEILLKNCLWDLMNNKVFFQHPDLTRCLAVHETVMQLMVQTLTKATFEQPGGNTISKDVLH--------SSNQAVTTDITVTSVTGSSLPVLHEEGLNPNTGHGSHHQQQQQSQQQRGSTGPTEMVVQCCRFLCYFCRTSRDNQKAMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALALREKQLEKVAIYLSRCGVQSNAELLAKGYPDIGWDPVEGERFLDFLRFTVWVNGETVEENANLVVRLLIRRPECLGPALRGGS-KVMKHSAGNTGTDGLEIPPGGPDGLHAARGSTGQLISDTDCQPNL----------------AGGGLLKAMKEGLVMSAQIKLVKMAQEAE---AAGLNPEEEDLGWRTVLMDYEDANLFTPLPYNFESLPPEDDPDYIDLGAAILTFHSILVNLLGYCAPDMETVKSESIRARSILQSLVSMADLEGVLSLRFILPPPKLEVQTNEDGEDEWVDKAGMPPGLLPEHKASVVLFLERVYGISDAATFLRLLENGFLPDLRAATLLDSTVVPDSDMALALNRYLCNSVLPLLTRHTKYLGEEGTAGGLFEATLQTAYRLSKCRSITNHQREVVCDFLVALMQQIKPPMMSALLKKMVSDLRTLSKESVVSLRALTEFYQRCGTYYSSDGWTGGSQGSPGHSATSADDDPGCTSNGNGNNGSGSSGGADNVGGRSGDGETSASEEERSITAHLFILIFEKLSRQPYEPELFSYALPCLCSIACALPPDYS----ISQLNAMGQQNDSLGQNVGQSVFTDQMNSLLVPGAP-------RLEANDSLDELVHHDVFRPQPIDTSQVRLPAALNSLIQRFAEHCHDSWALDLIEQGYTFGAQVDEVRRTHPNLRSFSQLPPQEQMRYIHPVTDTLKTMLACGWSVDGDENRYRDAPGDTKHLRRQTITSDNLLNYNPSPKDLRGVNVTKEMLNMAERLADNAHNIWARQKMSDLEAIGGGVHQLLVPYDILTDNERKRYRRLTHELIKYLQYNGYRL---------------TVRTGSNSTNTNTNKGNGGTGGVRHHDN----RNLAPTSRFAYGLLNKLLDYVDSAMSSVREPMPSTRYSTSRSWLSSSQDMKFFVKVVLPLVERYFETQQAYFLDPVAGASIDEKKMAATLFCKLFSLLRIKLNTFGHDVKIAVSCLQGLVQTIDVKAILKMG-TAEDFVRSRILPFFVNAADDLCVVVRNLDASRYSHVKGTIKRGACSIDYIHMVLLPVLKSMFEHLGKNECGEYLLVGNVQVTCYRILNALYKLGTTSSKHANRQSFVDELNRHRALIGDCLAALASAFPVAFLEANLNSNNPLSITFNNRGGDYSLEARDVLEKLSKTIGDLQSIIKQVELLAESGATGASEAPYLIEVTLPMLCSYLPNWWRKGPECMSLTSCNDGSNEGGLGQDTKTGNLLPKTKGNSILANATGPLTTVTADLMNRVLGSVLQLIQTNIDSPHAPWMTRIATRTQPIVANSTADMLGQYFLPVSERLLEHALIVERVEEAYRAEKRAGSESVGEREEELSCLVEILVRNLFAFYPLLIKFVDRHRSAWLKKPTYETQRLFSAVARMFLVWIRATKFKREEENFVSAHEIDRLSLIVP-SGENLTPGINRSRTHTNGRNESSSLKNV-KKAKTGPHTSLTVACIKRLLPVGLSQLGGREQELVLSAKRKLIKETLSLTGDKG--LEHLMQRESDTAIEAFLNNALDQEGDLDHRTQNWQKLLYKKIDRTIAATGRHAELAISTRSEI-VDKIQILSKVMHGLYLVDHPPAVSKGSWKKLVSSQRKRAVMACFRMVPLYAMPTHRVMNLFIKGYITEWLDYEESLGVKLIEDVTSGALLKDLSKSNELSSTGGTNEAIAGTVHAIEGVQKSTDSETGAAQDLDMMDSTLELDLSTTTNDPGTAISSDSNKSASLLQTGSLQTSNSSSSQHTYGQDSSSCQPDPLTQLLTALCRSASDQAPDDPLYLAYAKIMSKSCS-GEDEEEEEENSNEEGSSFQEQEEQKQQLLSEQNRLAERGAAEMVLLQLAASKGESTPVAQASIELGIALLLGGNIGVQGRMLDYLMKKKLSGFFTSLAGLTQKCSVLDLDTFERCNKAEGLAV-GLSDMEGITNLYDADFTCKIFRFLQLLCEGHNLAFQDYLRTQAGNTVSVNLIISTVDYLLRLQESIMDFYWHYSNKDTIDESGKNSFVRAIKIGKQVFRSLTEYIQGPCIGNQLALAHSRLWDAVAGFIYVSAQMQDKLSRDPDQLDLLREFLNLQKELMIMLLSMLEGNVVNGPIAKQMVDTLIESSANVEMILRFFDIFLRMKVITTSEAFLAFDVNGDGWISHREFRLALEQQKTYSPEEINYIIACVDNNADGKVDFKEFTERFYNPAEDIGFNLALLLTNLSEHVPSDPRLERLIDKARGVLDVFEPHLGRIEITGSNGRIERVYFEIRQQHIDQWEAPQIKESKRSFLHSVVGESGDKEKLECFVNFCEDTIFEMQHAQSINGDEADIALNRVAAFNRFLEITHLAFIGHI---LSVILHCVRPSQLCATWNTLRQMTLPDILLTILGIIVGLIICVGRFGSHLLHLLWYIIVALASDISQKRSLTHCNSAVRTMVPWSVDRISYSKVATTTTAIQHHSSEIDTEQPWWLLSEDQQLLIERADPVHLATIKE--------EYAITNFATSTHLSHESEKSGNEMSPKPSGNWKNNNNITSPNCLTSPNLKKTSTSSAPPGTRIPTSVMNTSSPTSPT---VNQKQEDECKT---------------KFNTRNYVISLFASNFYRFKISALILAFVINFLLLFSKVNQISPNALGDEDASGNELGGNDGTDTDEELVEWVTSGDTSSYIGPLIALLAAVHSILSFSTLVAYYYLKVPLVIFKREKEICRMLEFEGMWISSQPAEDNLRAHWDKLVLSTSSFPQMYWDKFVKKKVRNKYSIQYDYDEITKLLGMDKTSSDTETGGTSLSKFFGDIDIQYLVWKWGVVFTDISFLYLAVYFAASAFGNLNYFLYACHLLDVAVSFKTLRTIIQSVTHNGKQLVLTVMLTSIVIYLYTVVAFNFFRKFYVKDNDGVPDPKCNDMKTCFIFHLHTGLRAGGGIGDEIEAPDGDESENYRILFDLTFFFFVIIILLAIIQGLIIDAFGDLRDQLEQVKEDLESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPIGDCFRKQYEEELQ 5667          

HSP 2 Score: 1640.17 bits (4246), Expect = 0.000e+0
Identity = 835/1453 (57.47%), Postives = 1058/1453 (72.81%), Query Frame = 2
Query:  122 PDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQS-VIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVP----------------HSNGEHSPQHE-----------------SVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSV-----SGSGN-EVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLD------EWVMEEQRSSLSKMNLH---EVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQS-AEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRI---------RNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAG--NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKL-ISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDI-NKKGKKMRLGKNPFKKNRSRDASPDI 4291
            P EEE SFLRT+D +CLS   HGSS+R CL+A GFG+R C LE +S E+ PP++  CVF+LDQALSVRALQE+++  + ++   GQSGH+TLLYGHA+ LKH  SNM+LSCLSTS+S DKLAFDVGLQ+ A +EACWWT+HPA+KQRS GEKVRIGDDLILVSVSSERYLH+    GE I  + VIASFQQTLWTV+PVSSGAIRQKS+ MV GGDV+RLFHGDE LT                  + +   SP ++                 +VMYEIGAVS+ ARSLWR+E  KTKWS GF +WGS+ RLRHVT+GRYL V     +G+G+ +V T+   +A  +++ F +R +KDDKK R EEHE + MG  D++ GET  +LQH +S RWLSYEAYE +KRGVG+VEEK+AV+L+EGHMDD F++ + QDEE +SA+AIRRC SVF  FI  L+         +  Q+S  +  N H   EV +CLEDLI+FF +P+  EEHEI+Q+KLTALRNRQ+LFQ EG+I  +L+TI++FTG F+ RR+F QA+GEDK + F++L NYLYLLLAA+IRGNR NCAQFA  +R+DW+F+RLE  Q  AEGVLD LHCVLTDSDEAL +IT+ HIR LI LLDK+GRDPRVLQ LCSLC+GRQGGAVRLNQ LIY+ LLP +DLLLQT+LVD C SVRPN+F+G ++  A Y KWY+E+ IDS+E VT+  A +RVGW+N EG+   P G  GWG+  +GDDLFS+ FDG  LW GGKPKR                  L  GDIIGC+LDLT PVIQF +N   V+GYF+DFNI G+FYPC+S +AK S R + G   GRL +GPP GYS +  A  P ++LRLEP F+FG L+K ++ G  NS T +  VF+PR V T+ IQLPNYVE +RD+LAEN+HEMW+M+KIDQGW YG+ RDD N  HPCLTTF++LP +++Q++VTLAYETLRTI++LGY I YE   EG+R++T+KL N F Q NGY+PQPLDL  I LS  +E LV+QLAENTHN+WA DRI  GW+YG VE+ + KRSPHLVPY +VD  I++SN+ T++ETVKTL+AY YS+E   +D S+    +S        S   RT+R Q+T  VT GKWYYE E+LT GF+R GW          IGS++ SYAF    A KWN     YG IC+PGDVIGCM+DL D+TI+FSLNGELMMDP+G EIAFK++  D GYVP FS G GQ  K+N+GNDV +LK+FT CGLQEGY P  VNM RP+P+WYSREDP LFVD+D+++  ++V + +G+ PT K+ + ++  +   E +FLRL L  +CKDHFT+KSL ERHA ++ +RRQL+P  + T    + +         + NL    Q+MS+STL++ +++GKK+RLG N FKK RSRD SP++
Sbjct:    5 PAEEETSFLRTEDFICLSCFSHGSSERLCLAAEGFGNRMCSLEIISRESPPPNMPPCVFVLDQALSVRALQEMLSIQHQSSDGSGQSGHRTLLYGHAIRLKHRESNMYLSCLSTSTSQDKLAFDVGLQQNAETEACWWTIHPASKQRSVGEKVRIGDDLILVSVSSERYLHVY---GEVISSNGVIASFQQTLWTVLPVSSGAIRQKSMNMVLGGDVVRLFHGDESLTAACATESEEFSSSVAMTVNGSAPGSPPNKVQRPSIVNSDLLSGSRHAVMYEIGAVSTSARSLWRIEHTKTKWSAGFFSWGSEIRLRHVTTGRYLGVLPSEANGNGHCDVVTLSAHEATNAASIFLIRPTKDDKK-RSEEHETEGMGEPDLRLGETLAYLQHAASGRWLSYEAYETRKRGVGRVEEKKAVLLIEGHMDDLFSLVRAQDEEIRSASAIRRCTSVFNNFIHALNYISSPQNITLPSQQSQCNLSNGHLLGEVTQCLEDLIEFFAQPHPHEEHEIQQSKLTALRNRQNLFQNEGMIGHVLSTIERFTGTFQTRREFSQAVGEDKADQFNELGNYLYLLLAALIRGNRENCAQFATPTRLDWLFNRLELQQGFAEGVLDALHCVLTDSDEALYLITERHIRTLIGLLDKQGRDPRVLQALCSLCLGRQGGAVRLNQELIYETLLPQKDLLLQTKLVDQCGSVRPNIFVGYKDGGAMYPKWYFEVIIDSLETVTHQPAKIRVGWANTEGYNAHPCGGPGWGAAGLGDDLFSYAFDGSCLWAGGKPKRATIGTDEATNEEATSNVPLKRGDIIGCLLDLTGPVIQFNVNGRLVRGYFQDFNISGLFYPCMSMNAKASARFLLGSNQGRLHHGPPPGYSPICYARQPGQKLRLEPVFTFGQLDKYVFTGPLNSPTPQQYVFVPRTVRTSHIQLPNYVEMVRDRLAENLHEMWSMRKIDQGWRYGERRDDENNLHPCLTTFDKLPPSDKQYNVTLAYETLRTIISLGYNITYEPLPEGTRMRTMKLSNGFTQVNGYKPQPLDLTQIRLSVRIEALVDQLAENTHNMWARDRIALGWTYGFVEDQSQKRSPHLVPYSEVDPIIQQSNKDTAIETVKTLIAYGYSLEPISSDSSDPGRGSS----NMDYSGPTRTYRGQATRAVTRGKWYYEAEILTSGFIRIGWAKKSAPPDLIIGSSNSSYAFAAHQARKWNRNGSVYGTICRPGDVIGCMMDLVDKTISFSLNGELMMDPLGLEIAFKHIKVDEGYVPAFSLGSGQQVKINYGNDVQSLKFFTYCGLQEGYKPLGVNMCRPLPMWYSREDPSLFVDVDRQHPSLKVNVSSGTTPTFKVTVKQVDYMSPEETQFLRLSLGTQCKDHFTSKSLNERHAHLDALRRQLEPEPIYTHGVGVGD---------SSNLVMMGQDMSASTLEVRDRRGKKIRLG-NMFKKARSRDPSPEV 1439          

HSP 3 Score: 110.923 bits (276), Expect = 1.110e-19
Identity = 59/210 (28.10%), Postives = 117/210 (55.71%), Query Frame = 2
Query: 2666 VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTIN------YEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            VF P+P++T++++LP  + ++  + AE+ H+ WA+  I+QG+T+G   D++ +THP L +F +LP  E+   +    +TL+T++A G++++       + P +   L+   + +  L +  Y P P DL  ++++  +  +  +LA+N HNIWA  ++    + G   +        LVPY+ + D+ +K  R+ + E +K L    Y +
Sbjct: 3265 VFRPQPIDTSQVRLPAALNSLIQRFAEHCHDSWALDLIEQGYTFGAQVDEVRRTHPNLRSFSQLPPQEQMRYIHPVTDTLKTMLACGWSVDGDENRYRDAPGDTKHLRRQTITSDNLLN--YNPSPKDLRGVNVTKEMLNMAERLADNAHNIWARQKMSDLEAIGGGVHQL------LVPYDILTDNERKRYRRLTHELIKYLQYNGYRL 3466          

HSP 4 Score: 101.293 bits (251), Expect = 9.585e-17
Identity = 52/153 (33.99%), Postives = 88/153 (57.52%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKA 9526
            F P+ V TSHI+LPN +E + D+ A++LH+ W++  +++G+ YG  R+D N  HP L +FD L   D+   +    E L+ +I+ G+ I      + +R+         T +N GY P P DL  + ++  +  + ++LAEN HN+WA+ + A
Sbjct:  911 FVPRTVRTSHIQLPNYVEMVRDRLAENLHEMWSMRKIDQGWRYGERRDDENNLHPCLTTFDKLPPSDKQYNVTLAYETLRTIISLGYNITYEPLPEGTRMRTMKLSNGFTQVN-GYKPQPLDLTQIRLSVRIEALVDQLAENTHNMWARDRIA 1062          

HSP 5 Score: 68.9366 bits (167), Expect = 5.561e-7
Identity = 29/92 (31.52%), Postives = 55/92 (59.78%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KPQP+D + IRL   +E+L+DQ A++ H+ WA + +  G+ YG   +   K  P+L+ +  +    Q    +  IE +K +IA+G++++
Sbjct: 1023 NGYKPQPLDLTQIRLSVRIEALVDQLAENTHNMWARDRIALGWTYGFVEDQSQKRSPHLVPYSEVDPIIQQSNKDTAIETVKTLIAYGYSLE 1114          
BLAST of Ryanodine receptor related vs. TrEMBL
Match: A0A4Z2DNF4 (Ryanodine receptor isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010886 PE=4 SV=1)

HSP 1 Score: 3864.31 bits (10020), Expect = 0.000e+0
Identity = 2166/4229 (51.22%), Postives = 2782/4229 (65.78%), Query Frame = 2
Query: 4439 VDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRS--------ILMKCSDNQSFDT---RVH--KGKSTLDHKTKGDSK--ESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGR-TRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEE------------IDFDFHKIPSQTESCSIYPNLISDD----------------------VTLKMLGEN---------GEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC------------------------CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRS---------------------------------------LHLLPMGIGHPEEGESIPQFLQNIL-NLFERRPIEESKLCIETAKIDENKNLSQ-----------VIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEE-----------------TTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLP--MIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPG--QGIANEEEKQ----------------------------------------------LTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQS---------LAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIE-MHGER---RRPTIIND---GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEY--SKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNC-TGEYSLEAREILGELEKNLPNLDAIVEEIVDL-AESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMH---------------ENATEEEISK------------PVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGS----NNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGK-----AKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTEST------KDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFT-------TTPDPLSQLITALKRTAMEQ---------------------------------------ASD----DSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDI-----------VVGVFRXXXXXXXXXXXXXXXXXC-FGGR-----FFLALVSGPKTSGDRLEY-------------QESLQKRKAWLLPPEEQLILERLDPAEIALLDEYQEEGMYQPVTIHNVP-DNTYYFNKIDDQDNISITEIDKQEINARL--------RSSTIVGP-QRCQLDITDNKPSS-----DNTKQPDSSERQDFNIYQDNDKQXXXXXXXXXINPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ---------------KPSSDPEKMNSTDPDDME--EFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQ--PSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEELK 15994
            +D+ D  LP      + L  L+D++ F+V+VLPGQD   + IGWVTS FKL+++         L   S    FDT   ++H    + T+   T G  +   ++ + V    +C LE+DL+LKS+V +   +++N+  +LN     +D+GK+MSQG+++ C++D ATG L F+LN R+  I FQV P T L+ A+F +PT +E   FE GR  R TLP+ A MLR PR  + +L  RL++Q L++ HW+RV     K+H +K++++RGWS + E  V  +AV +PE DRC   LELDE  +LL+FH  TLELY+ +CC+ NHNVAQ LT H+DE+Q  Y++    + G LR+ F DL++ MH+ SH +LK  T  E +VP+    ++   T+K+   +       D     +E             ++D  +IP+  E  SI P L +D                       VT K   EN         G +   KL  CP     +LK + L  L ++V KG  I +P GGS E++ +PL+K ++ LL+MG +  NDI+ +L++LD  +FK+  +LR      S+L   L ESVKL++C LLH LCD+QLR+R+E +V+ ++ FV  +Q DQ  RY+ IK+S+LPSSV A+ T+EFRCP   QM  +L    +       ++  +                         CAEE+K  +  FH+ L D  G+  PE  + N L N+      + S                                       L L+P  +GHPEEG   P ++   L N+  R+P   +   +E  + +E+ +++Q           +I  T++ WA   FIE+++LIREMFS L RQYNA+ E++N+L+KTYVIS  S+D+V++LLRSLGRVR LLGVQ+G  EE+LLKNCLWD+MNNKVFFQHP+LTR LAVHETVMQLMV TLT++        ++++    SS      Q     +VT    +S+P L EE                     Q++ + GP EMVVQCCRFLCYFCRTS  NQK MFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALA+REKQLEKVA+YLSR GVQSN ELL+KGYPDIGWDPVEGERFLDFLRFTVWVNGE +EENANLVVRLLIRRPECLGPALRG S  +  +   T      V            E+ G      FN       +A         GGGLLKAMKEG+VMSAQIKL K+AQE E   +A  NP+++ L    +  DYEDANLF  LPYNF +LPPEDDPDY+DLGAAILTF+S+LV+LLG CAP+ +T KS SLR R+ILQSLVSM DLEGVLSLRFILP P++E+  NEDGE+EW DKAGMPPGLLPEHKASVVLFLERVYGI D  TFLRLLEN FL D+RAAT+LD     DSD ALALNRYL NSVLPLLT+H+ YLGE      + E TL T YRLS+CRS+T  QRE V DFLVAL QQ++PPM+  LL+K++ D+ +L+ ESVV LR+LT FYQRCG YYSS G  G  QG                                                      +T  LF  IF+ L++ PY+PELFS ALPCL +I CAL PDY    S+  +     ++ S    TGQS         L PG P     +E  D    +      D F+PQP+DTS IRLP +L SL+++FA+H HDSWAL+++E+GY +G   +++ +THPNL +F  L   +QM+YI PV + LKAM+A GW++D D +R     GE    RR TI +D    YNP+PKDLRGVNVTKEML+MAE+LA+NAHNIWA+ K +D+++IGGGVHQ+LVP++ILTD E+ RYR+LT+EL+KYLQYNGYRL               T R G    S+S + +N     +  T       ++  + T+RFAY LLSKLL YV+ A+ +V++  PSSRYS +  +   ++D+KFF KVVLPLVERYF     YF+ P + A  +EKKMAATLFCKLFSLLR KL A GHD+ I+V CLQGLVQ ID++AI+K+  T+EDFVR R+LPFF+N ADDL ++++NL + R+SH+KGT++RGA S++Y+HMVLLPVLKSMF+H+ K   G  LLVG+VQV CY+ILNALY+LGT S+++ +R+   +E NRHR L+GEC+AA+A  FPVAFLE++LN NN  SI +N   G+YSLEAR++L EL K   +L +I++++  L         EAP++IEVTLPMLCSYLP WW +GPE M+               +NAT   + K            P+TTVTA L+N VLG+VL+LI+ NIDS HAPWMTRIA RTQPIV ++T +MLG++FLPV+E+L  HAL  ++ EE Y+AEK+SGSE   E EEEL++ VEILVRN+FAFYPLLIK+VD HR++W+K+PT +T  LF+ VA +F++W+++  FKREE+NFV  +EID LSLI+P  G+     N++    +  N+S   K + +KAK   +TSL VACIKRLLP+GLS  GGREQEL+  AK++LI++   ++ D    +E  +Q+E+D  IE YL NA+D E + D +TQ WQK+LYKKI +      +  +   S  KE+ + ++L+L+KV+HGLY+VDHP ++ KG+WKKL+SSQRKRAVMACFRM+PL+++P HR +NLFL  Y + WL  EE + V+LIE+VT         K +E       +    +     +G +    SE  +   L+++  T        T DP S + T   ++A  Q                                       ASD    D LYL+YA IMSKSCS  +D++++E   +E   S QEQE +K Q+L+EQNRL++RGAAEMVLL++   +G  T V Q SIELGI+LLLGGN  VQ RML +L  KKL GFF S++GL Q+CSVLDLDTFERCNKAEGLA  GL D++GITNLYDA+FTCK+FRFLQLLCEGHNL+FQDYLR+QAGNT +VN+II TVDYLLRLQESIMDFYWHY+ KD+ID +GK + ++AIKIGKQ+FR+LTEYIQGPC+GNQLALAHSRLWDA++GF+++ A MQDKLS+DPDQL+LLREF+ LQKE+MIMLLSMLEGNVVNGPI KQMVDTL ESSANVEMIL+FFDIFLRMK IT+SEAFLAFD+N DGWIS+KEFR A+EQQK Y+ EEI YI+ CVD+N DG+VDF EFT+RF++PA+DIGFN+A+LLTNL EH+P+D RLERL+ KA+ +++ FEP+LGRIEITG +GRIERVYFEIRQ HIDQWE PQIK+SKRSFLHSVV E GDKEKLE FVNFCEDTI+EMQH+Q I+G+   + L +V+A    +  + L  +      ++ I   +  + +  +W+ LR +++ DI           ++ V R+  +   LL  ++  +   FG +       LA+ +    S DR  Y              E  +++  WLL  ++QL++ER DP  +A ++E  E  M    T  N+  + T   N I  + + ++  I+    +            SS IV P  R    + +   SS      N KQP+  E    N                          +T  Y+ISLFA N Y FKI AL+LAF INF+LLF +V Q               + + D      +D +D E  E+I   D+ +Y+G L   LA +HS  + S L+AYY LKVPLV+FKREKEI RMLEFEGMWI+ QP +DNL+AHWDKLVLSTPSFPQ YWDKFVKKKVRNKYS QYD  +I  LLGM++  P   +G  G L K     DIQYLIWKWGV+FTD +FLYL +YF  S  GN NYF +ACHLLDVA+SFKTLRTI+QSVTHNGKQLVLTVMLTS++IYLYTV+AFNFFRKFY+KDNDGV D KC++M TCF+FHLHTGLRAGGGIGDEIE+PDGD  E+YRILFD+TFFFFVI+ILLAIIQGLIIDAFG+LRDQLEQVKED+ESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP+GDCFRKQYEEEL+
Sbjct: 1553 LDEMDLFLPAPGGHTSPLANLVDEFSFTVLVLPGQDPGLVHIGWVTSYFKLAKTSKQDHISGFLHNVSSQLQFDTTHGQLHGQSNQQTMLGDTGGSIQPYAADLFTVRQAAVCLLESDLTLKSAVAERASFMVNLGQLLNQMATPEDLGKRMSQGLSLTCWVDIATGTLGFDLNGRDSGIRFQVEPSTRLFAAVFYRPTVKEAIHFEFGRRNRYTLPITASMLRPPRCTSTVLPHRLRVQALERVHWARVPPKSMKMHSMKISKLRGWSTIIECPVSEIAVRLPESDRCFTALELDEMQELLKFHSHTLELYRALCCHDNHNVAQYLTNHVDEHQLLYVMTASDMPGPLRSGFIDLMLVMHISSHVKLKQVTGKEFIVPM---FKNEPKTKKNLFNFDEQIGEVDGKELSDEGYKVGDEEEKEEDEYDLDRIPAVGEHVSIRPELRTDSHLLIVQGQECPGADGTGNLPAPVTEKSKEENPIPAALNVTGSNGLLKLADCPSFPLVKLKLLCLNCLVDSVFKGGSIRDPAGGSYEHLLLPLIKTINCLLVMGTLDQNDIHTLLAILDPESFKTSLSLRGDSTYESLLQFHLPESVKLEICRLLHNLCDLQLRNRVEQVVKFASKFVQALQEDQNSRYMAIKKSNLPSSVAARRTREFRCPASIQMKSLLQMPGSGGPTGRLQEAPTIPPSNEPGSGEEDDEDELEGVETNRCAEEVKEMLRHFHKLLCDKLGVMLPENGE-NNLENKSDSNSSTDSRFDELRLHAPTLTHPSDTLSLASFGASYPSDELQAALAHLPLVPPDMGHPEEGSGTPPWILKFLWNMIIRKP-SGNDSTVEVNEKNEHTSVTQFYRSGKRSLDGLIVYTIVKWANEGFIESLELIREMFSALHRQYNAIEELRNALEKTYVISVSSQDEVSRLLRSLGRVRSLLGVQLGSNEEILLKNCLWDLMNNKVFFQHPDLTRCLAVHETVMQLMVQTLTKATFEQPSGSATVKDALHSS-----NQAATDITVTGVTGSSLPVLHEEGLGSNSGHSIHYHQQQQQQSHQQRGSAGPTEMVVQCCRFLCYFCRTSRDNQKAMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALALREKQLEKVAIYLSRCGVQSNAELLAKGYPDIGWDPVEGERFLDFLRFTVWVNGETVEENANLVVRLLIRRPECLGPALRGGSKVMKHSTGNTGTDGLEVPPGGPDGLNAVRESNGQV----FNESDCQLNLA---------GGGLLKAMKEGLVMSAQIKLVKMAQEAE---AAGLNPEEEDLGWRTVLMDYEDANLFTPLPYNFESLPPEDDPDYIDLGAAILTFHSILVNLLGYCAPDMETVKSESLRARSILQSLVSMADLEGVLSLRFILPPPKLEVQTNEDGEDEWVDKAGMPPGLLPEHKASVVLFLERVYGISDAATFLRLLENGFLPDLRAATLLDSAVVPDSDMALALNRYLCNSVLPLLTRHTQYLGEEGTAGGLFEATLQTVYRLSKCRSITNHQREVVCDFLVALMQQIRPPMMFALLKKMVSDLRTLSKESVVSLRVLTEFYQRCGTYYSSDGWTGSTQGATGNSAASADDDSGNIISGGSIGTGSSNGSAGYDNAGGRSGGDGESSASEEERSITAHLFILIFEKLSRQPYEPELFSYALPCLCSIACALPPDY----SISQLNAMDQQNDSLGQSTGQSVFTSQMNTLLVPGAPR----QETNDSPEELIHH---DVFRPQPIDTSQIRLPVALNSLIERFAEHCHDSWALDLIEQGYSFGAHVDEVRRTHPNLRAFSQLPPQEQMRYIHPVTDTLKAMLACGWSVDGDENRYRGTSGETKHLRRQTITSDNLLNYNPSPKDLRGVNVTKEMLNMAERLADNAHNIWARQKMSDLEAIGGGVHQLLVPYDILTDNERKRYRRLTHELIKYLQYNGYRL---------------TVRTG----SNSTN-TNTMHNGTGGTGGVRLHDNRNLTPTSRFAYGLLSKLLDYVDSAMSSVREPMPSSRYSTSRSWLSSSQDMKFFVKVVLPLVERYFETQHAYFLDPTAGASIDEKKMAATLFCKLFSLLRIKLNAFGHDVKIAVSCLQGLVQTIDVKAILKM-GTAEDFVRGRILPFFVNAADDLCVVVRNLDVGRYSHVKGTIKRGACSVDYVHMVLLPVLKSMFEHLGKNECGEYLLVGNVQVTCYRILNALYKLGTTSAKHANRQSFVDELNRHRALIGECLAALASAFPVAFLEANLNSNNPLSITFNNRGGDYSLEARDVLEELSKTTGDLQSIIKQVELLAEAGATGAAEAPYLIEVTLPMLCSYLPHWWRKGPECMNVTSCSGGSNEGGVGQDNATGNLLPKTKENNFLTGATGPLTTVTADLMNRVLGSVLQLIQTNIDSQHAPWMTRIATRTQPIVAHSTADMLGQYFLPVSERLLEHALIVERVEEAYRAEKRSGSENVGEREEELSRLVEILVRNLFAFYPLLIKFVDRHRSSWLKKPTYETQRLFSAVARMFLVWARATKFKREEENFVSAHEIDRLSLIVPSGGNLTPGMNRNRTQTNGRNESSNLKNV-KKAKTGPHTSLTVACIKRLLPVGLSQLGGREQELVLCAKRKLIKETLSLTGDRC--LEHSMQRESDSIIEAYLNNALDQEGDLDHRTQKWQKLLYKKIDQTIALTGRHAELVISTRKEV-VDKILILSKVMHGLYMVDHPQTISKGAWKKLVSSQRKRAVMACFRMVPLYAMPTHRVMNLFLKGYITEWLDYEESLGVKLIEDVTSGALLKDLLKSNELLSAGGGNDNAPSTAHAIEGVQKSAESETGANQDLDMMDSTLDLDLSSVTIDPGSPVSTDPSKSASLQQTSSSQTSDNSSGQFAYRQDSSTSKPDPLTQLLVALCRSASDQAPDDPLYLAYAKIMSKSCS-GEDEEEEEENSNEEGPSFQEQEEQKQQLLSEQNRLAERGAAEMVLLQLAASKGESTPVAQASIELGIALLLGGNIDVQGRMLDYLMRKKLSGFFTSLAGLTQKCSVLDLDTFERCNKAEGLAV-GLSDMEGITNLYDADFTCKIFRFLQLLCEGHNLSFQDYLRTQAGNTVSVNLIISTVDYLLRLQESIMDFYWHYSNKDTIDESGKSSFIRAIKIGKQVFRSLTEYIQGPCIGNQLALAHSRLWDAVAGFIYVSAQMQDKLSRDPDQLDLLREFLNLQKELMIMLLSMLEGNVVNGPIAKQMVDTLTESSANVEMILRFFDIFLRMKVITTSEAFLAFDVNGDGWISNKEFRLALEQQKTYSTEEINYIIACVDNNADGRVDFKEFTERFYNPAEDIGFNLALLLTNLSEHVPSDPRLERLIGKARGVLDVFEPHLGRIEITGSNGRIERVYFEIRQQHIDQWEAPQIKESKRSFLHSVVGESGDKEKLECFVNFCEDTIFEMQHAQSINGDEADMALNRVAAFNRFLEITHLDFIGHV---LSVIFHSIRPSQICATWQALRQMTIPDILLTLLGVIIGLIICVGRMGSHTLHLLWYIIVALASDFGQKRSLTHHHLAVRASMPWSVDRSSYLKVATTPSVIPHINEMDREQPWWLLSEDQQLLIERADPVHLATIEE--EYAMMNSATSSNISHETTKVGNDISPKLSTTLKSINNNVASLNFPSSPYLKKTSSPIVSPITRSPTSVVNTPSSSPPSPISNQKQPEGCEESKAN-------------------------FNTRNYVISLFASNFYRFKISALILAFVINFLLLFSKVNQISQNGLGDADNDIGNELNGDVNIDGDSDNNDKELVEWITSGDTSSYVGPLIATLAFVHSILSFSTLVAYYYLKVPLVIFKREKEICRMLEFEGMWISSQPAEDNLRAHWDKLVLSTPSFPQMYWDKFVKKKVRNKYSIQYDHGEITTLLGMDKINPDTETGRFG-LSKFFGGIDIQYLIWKWGVVFTDISFLYLAVYFAASAFGNLNYFLYACHLLDVAVSFKTLRTIIQSVTHNGKQLVLTVMLTSIVIYLYTVVAFNFFRKFYVKDNDGVPDPKCNDMKTCFIFHLHTGLRAGGGIGDEIEAPDGDESESYRILFDLTFFFFVIIILLAIIQGLIIDAFGDLRDQLEQVKEDLESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPIGDCFRKQYEEELQ 5686          

HSP 2 Score: 1642.86 bits (4253), Expect = 0.000e+0
Identity = 842/1457 (57.79%), Postives = 1050/1457 (72.07%), Query Frame = 2
Query:  122 PDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTV---------------------PHSNGEHSPQHE------------SVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSV-----SGSGN-EVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSL----------SKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQS-AEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRI---------RNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAG--NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKS-EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNL----QNMSSSTLDI-NKKGKKMRLGKNPFKKNRSRDASPDI 4291
            P EEE SFLRT+D +CLS   HGSS+R CL+A GFG+R C LE +S E+ PP++  CVF+LDQALSVRALQE+++  + ++  GGQSGH+TLLYGHA+ LKH  SNM+LSCLSTS+S DKLAFDVGLQ+ A SEACWWT+HPA+KQRS GEKVRIGDDLILVSVSSERYLH+  +   +    VIASFQQTLWTV+PVSSGAIRQKS+ MV GGDV+RLFHGDE LT                      P S     P+              +VMYEIGAVS+ A SLWR+E  KTKWS GF +WG + RLRHVT+GRYL V     +GSG+ +V T+   +A  +++ F +R SKDDKK R EEHE + MG  D++ GET  +LQH +S RWLSYEAYE +KRGVG+VEEK+AV+LVEGHMDD F++ + QDEE +SA+AIRRC SVF  FI  L+ ++   Q  SL          S   L EV +CLEDLI+FF +P+  E+HEI+Q+KL ALRNRQ+LFQ EG+I  +L+TI+KFTG F+ RR+F QA+GEDK + FD+L NYLYLLLAA+IRGNR NCAQFA  +R+DW+F+RLE  Q  AEGVLD LHCVLTDSDEAL +IT+ HIR LI LLDK+GRDPRVLQ LCSLC GRQGGAVRLNQ LIY+ LLP +DLLLQT+LVD C SVRPN+F+G ++  A Y KWY+E+ ID +E VT+  A +RVGW+N EG+   P G  GWG+ ++GDDLFS+ FDG  LW GGKPK+                  L  GDIIGC+LDLT PVIQF +N   VKGYF+DFNI G+FYPC+S +AK S R + G   GRL +GPP GYS +  A  P ++LRLEP F+FG L+K ++ G  NS T +  VF+PR V T+ IQLPNYVE +RD+LAEN+HEMW+M+KIDQGW YG+ RDD N  HPCLTTF++LP ++RQ++VTLAYETLRTI+ LGY I YE   EG+RL+T+KLPNSF Q NGY+PQPLDL  + LS  LE LV+QLAENTHN+WA DRI  GW+YG VE+++ KRSPHLVP+ +VD  I++SN+ T++ETVKTLL Y Y++E   ++ S+   SNS        S   RT+R Q T  VT GKWYYE E+LT GF+R GW          IGSN+ SY F    A KW+     YG +CQPGDVIGCM+DL D+TI+FSLNGELMMDP+G EIAFK++  D GYVP FS G GQ+ K+NFGNDV +LK+FT CGLQEGY P  VNM RP+P+WYSREDP LFVDI +++  ++V + +G+ PT K+  K      S E +FLRL L  +CKDHFT+KSL ERHA ++ +RRQL+P              P+Y   ++   T NL    Q+M++STL++ +++GKK+RLG N FKK RSRD SP++
Sbjct:    5 PAEEETSFLRTEDFICLSCFSHGSSERLCLAAEGFGNRMCSLEIISRESPPPNMPPCVFVLDQALSVRALQEMLSIQHQSSDGGGQSGHRTLLYGHAIRLKHRESNMYLSCLSTSTSQDKLAFDVGLQQNAESEACWWTIHPASKQRSVGEKVRIGDDLILVSVSSERYLHVYGEVNSS--HGVIASFQQTLWTVLPVSSGAIRQKSMHMVLGGDVVRLFHGDESLTAACATESEEFSPSITMAVNGTAPGSPPNKMPRPSIMNCDPLSSSRYAVMYEIGAVSTSACSLWRIEHKKTKWSAGFFSWGCEIRLRHVTTGRYLGVLPSEANGSGHCDVVTLSAHEATNAASIFLIRPSKDDKK-RMEEHEAEGMGEPDVRLGETLTYLQHAASGRWLSYEAYETRKRGVGRVEEKKAVLLVEGHMDDLFSLVRAQDEEIRSASAIRRCTSVFNNFIHTLN-YISSPQNISLPIQQCQYNLSSGHLLGEVTQCLEDLIEFFAQPSPHEDHEIQQSKLAALRNRQNLFQNEGMIGHVLSTIEKFTGTFQTRREFSQALGEDKADQFDELGNYLYLLLAALIRGNRENCAQFATPTRLDWLFNRLELQQGFAEGVLDALHCVLTDSDEALYLITERHIRTLIGLLDKQGRDPRVLQALCSLCYGRQGGAVRLNQELIYETLLPQKDLLLQTKLVDQCGSVRPNIFVGYKDGGAMYPKWYFEVIIDLLETVTHQPAKIRVGWANTEGYNAHPCGGPGWGAASLGDDLFSYAFDGSCLWAGGKPKQATIGTDETTNEETASNVPLKRGDIIGCLLDLTGPVIQFNVNGRLVKGYFQDFNITGLFYPCISMNAKASARFLLGSNQGRLHHGPPPGYSPICYARQPGQKLRLEPVFTFGQLDKYVFTGPLNSPTPQQYVFVPRTVRTSHIQLPNYVEIVRDRLAENLHEMWSMRKIDQGWKYGERRDDENGLHPCLTTFDKLPPSDRQYNVTLAYETLRTIIGLGYNITYEPLPEGTRLRTMKLPNSFTQVNGYKPQPLDLTQVRLSVRLEVLVDQLAENTHNMWARDRIALGWTYGFVEDHSQKRSPHLVPFSEVDPIIQQSNKDTAIETVKTLLVYGYTLEPISSESSDAGRSNS----TMDYSGPTRTYRGQITRAVTRGKWYYEAEILTSGFIRIGWAKKSAPPDLIIGSNNSSYGFAAHQARKWHRNGSAYGTVCQPGDVIGCMMDLIDKTISFSLNGELMMDPLGLEIAFKHIKVDEGYVPAFSLGSGQHVKINFGNDVQSLKFFTYCGLQEGYKPLGVNMCRPLPMWYSREDPSLFVDIGRQHPSLKVNVSSGTTPTFKVTVKQADYMSSEETQFLRLSLGTRCKDHFTSKSLNERHAHLDALRRQLEP-------------EPAYTQGVSAGTTSNLVIMGQDMTASTLEVRDRRGKKIRLG-NMFKKARSRDPSPEV 1439          

HSP 3 Score: 109.383 bits (272), Expect = 3.269e-19
Identity = 61/210 (29.05%), Postives = 118/210 (56.19%), Query Frame = 2
Query: 2666 VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINY-EMPSEGSRLKTIKLPNSFLQSN---GYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPH--LVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            VF P+P++T++I+LP  + ++ ++ AE+ H+ WA+  I+QG+++G + D++ +THP L  F +LP  E+   +    +TL+ ++A G++++  E    G+  +T  L    + S+    Y P P DL  ++++  +  +  +LA+N HNIWA  ++         +  A+    H  LVPY+ + D+ +K  R+ + E +K L    Y +
Sbjct: 3272 VFRPQPIDTSQIRLPVALNSLIERFAEHCHDSWALDLIEQGYSFGAHVDEVRRTHPNLRAFSQLPPQEQMRYIHPVTDTLKAMLACGWSVDGDENRYRGTSGETKHLRRQTITSDNLLNYNPSPKDLRGVNVTKEMLNMAERLADNAHNIWARQKMS--------DLEAIGGGVHQLLVPYDILTDNERKRYRRLTHELIKYLQYNGYRL 3473          

HSP 4 Score: 100.908 bits (250), Expect = 1.212e-16
Identity = 53/153 (34.64%), Postives = 87/153 (56.86%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKA 9526
            F P+ V TSHI+LPN +E + D+ A++LH+ W++  +++G+ YG  R+D N  HP L +FD L   D+   +    E L+ +I  G+ I      + +R+         T +N GY P P DL  V ++  +  + ++LAEN HN+WA+ + A
Sbjct:  911 FVPRTVRTSHIQLPNYVEIVRDRLAENLHEMWSMRKIDQGWKYGERRDDENGLHPCLTTFDKLPPSDRQYNVTLAYETLRTIIGLGYNITYEPLPEGTRLRTMKLPNSFTQVN-GYKPQPLDLTQVRLSVRLEVLVDQLAENTHNMWARDRIA 1062          

HSP 5 Score: 67.781 bits (164), Expect = 1.284e-6
Identity = 29/92 (31.52%), Postives = 53/92 (57.61%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KPQP+D + +RL   LE L+DQ A++ H+ WA + +  G+ YG   +   K  P+L+ F  +    Q    +  IE +K ++ +G+T++
Sbjct: 1023 NGYKPQPLDLTQVRLSVRLEVLVDQLAENTHNMWARDRIALGWTYGFVEDHSQKRSPHLVPFSEVDPIIQQSNKDTAIETVKTLLVYGYTLE 1114          
BLAST of Ryanodine receptor related vs. TrEMBL
Match: A0A4Z2DMG0 (Ryanodine receptor isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010886 PE=4 SV=1)

HSP 1 Score: 3851.21 bits (9986), Expect = 0.000e+0
Identity = 2163/4229 (51.15%), Postives = 2774/4229 (65.59%), Query Frame = 2
Query: 4439 VDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRS--------ILMKCSDNQSFDT---RVH--KGKSTLDHKTKGDSK--ESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGR-TRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEE------------IDFDFHKIPSQTESCSIYPNLISDD----------------------VTLKMLGEN---------GEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC------------------------CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRS---------------------------------------LHLLPMGIGHPEEGESIPQFLQNIL-NLFERRPIEESKLCIETAKIDENKNLSQ-----------VIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEE-----------------TTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLP--MIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPG--QGIANEEEKQ----------------------------------------------LTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQS---------LAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIE-MHGER---RRPTIIND---GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEY--SKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNC-TGEYSLEAREILGELEKNLPNLDAIVEEIVDL-AESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMH---------------ENATEEEISK------------PVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGS----NNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGK-----AKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTEST------KDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFT-------TTPDPLSQLITALKRTAMEQ---------------------------------------ASD----DSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDI-----------VVGVFRXXXXXXXXXXXXXXXXXC-FGGR-----FFLALVSGPKTSGDRLEY-------------QESLQKRKAWLLPPEEQLILERLDPAEIALLDEYQEEGMYQPVTIHNVP-DNTYYFNKIDDQDNISITEIDKQEINARL--------RSSTIVGP-QRCQLDITDNKPSS-----DNTKQPDSSERQDFNIYQDNDKQXXXXXXXXXINPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQ---------------KPSSDPEKMNSTDPDDME--EFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQ--PSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEELK 15994
            +D+ D  LP      + L  L+D++ F+V+VLPGQD   + IGWVTS FKL+++         L   S    FDT   ++H    + T+   T G  +   ++ + V    +C LE+DL+LKS+V +   +++N+  +LN     +D+GK+MSQG+++ C++D ATG L F+LN R+  I FQV P T L+ A+F +PT +E   FE GR  R TLP+ A MLR PR  + +L  RL++Q L++ HW+RV     K+H +K++++RGWS + E  V  +AV +PE DRC   LELDE  +LL+FH  TLELY+ +CC+ NHNVAQ LT H+DE+Q  Y++    + G LR+ F DL++ MH+ SH +LK  T  E +VP+    ++   T+K+   +       D     +E             ++D  +IP+  E  SI P L +D                       VT K   EN         G +   KL  CP     +LK + L  L ++V KG  I +P GGS E++ +PL+K ++ LL+MG +  NDI+ +L++LD  +FK+  +LR      S+L   L ESVKL++C LLH LCD+QLR+R+E +V+ ++ FV  +Q DQ  RY+ IK+S+LPSSV A+ T+EFRCP   QM  +L    +       ++  +                         CAEE+K  +  FH+ L D  G+  PE  + N L N+      + S                                       L L+P  +GHPEEG   P ++   L N+  R+P   +   +E  + +E+ +++Q           +I  T++ WA   FIE+++LIREMFS L RQYNA+ E++N+L+KTYVIS  S+D+V++LLRSLGRVR LLGVQ+G  EE+LLKNCLWD+MNNKVFFQHP+LTR LAVHETVMQLMV TLT++        ++++    SS      Q     +VT    +S+P L EE                     Q++ + GP EMVVQCCRFLCYFCRTS  NQK MFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALA+REKQLEKVA+YLSR GVQSN ELL+KGYPDIGWDPVEGERFLDFLRFTVWVNGE +EENANLVVRLLIRRPECLGPALRG S  +  +   T      V            E+ G      FN       +A         GGGLLKAMKEG+VMSAQIKL K+AQE E   +A  NP+++ L    +  DYEDANLF  LPYNF +LPPEDDPDY+DLGAAILTF+S+LV+LLG CAP+ +T KS SLR R+ILQSLVSM DLEGVLSLRFILP P++E+  NEDGE+EW DKAGMPPGLLPEHKASVVLFLERVYGI D  TFLRLLEN FL D+RAAT+LD     DSD ALALNRYL NSVLPLLT+H+ YLGE      + E TL T YRLS+CRS+T  QRE V DFLVAL QQ++PPM+  LL+K++ D+ +L+ ESVV LR+LT FYQRCG YYSS G  G  QG                                                      +T  LF  IF+ L++ PY+PELFS ALPCL +I CAL PDY    S+  +     ++ S    TGQS         L PG P     +E  D    +      D F+PQP+DTS IRLP +L SL+++FA+H HDSWAL+++E+GY +G   +++ +THPNL +F  L   +QM+YI PV + LKAM+A GW++D D +R     GE    RR TI +D    YNP+PKDLRGVNVTKEML+MAE+LA+NAHNIWA+ K +D+++IGGGVHQ+LVP++ILTD E+ RYR+LT+EL+KYLQYNGYRL               T R G    S+S + +N     +  T       ++  + T+RFAY LLSKLL YV+ A+ +V++  PSSRYS +  +   ++D+KFF KVVLPLVERYF     YF+ P + A  +EKKMAATLFCKLFSLLR KL A GHD+ I+V CLQGLVQ ID++AI+K+  T+EDFVR R+LPFF+N ADDL ++++NL + R+SH+KGT++RGA S++Y+HMVLLPVLKSMF+H+ K   G  LLVG+VQV CY+ILNALY+LGT S+++ +R+   +E NRHR L+GEC+AA+A  FPVAFLE++LN NN  SI +N   G+YSLEAR++L EL K   +L +I++++  L         EAP++IEVTLPMLCSYLP WW +GPE M+               +NAT   + K            P+TTVTA L+N VLG+VL+LI+ NIDS HAPWMTRIA RTQPIV ++T +MLG++FLPV+E+L  HAL  ++ EE Y+AEK+SGSE   E EEEL++ VEILVRN+FAFYPLLIK+VD HR++W+K+PT +T  LF+ VA +F++W+++  FKREE+NFV  +EID LSLI+P  G+     N++    +  N+S   K + +KAK   +TSL VACIKRLLP+GLS  GGREQEL+  AK++L                  I++E+D  IE YL NA+D E + D +TQ WQK+LYKKI +      +  +   S  KE+ + ++L+L+KV+HGLY+VDHP ++ KG+WKKL+SSQRKRAVMACFRM+PL+++P HR +NLFL  Y + WL  EE + V+LIE+VT         K +E       +    +     +G +    SE  +   L+++  T        T DP S + T   ++A  Q                                       ASD    D LYL+YA IMSKSCS  +D++++E   +E   S QEQE +K Q+L+EQNRL++RGAAEMVLL++   +G  T V Q SIELGI+LLLGGN  VQ RML +L  KKL GFF S++GL Q+CSVLDLDTFERCNKAEGLA  GL D++GITNLYDA+FTCK+FRFLQLLCEGHNL+FQDYLR+QAGNT +VN+II TVDYLLRLQESIMDFYWHY+ KD+ID +GK + ++AIKIGKQ+FR+LTEYIQGPC+GNQLALAHSRLWDA++GF+++ A MQDKLS+DPDQL+LLREF+ LQKE+MIMLLSMLEGNVVNGPI KQMVDTL ESSANVEMIL+FFDIFLRMK IT+SEAFLAFD+N DGWIS+KEFR A+EQQK Y+ EEI YI+ CVD+N DG+VDF EFT+RF++PA+DIGFN+A+LLTNL EH+P+D RLERL+ KA+ +++ FEP+LGRIEITG +GRIERVYFEIRQ HIDQWE PQIK+SKRSFLHSVV E GDKEKLE FVNFCEDTI+EMQH+Q I+G+   + L +V+A    +  + L  +      ++ I   +  + +  +W+ LR +++ DI           ++ V R+  +   LL  ++  +   FG +       LA+ +    S DR  Y              E  +++  WLL  ++QL++ER DP  +A ++E  E  M    T  N+  + T   N I  + + ++  I+    +            SS IV P  R    + +   SS      N KQP+  E    N                          +T  Y+ISLFA N Y FKI AL+LAF INF+LLF +V Q               + + D      +D +D E  E+I   D+ +Y+G L   LA +HS  + S L+AYY LKVPLV+FKREKEI RMLEFEGMWI+ QP +DNL+AHWDKLVLSTPSFPQ YWDKFVKKKVRNKYS QYD  +I  LLGM++  P   +G  G L K     DIQYLIWKWGV+FTD +FLYL +YF  S  GN NYF +ACHLLDVA+SFKTLRTI+QSVTHNGKQLVLTVMLTS++IYLYTV+AFNFFRKFY+KDNDGV D KC++M TCF+FHLHTGLRAGGGIGDEIE+PDGD  E+YRILFD+TFFFFVI+ILLAIIQGLIIDAFG+LRDQLEQVKED+ESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP+GDCFRKQYEEEL+
Sbjct: 1553 LDEMDLFLPAPGGHTSPLANLVDEFSFTVLVLPGQDPGLVHIGWVTSYFKLAKTSKQDHISGFLHNVSSQLQFDTTHGQLHGQSNQQTMLGDTGGSIQPYAADLFTVRQAAVCLLESDLTLKSAVAERASFMVNLGQLLNQMATPEDLGKRMSQGLSLTCWVDIATGTLGFDLNGRDSGIRFQVEPSTRLFAAVFYRPTVKEAIHFEFGRRNRYTLPITASMLRPPRCTSTVLPHRLRVQALERVHWARVPPKSMKMHSMKISKLRGWSTIIECPVSEIAVRLPESDRCFTALELDEMQELLKFHSHTLELYRALCCHDNHNVAQYLTNHVDEHQLLYVMTASDMPGPLRSGFIDLMLVMHISSHVKLKQVTGKEFIVPM---FKNEPKTKKNLFNFDEQIGEVDGKELSDEGYKVGDEEEKEEDEYDLDRIPAVGEHVSIRPELRTDSHLLIVQGQECPGADGTGNLPAPVTEKSKEENPIPAALNVTGSNGLLKLADCPSFPLVKLKLLCLNCLVDSVFKGGSIRDPAGGSYEHLLLPLIKTINCLLVMGTLDQNDIHTLLAILDPESFKTSLSLRGDSTYESLLQFHLPESVKLEICRLLHNLCDLQLRNRVEQVVKFASKFVQALQEDQNSRYMAIKKSNLPSSVAARRTREFRCPASIQMKSLLQMPGSGGPTGRLQEAPTIPPSNEPGSGEEDDEDELEGVETNRCAEEVKEMLRHFHKLLCDKLGVMLPENGE-NNLENKSDSNSSTDSRFDELRLHAPTLTHPSDTLSLASFGASYPSDELQAALAHLPLVPPDMGHPEEGSGTPPWILKFLWNMIIRKP-SGNDSTVEVNEKNEHTSVTQFYRSGKRSLDGLIVYTIVKWANEGFIESLELIREMFSALHRQYNAIEELRNALEKTYVISVSSQDEVSRLLRSLGRVRSLLGVQLGSNEEILLKNCLWDLMNNKVFFQHPDLTRCLAVHETVMQLMVQTLTKATFEQPSGSATVKDALHSS-----NQAATDITVTGVTGSSLPVLHEEGLGSNSGHSIHYHQQQQQQSHQQRGSAGPTEMVVQCCRFLCYFCRTSRDNQKAMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALALREKQLEKVAIYLSRCGVQSNAELLAKGYPDIGWDPVEGERFLDFLRFTVWVNGETVEENANLVVRLLIRRPECLGPALRGGSKVMKHSTGNTGTDGLEVPPGGPDGLNAVRESNGQV----FNESDCQLNLA---------GGGLLKAMKEGLVMSAQIKLVKMAQEAE---AAGLNPEEEDLGWRTVLMDYEDANLFTPLPYNFESLPPEDDPDYIDLGAAILTFHSILVNLLGYCAPDMETVKSESLRARSILQSLVSMADLEGVLSLRFILPPPKLEVQTNEDGEDEWVDKAGMPPGLLPEHKASVVLFLERVYGISDAATFLRLLENGFLPDLRAATLLDSAVVPDSDMALALNRYLCNSVLPLLTRHTQYLGEEGTAGGLFEATLQTVYRLSKCRSITNHQREVVCDFLVALMQQIRPPMMFALLKKMVSDLRTLSKESVVSLRVLTEFYQRCGTYYSSDGWTGSTQGATGNSAASADDDSGNIISGGSIGTGSSNGSAGYDNAGGRSGGDGESSASEEERSITAHLFILIFEKLSRQPYEPELFSYALPCLCSIACALPPDY----SISQLNAMDQQNDSLGQSTGQSVFTSQMNTLLVPGAPR----QETNDSPEELIHH---DVFRPQPIDTSQIRLPVALNSLIERFAEHCHDSWALDLIEQGYSFGAHVDEVRRTHPNLRAFSQLPPQEQMRYIHPVTDTLKAMLACGWSVDGDENRYRGTSGETKHLRRQTITSDNLLNYNPSPKDLRGVNVTKEMLNMAERLADNAHNIWARQKMSDLEAIGGGVHQLLVPYDILTDNERKRYRRLTHELIKYLQYNGYRL---------------TVRTG----SNSTN-TNTMHNGTGGTGGVRLHDNRNLTPTSRFAYGLLSKLLDYVDSAMSSVREPMPSSRYSTSRSWLSSSQDMKFFVKVVLPLVERYFETQHAYFLDPTAGASIDEKKMAATLFCKLFSLLRIKLNAFGHDVKIAVSCLQGLVQTIDVKAILKM-GTAEDFVRGRILPFFVNAADDLCVVVRNLDVGRYSHVKGTIKRGACSVDYVHMVLLPVLKSMFEHLGKNECGEYLLVGNVQVTCYRILNALYKLGTTSAKHANRQSFVDELNRHRALIGECLAALASAFPVAFLEANLNSNNPLSITFNNRGGDYSLEARDVLEELSKTTGDLQSIIKQVELLAEAGATGAAEAPYLIEVTLPMLCSYLPHWWRKGPECMNVTSCSGGSNEGGVGQDNATGNLLPKTKENNFLTGATGPLTTVTADLMNRVLGSVLQLIQTNIDSQHAPWMTRIATRTQPIVAHSTADMLGQYFLPVSERLLEHALIVERVEEAYRAEKRSGSENVGEREEELSRLVEILVRNLFAFYPLLIKFVDRHRSSWLKKPTYETQRLFSAVARMFLVWARATKFKREEENFVSAHEIDRLSLIVPSGGNLTPGMNRNRTQTNGRNESSNLKNV-KKAKTGPHTSLTVACIKRLLPVGLSQLGGREQELVLCAKRKL------------------IKRESDSIIEAYLNNALDQEGDLDHRTQKWQKLLYKKIDQTIALTGRHAELVISTRKEV-VDKILILSKVMHGLYMVDHPQTISKGAWKKLVSSQRKRAVMACFRMVPLYAMPTHRVMNLFLKGYITEWLDYEESLGVKLIEDVTSGALLKDLLKSNELLSAGGGNDNAPSTAHAIEGVQKSAESETGANQDLDMMDSTLDLDLSSVTIDPGSPVSTDPSKSASLQQTSSSQTSDNSSGQFAYRQDSSTSKPDPLTQLLVALCRSASDQAPDDPLYLAYAKIMSKSCS-GEDEEEEEENSNEEGPSFQEQEEQKQQLLSEQNRLAERGAAEMVLLQLAASKGESTPVAQASIELGIALLLGGNIDVQGRMLDYLMRKKLSGFFTSLAGLTQKCSVLDLDTFERCNKAEGLAV-GLSDMEGITNLYDADFTCKIFRFLQLLCEGHNLSFQDYLRTQAGNTVSVNLIISTVDYLLRLQESIMDFYWHYSNKDTIDESGKSSFIRAIKIGKQVFRSLTEYIQGPCIGNQLALAHSRLWDAVAGFIYVSAQMQDKLSRDPDQLDLLREFLNLQKELMIMLLSMLEGNVVNGPIAKQMVDTLTESSANVEMILRFFDIFLRMKVITTSEAFLAFDVNGDGWISNKEFRLALEQQKTYSTEEINYIIACVDNNADGRVDFKEFTERFYNPAEDIGFNLALLLTNLSEHVPSDPRLERLIGKARGVLDVFEPHLGRIEITGSNGRIERVYFEIRQQHIDQWEAPQIKESKRSFLHSVVGESGDKEKLECFVNFCEDTIFEMQHAQSINGDEADMALNRVAAFNRFLEITHLDFIGHV---LSVIFHSIRPSQICATWQALRQMTIPDILLTLLGVIIGLIICVGRMGSHTLHLLWYIIVALASDFGQKRSLTHHHLAVRASMPWSVDRSSYLKVATTPSVIPHINEMDREQPWWLLSEDQQLLIERADPVHLATIEE--EYAMMNSATSSNISHETTKVGNDISPKLSTTLKSINNNVASLNFPSSPYLKKTSSPIVSPITRSPTSVVNTPSSSPPSPISNQKQPEGCEESKAN-------------------------FNTRNYVISLFASNFYRFKISALILAFVINFLLLFSKVNQISQNGLGDADNDIGNELNGDVNIDGDSDNNDKELVEWITSGDTSSYVGPLIATLAFVHSILSFSTLVAYYYLKVPLVIFKREKEICRMLEFEGMWISSQPAEDNLRAHWDKLVLSTPSFPQMYWDKFVKKKVRNKYSIQYDHGEITTLLGMDKINPDTETGRFG-LSKFFGGIDIQYLIWKWGVVFTDISFLYLAVYFAASAFGNLNYFLYACHLLDVAVSFKTLRTIIQSVTHNGKQLVLTVMLTSIVIYLYTVVAFNFFRKFYVKDNDGVPDPKCNDMKTCFIFHLHTGLRAGGGIGDEIEAPDGDESESYRILFDLTFFFFVIIILLAIIQGLIIDAFGDLRDQLEQVKEDLESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPIGDCFRKQYEEELQ 5670          

HSP 2 Score: 1641.71 bits (4250), Expect = 0.000e+0
Identity = 842/1457 (57.79%), Postives = 1050/1457 (72.07%), Query Frame = 2
Query:  122 PDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTV---------------------PHSNGEHSPQHE------------SVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSV-----SGSGN-EVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSL----------SKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQS-AEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRI---------RNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAG--NSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKS-EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNL----QNMSSSTLDI-NKKGKKMRLGKNPFKKNRSRDASPDI 4291
            P EEE SFLRT+D +CLS   HGSS+R CL+A GFG+R C LE +S E+ PP++  CVF+LDQALSVRALQE+++  + ++  GGQSGH+TLLYGHA+ LKH  SNM+LSCLSTS+S DKLAFDVGLQ+ A SEACWWT+HPA+KQRS GEKVRIGDDLILVSVSSERYLH+  +   +    VIASFQQTLWTV+PVSSGAIRQKS+ MV GGDV+RLFHGDE LT                      P S     P+              +VMYEIGAVS+ A SLWR+E  KTKWS GF +WG + RLRHVT+GRYL V     +GSG+ +V T+   +A  +++ F +R SKDDKK R EEHE + MG  D++ GET  +LQH +S RWLSYEAYE +KRGVG+VEEK+AV+LVEGHMDD F++ + QDEE +SA+AIRRC SVF  FI  L+ ++   Q  SL          S   L EV +CLEDLI+FF +P+  E+HEI+Q+KL ALRNRQ+LFQ EG+I  +L+TI+KFTG F+ RR+F QA+GEDK + FD+L NYLYLLLAA+IRGNR NCAQFA  +R+DW+F+RLE  Q  AEGVLD LHCVLTDSDEAL +IT+ HIR LI LLDK+GRDPRVLQ LCSLC GRQGGAVRLNQ LIY+ LLP +DLLLQT+LVD C SVRPN+F+G ++  A Y KWY+E+ ID +E VT+  A +RVGW+N EG+   P G  GWG+ ++GDDLFS+ FDG  LW GGKPK+                  L  GDIIGC+LDLT PVIQF +N   VKGYF+DFNI G+FYPC+S +AK S R + G   GRL +GPP GYS +  A  P ++LRLEP F+FG L+K ++ G  NS T +  VF+PR V T+ IQLPNYVE +RD+LAEN+HEMW+M+KIDQGW YG+ RDD N  HPCLTTF++LP ++RQ++VTLAYETLRTI+ LGY I YE   EG+RL+T+KLPNSF Q NGY+PQPLDL  + LS  LE LV+QLAENTHN+WA DRI  GW+YG VE+++ KRSPHLVP+ +VD  I++SN+ T++ETVKTLL Y Y++E   ++ S+   SNS        S   RT+R Q T  VT GKWYYE E+LT GF+R GW          IGSN+ SY F    A KW+     YG +CQPGDVIGCM+DL D+TI+FSLNGELMMDP+G EIAFK++  D GYVP FS G GQ+ K+NFGNDV +LK+FT CGLQEGY P  VNM RP+P+WYSREDP LFVDI +++  ++V + +G+ PT K+  K      S E +FLRL L  +CKDHFT+KSL ERHA ++ +RRQL+P              P+Y   ++   T NL    Q+M++STL++ +++GKK+RLG N FKK RSRD SP++
Sbjct:    5 PAEEETSFLRTEDFICLSCFSHGSSERLCLAAEGFGNRMCSLEIISRESPPPNMPPCVFVLDQALSVRALQEMLSIQHQSSDGGGQSGHRTLLYGHAIRLKHRESNMYLSCLSTSTSQDKLAFDVGLQQNAESEACWWTIHPASKQRSVGEKVRIGDDLILVSVSSERYLHVYGEVNSS--HGVIASFQQTLWTVLPVSSGAIRQKSMHMVLGGDVVRLFHGDESLTAACATESEEFSPSITMAVNGTAPGSPPNKMPRPSIMNCDPLSSSRYAVMYEIGAVSTSACSLWRIEHKKTKWSAGFFSWGCEIRLRHVTTGRYLGVLPSEANGSGHCDVVTLSAHEATNAASIFLIRPSKDDKK-RMEEHEAEGMGEPDVRLGETLTYLQHAASGRWLSYEAYETRKRGVGRVEEKKAVLLVEGHMDDLFSLVRAQDEEIRSASAIRRCTSVFNNFIHTLN-YISSPQNISLPIQQCQYNLSSGHLLGEVTQCLEDLIEFFAQPSPHEDHEIQQSKLAALRNRQNLFQNEGMIGHVLSTIEKFTGTFQTRREFSQALGEDKADQFDELGNYLYLLLAALIRGNRENCAQFATPTRLDWLFNRLELQQGFAEGVLDALHCVLTDSDEALYLITERHIRTLIGLLDKQGRDPRVLQALCSLCYGRQGGAVRLNQELIYETLLPQKDLLLQTKLVDQCGSVRPNIFVGYKDGGAMYPKWYFEVIIDLLETVTHQPAKIRVGWANTEGYNAHPCGGPGWGAASLGDDLFSYAFDGSCLWAGGKPKQATIGTDETTNEETASNVPLKRGDIIGCLLDLTGPVIQFNVNGRLVKGYFQDFNITGLFYPCISMNAKASARFLLGSNQGRLHHGPPPGYSPICYARQPGQKLRLEPVFTFGQLDKYVFTGPLNSPTPQQYVFVPRTVRTSHIQLPNYVEIVRDRLAENLHEMWSMRKIDQGWKYGERRDDENGLHPCLTTFDKLPPSDRQYNVTLAYETLRTIIGLGYNITYEPLPEGTRLRTMKLPNSFTQVNGYKPQPLDLTQVRLSVRLEVLVDQLAENTHNMWARDRIALGWTYGFVEDHSQKRSPHLVPFSEVDPIIQQSNKDTAIETVKTLLVYGYTLEPISSESSDAGRSNS----TMDYSGPTRTYRGQITRAVTRGKWYYEAEILTSGFIRIGWAKKSAPPDLIIGSNNSSYGFAAHQARKWHRNGSAYGTVCQPGDVIGCMMDLIDKTISFSLNGELMMDPLGLEIAFKHIKVDEGYVPAFSLGSGQHVKINFGNDVQSLKFFTYCGLQEGYKPLGVNMCRPLPMWYSREDPSLFVDIGRQHPSLKVNVSSGTTPTFKVTVKQADYMSSEETQFLRLSLGTRCKDHFTSKSLNERHAHLDALRRQLEP-------------EPAYTQGVSAGTTSNLVIMGQDMTASTLEVRDRRGKKIRLG-NMFKKARSRDPSPEV 1439          

HSP 3 Score: 109.383 bits (272), Expect = 3.799e-19
Identity = 60/208 (28.85%), Postives = 117/208 (56.25%), Query Frame = 2
Query: 2666 VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINY-EMPSEGSRLKTIKLPNSFLQSN---GYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            VF P+P++T++I+LP  + ++ ++ AE+ H+ WA+  I+QG+++G + D++ +THP L  F +LP  E+   +    +TL+ ++A G++++  E    G+  +T  L    + S+    Y P P DL  ++++  +  +  +LA+N HNIWA  ++    + G   +        LVPY+ + D+ +K  R+ + E +K L    Y +
Sbjct: 3272 VFRPQPIDTSQIRLPVALNSLIERFAEHCHDSWALDLIEQGYSFGAHVDEVRRTHPNLRAFSQLPPQEQMRYIHPVTDTLKAMLACGWSVDGDENRYRGTSGETKHLRRQTITSDNLLNYNPSPKDLRGVNVTKEMLNMAERLADNAHNIWARQKMSDLEAIGGGVHQL------LVPYDILTDNERKRYRRLTHELIKYLQYNGYRL 3473          

HSP 4 Score: 100.908 bits (250), Expect = 1.317e-16
Identity = 53/153 (34.64%), Postives = 87/153 (56.86%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKA 9526
            F P+ V TSHI+LPN +E + D+ A++LH+ W++  +++G+ YG  R+D N  HP L +FD L   D+   +    E L+ +I  G+ I      + +R+         T +N GY P P DL  V ++  +  + ++LAEN HN+WA+ + A
Sbjct:  911 FVPRTVRTSHIQLPNYVEIVRDRLAENLHEMWSMRKIDQGWKYGERRDDENGLHPCLTTFDKLPPSDRQYNVTLAYETLRTIIGLGYNITYEPLPEGTRLRTMKLPNSFTQVN-GYKPQPLDLTQVRLSVRLEVLVDQLAENTHNMWARDRIA 1062          

HSP 5 Score: 67.781 bits (164), Expect = 1.328e-6
Identity = 29/92 (31.52%), Postives = 53/92 (57.61%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KPQP+D + +RL   LE L+DQ A++ H+ WA + +  G+ YG   +   K  P+L+ F  +    Q    +  IE +K ++ +G+T++
Sbjct: 1023 NGYKPQPLDLTQVRLSVRLEVLVDQLAENTHNMWARDRIALGWTYGFVEDHSQKRSPHLVPFSEVDPIIQQSNKDTAIETVKTLLVYGYTLE 1114          
BLAST of Ryanodine receptor related vs. TrEMBL
Match: A0A1S3I400 (ryanodine receptor OS=Lingula unguis OX=7574 GN=LOC106160113 PE=4 SV=1)

HSP 1 Score: 2809.63 bits (7282), Expect = 0.000e+0
Identity = 1562/2847 (54.86%), Postives = 1975/2847 (69.37%), Query Frame = 2
Query: 7784 GGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAE---LPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHG--ERR--RPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVG----PQS---MAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCT----GEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEE---------------ISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQ----------GSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQA---SDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGE------GEGLRLIQVSAIQDIIGTSKLLLMTKAFA----KITSITSLLNWTNVKHSWKFLRSVSVKDIVVGVFRXXXXXXXXXXXXXXXXXCFGGRFFLALVSGPK--------TSGDRLEYQESLQKRKAWLLP-PEEQLILER----LDPAEIAL--LDEYQEEGMYQPVTI-HNVPDNTYYFNKIDDQDNISITE------IDKQEINARLRSSTIVGPQRCQLD-ITDNKPSSDNTKQPDSSERQDFNIYQDNDKQXXXXXXXXXINPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEE----------------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRG--------WLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEE 15988
            GGGLLKAMK+GI MS QI   +    +  G  A  N    T  +  ++ ++ ++F     + Y+F  LPPEDD DY+D+G AIL FYS LVDLLGRCAP+ +   + +S SLR RAIL+SLVS+EDLEGVL L+FILP     +T   D  E  + +  +PPGLLP+HK++VV FLERVYGI D  TF RLLE+ FL D+RAAT LD  ++ DSD ALALNRYL NSVLPLLT ++H+  + +  +S+L++TLHT YRLS+CRSLTK Q++ V++FLV+LT  L+PPM+TKLLRKL ID+P L   +VVPLR+LT  Y+RCG YY + G    G A EEEK+LT  LF+ IFD+LA+  YDPELFSKALPCL+AIGCALSPDYS                                      Q +     AS  TD  + PQPV+T+ I L + LES+  +FA+H HDSWA++  ++ +VYG   ++ NK HPNL  F +L+  D ++ +EPV E+++AM+AWGWT+D D +R+   G  +RR  R ++ +  YNP P DLR + +T+EM +MAE+LA N+H++WA+ KK ++D+IGGG+HQ +VPF+ILTDKEK  +R+   ELLK+LQ  GYRL  N  + +   S+AG           ++  S   RQ     A+     +++E  RFAY LL KLL YV++A V +  ++PSSRYSR   ++  TED+KFFGKVVLPLVE+YF AHK YF+     PQ+   MA  +EK+M A+LFCKL  LLRQK+TA GHD++I+VRCLQ LV AID R++VK    S + VR  LLPFF N ADDL  ++ N+   RFSH+KGT+ RGA SLNY+HMVLLPVL SMFDH+   N G DLLVG++Q+A YKILNALY LGT ++   +R  + EE NRHRPLLGEC+A+ A TFPVAFLE  LN+ NK+S+LY  T     E+SLEA++++ +L  NLP LD IV EI +LAESGGKY EAPHVIEVTLPMLCSYLP WWS+GP+N+  N TE +                S  VTTVTA+L+N VLGNVLKLI+NN+ +P+APWM RIA RTQPI+ N+T+ ML EH LP+AEK+  +  + +  EE Y A K++  +  +E+EE+L+  + ILVR+++AF+PLLIKYVD HR+ W++ PT   + L+T +AEIF  W+KS  FKREE NFV QNEID+++LIMP Q           S N+S+   S    S  KK    K K+ SYTSLNVAC+KRLLPIGL++FGGREQEL+Q+AK +L                  IQKE +GDIEE+LK+++ LE+E+++    WQKVLYKKIG+ KF    E ++ +  ++RV+ +A+VLHGL+LV+HPP   KG+W+K+IS+QRKRAVMACFRM+PLH+LPRHR +NLF+ AY+  WL  E+   VRLIE++T S +                                  +   +       PD L+QL+TAL RTA  +     ++ LY+S+A IMSKSCSGED+DDDDE E D G  S QEQEMEK Q+L EQ+RL+DR AAEM+LL I   RG  T +V  +I+LGISLL GGN  +QSRML  L+EKK +GFF SI+G+MQ+CSVLDLD FER NKAE L  G      G+ NL+DAE TCKLFRFLQLLCEGHNL FQ+YLR+QAGN TTVNIIICTVDYLLRLQESIMDFYWHY+GKD ID AGK N V+AIK+ KQ+FRTLTEYIQGPC  NQLALAHSRLWDA+ GFL+IFAHMQDKLSKDP+QLELLREFMKLQK+MMIMLLSMLEGNV+NGPIGKQMVDTLVESSANVEMILKFFDIFL+MKD+T+SEAFL FD NKDGWIS KEFR AM  QKMY  EEI+YIMMCVD+N DGKVDF EFTDRFH+PAKDIGFNVAVLLTNL EHMP++ RL RL+ +AK +++ F  YLGRIEI G SGRIERVYFEI+QSHIDQWEKPQIK+SKRSFLHSVVNEGGDKEKLESFVNFCEDTI+EMQH+  IS E           L + + + +  G   +  +   F+     I    S  +W N+KH ++ ++ ++  ++++ + +L       +M L+++I+   G++ +A++ G +         S   L Y   L        P P +QL  E      DP +  +  LD ++EE     V + +++  +  +  +   + ++ ++E      +  ++           G    Q D     KP  D    P   E        D  KQ  ++E      P+E+K  + G +++  FA+N YNFK  ALVLAF INF+LLFY+V + P +  +  N     DM E                      +I +  ++ Y+  + ++ A  H+  + S+ IAYYCLKVPLV+FKREKEI+R LEFEGMWI EQP++D++K+HWDKLVLST SFP++YWDKFVKKKVRNKY EQ+DF++I NLLGM + S   G           +L   +   D QY IWKWGVIFTDN+FLYL  + + S++GNFNYFFFA HLLD+AI  K L TILQSVTHNGKQLVLTVMLT V++Y+YTVIAFNFFR+FY K+ DG KD KC +MLTCF+FHL+ G+RAGGGIGDEIE+PDGDPYE YRILFDITFFFFVIVILLAI+QGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDK+PHGFEQHV  EHNFANYM+FLMH+INKPDTEYTGQE+YVWELY QRCWDFFPVGDCFRKQYE+E
Sbjct:  801 GGGLLKAMKDGIRMSEQIAASR--DSMSSGFLAAINDDNDTEFLRQSEEKNRHIFLTHDGVKYDFSTLPPEDDEDYIDMGGAILDFYSALVDLLGRCAPDAEIIKSGRSDSLRARAILRSLVSVEDLEGVLGLKFILP-----ITSQSDDGEAKQSEGSLPPGLLPQHKSAVVQFLERVYGIPDQSTFFRLLEDGFLPDLRAATTLDTAAASDSDMALALNRYLCNSVLPLLTAYAHFFDDADHVSSLLDSTLHTTYRLSKCRSLTKNQKDLVTEFLVSLTGHLRPPMMTKLLRKLTIDLPGLNENTVVPLRVLTHHYERCGRYYGTGGWGSWGAATEEEKKLTMMLFTLIFDSLAQRAYDPELFSKALPCLSAIGCALSPDYSLS-----------------------------------NQDEPWLKDASLDTDGMYNPQPVETTRISLSSPLESVARKFAEHYHDSWAVKKFDQSWVYGPAYDEDNKIHPNLKPFSMLNNKDSVRCLEPVRESMRAMLAWGWTLDVDQNRLTSGGSLKRRGSRVSVDSQNYNPRPVDLRNLTLTREMQNMAERLASNSHDVWARKKKDELDAIGGGIHQQVVPFDILTDKEKRPHRERAQELLKFLQMQGYRLQSNDMADNRKMSVAGPR---------TVSNS---RQSKDSEADSGVGVSATEK-RFAYSLLEKLLEYVDKAAVNLNTLKPSSRYSRRESYTMATEDVKFFGKVVLPLVEKYFRAHKVYFIAAPGMPQASVGMASVKEKEMTASLFCKLAYLLRQKITAFGHDVDIAVRCLQVLVHAIDARSVVK---NSPEIVRSSLLPFFNNAADDLYQVVHNIKSGRFSHVKGTISRGATSLNYVHMVLLPVLSSMFDHLGSNNYGADLLVGEMQLASYKILNALYTLGTSTAACVERIYLLEEMNRHRPLLGECIASFASTFPVAFLEPQLNRYNKHSMLYGITEERIAEHSLEAQDVMKQLADNLPTLDKIVAEIEELAESGGKYQEAPHVIEVTLPMLCSYLPFWWSQGPDNV--NLTEGQDYGSDRRNSLQFDTSSSNHVTTVTAQLMNAVLGNVLKLIKNNVGTPNAPWMNRIATRTQPIIANSTLEMLEEHMLPLAEKITDNRHKVELLEEQYNAIKRNQQDIDSEIEEQLHDAMHILVRDIYAFFPLLIKYVDQHRSHWLRNPTVGAEKLYTCIAEIFTYWTKSPFFKREEHNFVTQNEIDNMALIMPSQQGKSLQVVRADSGNQSQDQESTVPKSGRKK---HKPKMDSYTSLNVACLKRLLPIGLNLFGGREQELVQQAKDKL------------------IQKEPEGDIEEFLKSSLMLEDENEENDNKWQKVLYKKIGRTKFAGVVE-MTLDHAVERVMSMARVLHGLHLVEHPPPSHKGAWRKVISTQRKRAVMACFRMVPLHNLPRHRVINLFMKAYKEQWLIMEDIGQVRLIEDLTHSEE---------------------------------EDIEKKEEEEEEKPDALTQLVTALSRTATTEQDTLQENFLYMSFAQIMSKSCSGEDEDDDDENEEDPGA-SFQEQEMEKQQLLFEQSRLADRAAAEMMLLYISASRGAWTDMVINTIDLGISLLRGGNEEIQSRMLTHLREKKDVGFFTSIAGMMQRCSVLDLDAFERNNKAESLGVGS-EGAAGVKNLHDAEQTCKLFRFLQLLCEGHNLEFQNYLRTQAGNNTTVNIIICTVDYLLRLQESIMDFYWHYSGKDVIDPAGKDNFVRAIKVAKQVFRTLTEYIQGPCSQNQLALAHSRLWDAVGGFLYIFAHMQDKLSKDPEQLELLREFMKLQKDMMIMLLSMLEGNVMNGPIGKQMVDTLVESSANVEMILKFFDIFLKMKDMTTSEAFLEFDTNKDGWISCKEFRRAMLDQKMYKSEEIDYIMMCVDTNQDGKVDFMEFTDRFHNPAKDIGFNVAVLLTNLSEHMPSEPRLARLMERAKPVLDYFGMYLGRIEILGSSGRIERVYFEIKQSHIDQWEKPQIKESKRSFLHSVVNEGGDKEKLESFVNFCEDTIFEMQHATSISAEEQMAQMATAAALRKEAGLPEEQGAVAINAVKTGFSMLKDGILLFLSFFSWANIKHGYQTVKGMTFSEMLLALMKLGAKAVLAIMTLMFHIVWMLGKWVIAMMMGDQGGDLPSKDVSHKALPYASPLALEGEKARPGPGKQLGREAEMAGEDPEQYRVFGLDIHREE---TDVGVEYSLSASQRHLAQTTPESSLDMSEGEMADHLQPKQNGIHAGEPAYGGTHGDQYDAFHQKKPPHD---APAGGEHASGEDVTDKRKQAKDDEL-----PYEIKGTEYGNFVLGWFARNFYNFKFAALVLAFIINFVLLFYQVVKVPIAGEDVGN-----DMAEAAVNATEGEEGGEEPSEEEFEEWITMASTLYYLLPVVQLCALAHTIVSFSIAIAYYCLKVPLVIFKREKEIARKLEFEGMWIAEQPSEDDIKSHWDKLVLSTASFPESYWDKFVKKKVRNKYCEQFDFDEISNLLGMEKGSTIPGKDAHQEQPKSRFLPHFLQGVDWQYHIWKWGVIFTDNSFLYLLCFCLFSVLGNFNYFFFAAHLLDLAIGIKALSTILQSVTHNGKQLVLTVMLTIVVVYVYTVIAFNFFRQFYAKEEDGEKDYKCQDMLTCFIFHLYVGVRAGGGIGDEIEAPDGDPYEVYRILFDITFFFFVIVILLAIMQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKVPHGFEQHVMNEHNFANYMFFLMHLINKPDTEYTGQESYVWELYNQRCWDFFPVGDCFRKQYEDE 3514          

HSP 2 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 409/917 (44.60%), Postives = 535/917 (58.34%), Query Frame = 2
Query: 5009 FELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLI---SDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDD---ISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDE----NKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEF 7726
            FELGRT+ TLP+ A + R  +   P   SRL +Q+L    WS V N   K++ LKL+E+RGWS+L E  V M+ +HIPEEDR LDILEL EH + L+FH  TLELY+ IC +GNH  A  LT H+DE Q  Y IQ+ YL G LR  F DLLI+MHLESH+  +L TQNE ++PL           K   ++ +  K  +  S           IP    S SI P+L      +V    LG       P     P      LK  ++  L  AV  G   I +PIGGS EN+FVPLL+++D LL+MGM    D++ +  ++D  TF  + +         +L M L E VKL++CHLL  LCD QLR R+E I+  + DF + +QNDQ  RY  IKQSDLP ++ AK T+EFRC P++QM  +LNF        EE +D   +  C+++LK  +  FH +L+++C +   +            + K +    + P     P       + LQ +    E +  E  +   +  K DE    + +L  +I  T+  WA+  FI +  L++EMFSLL+RQY+ +GE+  ++ KTYVIS  S  D+  L+++LG +R LL VQV   EE  LK+ + D+++NKVFFQHP+L R L VHETVMQLMV+TL + +         ++   D           V Q V                       D   +MVV CCRFLCYFCRTS QNQ+ MF+HLSY+LENSSMLLA PSLRG+CPLDVAYSS+MDNNELALA+RE  LEKVAVYLSR+GVQSN ELL+KGYPDIGWDPVEGERFLDFLRF VWVNGE +EEN+NLVVRLLIRRPECLGPALRG    + +A          +  S    + G    I   + +EF
Sbjct:    4 FELGRTKTTLPLSAALFRGAKDLIPQCPSRLDVQLLVPHRWSSVPNKSLKVNTLKLSEIRGWSMLCESPVAMLGLHIPEEDRSLDILELIEHTEALKFHVHTLELYRAICSHGNHRAAYELTKHVDERQLMYCIQSEYLSGALRMGFHDLLISMHLESHAVTRLMTQNEFIIPLVAD-------PKPLYQFVDKDKEKERQS-----------IPKLERSVSIRPHLQLEGESNVGSMNLGVPEGVTPPAPMAAPPFYLGALKEHTMHSLVMAVKTGGPHIRDPIGGSQENLFVPLLRLIDRLLVMGMCTEEDLHQLFVLIDPHTFDKERSF----CAEGLLQMKLAEPVKLEMCHLLKHLCDCQLRKRMESIMSFATDFCAAVQNDQRVRYNYIKQSDLPPAIAAKKTREFRCTPQEQMRSLLNFK------SEEDEDGGMVCPCSDDLKEILKNFHNELLEHCAVPSSK------------EEKETEVEAVEP-----PPASSWQDKILQLVAKKREEKKAETDEGKKQGEKPDEILGWSGSLQNLISNTMRKWAEEDFITDQSLVQEMFSLLYRQYDGIGEVLRAILKTYVISAASTHDINNLVKALGNIRALLNVQVAPQEEETLKSSIKDLLDNKVFFQHPDLMRALYVHETVMQLMVNTLNKQQQQQAAGGGEVKRDGD-----------VEQPV-----------------------DNSTDMVVMCCRFLCYFCRTSRQNQRAMFDHLSYLLENSSMLLAHPSLRGSCPLDVAYSSMMDNNELALALRESHLEKVAVYLSRAGVQSNSELLAKGYPDIGWDPVEGERFLDFLRFCVWVNGESVEENSNLVVRLLIRRPECLGPALRGEGGGLLKAMKDGIRMSEQIAASRDSMSSGFLAAINDDNDTEF 841          

HSP 3 Score: 109.768 bits (273), Expect = 2.880e-19
Identity = 68/235 (28.94%), Postives = 128/235 (54.47%), Query Frame = 2
Query: 2591 LEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMP--SEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPH--LVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIET 3283
            L P +S  N ++  +  ++    + ++ P+PVET  I L + +E++  K AE+ H+ WA++K DQ W YG   D+ NK HP L  F  L + +    +    E++R ++A G+T++ +    + G  LK  +     + S  Y P+P+DL N++L+  ++ +  +LA N+H++WA  R K+       E +A+    H  +VP++ + D  K+ +R+ + E +K L    Y +++
Sbjct: 1172 LSPDYSLSNQDEP-WLKDASLDTDGMYNPQPVETTRISLSSPLESVARKFAEHYHDSWAVKKFDQSWVYGPAYDEDNKIHPNLKPFSMLNNKDSVRCLEPVRESMRAMLAWGWTLDVDQNRLTSGGSLKR-RGSRVSVDSQNYNPRPVDLRNLTLTREMQNMAERLASNSHDVWA--RKKKD------ELDAIGGGIHQQVVPFDILTDKEKRPHRERAQELLKFLQMQGYRLQS 1396          
BLAST of Ryanodine receptor related vs. Ensembl Cavefish
Match: RYR2 (ryanodine receptor 2 [Source:HGNC Symbol;Acc:HGNC:10484])

HSP 1 Score: 1743.01 bits (4513), Expect = 0.000e+0
Identity = 1041/2546 (40.89%), Postives = 1457/2546 (57.23%), Query Frame = 2
Query:  155 DDHVCL--SSVGHGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVA---KGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSP-QHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSE------TKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNL--ISDDVTLKMLGENGEDIFPK--LDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF------------------------KSKPALR-----------MPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            DD V L  S+  H    + CL+A GFG+R CFLE+ S   N PPDLS+C F+L+Q+LSVRALQE++A   +  +  A GG  GH+TLLYGHAVLL+H+ S M+L CLSTS SS DKLAFDVGLQE+   EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  NG      V A+FQQTLW+V P+ SG+  + + G + GGDVLRL HG  DECLTVP  +GEH   Q  +V YE GAVS+HARSLWRLE ++  WSG    WG   RLRHVT+G+YLS+      +  + + +A   STAF  R SK+ K       E D MG  DIK+G++  ++QHV +  WL+Y++    K       +++A++  EGHMDDG T+++ Q EES++A  IR    +F RFI+ LD  + ++ ++S+  + +  V   L+DLI +F  P+   EHE KQ +L AL+NRQ+LFQEEG+INL+L  ID+    +     F +  G +  E +  + N LY LLAA+IRGNR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRL +  SS+RPN+F+GV E SA Y+KWYYE+ +D +E  VT     LRVGW++  G+ P+PGG +GWG   VGDDL+S+GFDG +LW+G   + + +   Q +L   D++ C LDL+ P I F IN +PV+G F +FN DG+F+P VS SA V VR + GG HG  ++ PP GY+  FEA+LP+E+LR+E    +    K  +AG  +      +     F P PV+T++I LP ++E IR+KLAENIHE+W M KID GW YG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +         ++K +KL   +  S+GY+P P+DL +I L+S  E +V++LAEN HN+WA DRI+QGW+YG  ++   KR+P LVPY  +D+  KKSN+ +  E V+TLL Y Y++E P  D +  A   + +      +   R FRA+ ++ V +GKWY+E+E++T G MR GW         E+GS+ Q++ FD   A +W+  +  +G+    GDV+GCM+D+ + T+ F+LNGE+++D  G E+AFK+     G++P  S G  Q  ++NFG DV TLKYFT CGLQEGY PF VNM+R + +W S+  P  F+ +   +  +EV    G+V   P LK+  + FG Q S  ++ F RL +PI+C + F   +     A+      + D     T  D  +  M S  G +  N  +  ++  ++  D N++ K  +L K  F   RS+   PD    T+  S +                      S  V+ D           DD +YL+                YY+SV + PGQ+   +++GWVTS F               +D      K      T GD K                    +  S+  S  Y++   +  NN G       + + G+ IGC +D A+G LTF  N +EL   +Q     SLY  MF  P       ++     N +P+ AG+ +  ++   P    RL +Q L    WSRV N   +  + ++NE  GW +   + +Q M++HIPEE+R +DILEL E   LL+FH  TL LY  +C  GN+ VA +L +H+DE+Q    IQN Y+ G LRT ++DLLI +HL S++  +L   +E +VP+    +S  +     +K                     H +P    S S+ P +   S D    + G NG  +         PE   E LK+ +++ L  AV +G+  + +P+GGS E +FVPL+K+   LLIMG+  + D+  IL +++ + F                        +  PA+            +P+    +L M L E VKLQ+C LL  LCD Q+RHRIE +V  S+DFV+++Q++Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +L F      C         C E+++ ++  FH                  +L+  C         H       H     +      N+LN+    P                  L Q+I  T++ WA+   IE+ +L+R MF LL RQY+ +G +  +L KTY I+  S +D   LL SLG++R LL V++G  EE L+   L DIMNNKVF+QHPNL R L +HETVM++MV+ L                    S G                         E+ E+   K      MV  CCRFLCYFCR S QNQK MF+HLSY+LENSS+ LA PS+RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+  G+QS V L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENAN+VVRLLIRRPEC GPALRG
Sbjct:   11 DDEVVLQCSATLHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTEEKAEGTAQGG--GHRTLLYGHAVLLRHSYSGMYLCCLSTSHSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSL---HVDAAFQQTLWSVAPICSGS--EVAQGFLIGGDVLRLLHGHMDECLTVP--SGEHGEEQRRTVHYEGGAVSTHARSLWRLETLRVAWSGSHTRWGQPFRLRHVTTGKYLSLLDDKG-LQLMEKEKADVKSTAFCFRSSKE-KLDFGLRKEVDGMGVPDIKYGDSVCYIQHVDTGLWLTYQS-VDAKCARMGGVQRKAIMHHEGHMDDGLTLSRSQHEESRTARVIRSTVFLFNRFIRGLDT-LSKKGKTSMLDLPIESVSLSLQDLIGYFQPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLH-VYSSAAHFAEVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVC-HGVAVRSNQHLICDNLLPGRDLLLQTRLANHVSSMRPNIFLGVSEGSAQYRKWYYELIVDHVEPFVTAEATHLRVGWASTPGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGCIARTVSSP-NQHLLCADDVVSCCLDLSAPSISFRINGQPVQGMFENFNSDGLFFPVVSFSAGVKVRYLLGGRHGEFKFLPPTGYAPCFEAVLPREKLRVEQSQEY----KQDHAGTRDLLGPTVSLSQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIDLGWMYGAIRDDNKRQHPCLVEFSKLPEQERSYNLQMSLETLKTLLALGCHVGVADERAVEKVKRLKLSAKYELSSGYKPTPMDLSHIKLASTQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNKRNPRLVPYVLLDERTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARADITTMS------AERFRIFRAEKSYSVNAGKWYFELEVVTAGEMRVGWARPGCLPDLELGSDDQAFVFDGFKAQRWHQGNEHFGRSWLAGDVVGCMVDMNEHTMMFTLNGEVLLDDSGSELAFKDFEVWEGFIPVCSLGVTQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNMNRDITMWLSKRLP-QFIPVPTGHEHIEVTRIDGTVESCPCLKVTQRSFGSQNSNTDIVFYRLSMPIECAEGFAKSAGGTLPANGSFFSPKKDLEDFETVSDFEV-LMKSAHGHMGSNGPEKDKDEFNNHKDYNQE-KPSKL-KQRFMLKRSK---PDF--NTSNSSAR---------------------LSEEVMAD---------ERDDFEYLMQ------------TSTYYYSVRIFPGQEPSSVWVGWVTSDF-------------HQYDPAFQLDKVRTVTVTLGDEKGK------------------VHESIKRSNCYMVWAGES-NNPGQ-----GRNNNGLEIGCMVDTASGLLTFTTNGKELSTYYQWL-HHSLYLCMF--PVFVCVCVYQ-----NVMPLSAGLFKSEKKNPVPQCPPRLHVQFLTPVLWSRVPNHFLRSEVSRVNERHGWMVQCSDPLQFMSLHIPEENRSVDILELTEQRDLLKFHYHTLRLYSAVCALGNNRVAGALCSHVDESQLLSAIQNKYMPGLLRTGYYDLLIDIHLSSYATARLMMNSEYIVPMTDETKSITLFPDEKKK---------------------HGLPGIGLSTSLRPRMRFSSPDFVSAVAGSNGGPVAGGDCFQYSPEFPLETLKSRTMEMLTEAVQEGSLHVRDPVGGSTEFLFVPLIKLFYTLLIMGIFHNGDLRTILQLIEPSVFSQSTGSEGATGTPDKEGGPGEGRSEGGPAIGGGEEEDGTKSGLPK--EGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAVVAFSDDFVASLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLGFKDEKQECP--------CPEDIRDQLLEFHE-----------------DLMTHC-------GTHF------HNYSDYACTDL--NVLNVNGVAPA---------------GTLQQLISETMVRWAQECVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINAVSVEDTINLLASLGQIRSLLSVRMGREEEKLMIRGLSDIMNNKVFYQHPNLMRALGMHETVMEVMVNVL--------------------SGG-------------------------ESKEITFPK------MVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVQYLAGCGLQSCVMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRG 2303          

HSP 2 Score: 1429.08 bits (3698), Expect = 0.000e+0
Identity = 864/2065 (41.84%), Postives = 1215/2065 (58.84%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQ-GIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA--DLSRIEMHGERRRPTIIND-------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSR-YSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYF-------VGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEP-ITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAM-EQASDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQ---EQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGE 13891
            GG GLL AM+E I         K++++      +  +   KTL  +  D ED                    D + +G AI+TFY+ L+DLLGRCAPE       K  ++R+RAIL+SL+ +EDLEGV+S+ F +P      T+ +DG     D   M  G  P+HKA++VLFL+RVYGI+D    L LLE  FL D+RAA  LD  +   +D ALALNRYL  +VLPLLTK +      E  AS++++ LHT YRLS+   LTK QR+ + + L+A+  +L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY  +G  G  G A++EE  L+ +LF GIFD LA+  YD ELF  ALPCL+A+  AL PDY                          +      ++E +  +D E          +F PQPVDTS++ +P  L+  ++++A+H H+ W++E V +                 LIS   LS  D+  Y  P+ E LK M++WGW+I+   +     +H   RR ++ +        G++P P D+  V +++++  MAE LAEN HNIWA+ KK ++++ GGG H +LVP++ LT KEKS+ R+   ++LK+LQ NGY                            ++ R+  +++   P+             RFAY  L +L+ YV++A   + +   S+R     +P  Q+   +KFFGKVVLPLV++YF  H+ YF       +G    A N+EK+M  +LFCKL  L+R +++  G+D    V CL  L Q +D R ++K   T  + V+  L  FF N A+DL   ++NL   +F+H +   +     +NY  + LLPVL S+F+H+ + N  G+ L+ D  V C   +N L+++                                             +NN   +L +      L  +  + E+   +P+L+  +EEI++LAESG +YT+ PHV+EV LPMLCSY+  WW  GPE+  E+A         T++T++ +N +LGN+LK+I NN+      WM R+A+ +QPI+  A   +L  HFLP+ EKLK  A     +EE     K  G    +E E  +  +  ILVR+++AFYPLLI++VD +R  W+K+P  + + LF +VAE+F+ W+KS +FKREEQNFV QNEI+++S ++ D     KS+ S+ A +D   KK   R  + S  TSL VA +KRLLP+GL++    +QELI  AK R                    QK+ + ++ E ++N + L+ + +D    WQ  LYK +       S ++   E  ++RVL +A VL  L  V+HP    K  W KL+S QRKRAV+ACFRM PL++LPRHR VNLFL  Y   W+  EE     +LIE++ +                       P G+EP E  EG               DPL QLI    RTA+ E+    S+Y+S   +  +SC  E++D+++E       KS +   E+EMEK ++L +Q RL DRGAAEMVL  I   +G +  +V  +++LGI++L GGN++VQ +ML +LK+KK +GFF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G     + D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD ID  G+ N  KAI + KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q++LL+E M LQK+M++MLLSMLEGNVVNG IGKQMVD LVESS NVEMILKFFD+FL++KD+TSS+AF  +D +  G IS ++F  AME  K Y   E E+++ C +++ +  +D+ EF +RFH+PAKDIGFNVAVLLTNL EHMP+D+RL+  +  A+ ++  F+PYLGRIEI G + RIERVYFEI +S   QWEKPQ+K+SKR F+  VVNEGG+KEK+E FVNFCEDTI+EMQ + ++S  GE
Sbjct: 2305 GGNGLLAAMEEAI---------KISEDPSRDGPSPTSEDSKTLDAV-EDEED--------------------DTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRAILRSLIPIEDLEGVISIPFPMP------TLAKDGSVVEPD---MSAGFCPDHKAAMVLFLDRVYGIEDQNFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTKCAPLFAGTEPFASLIDSLLHTVYRLSKGCCLTKAQRDAIEECLLAVCGKLRPSMMQHLLRRLVFDVPLLNEHTKMPLKLLTNHYERCWKYYCLSGGWGSFGAASDEELHLSRKLFWGIFDALARKRYDAELFKLALPCLSAVAGALPPDY--------------------------MESNYVAMMEKQSSMDAEG---------NFNPQPVDTSNVNIPEKLDHFINKYAEHSHEKWSMEKVMR-----------------LISVATLSVTDKEVYRWPIRETLKTMLSWGWSIERTRESDPASLHSRTRRISLSSQLSIEGAHGFSPRPVDMSNVTLSRDLHSMAELLAENYHNIWAKKKKLELEAKGGGSHPLLVPYDTLTAKEKSKDREKAQDILKFLQINGY----------------------------TVSRAMKEQELDTPSIE----------KRFAYTFLQQLITYVDEAHEHMLEFDVSTRPKGEKIPHEQQ---MKFFGKVVLPLVDQYFKNHRLYFLSTAVRPIGSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDSTSIVNCLHILGQTLDARTVMK---TGLETVKAALRAFFENAAEDLERTMENLRQGQFTHTRTQPKGVTQIINYTTVALLPVLSSLFEHIGQ-NLFGEDLIRDRVVVCSAWINQLFRI--------------------------------------------VRNNPKYLLLSLPPASGLPTQ--VEEVCPLVPSLEKALEEIMELAESGMRYTQMPHVMEVVLPMLCSYMSHWWEHGPESNPEHA-----ESCCTSLTSEHMNALLGNILKIIYNNLGIDEGAWMKRLAVFSQPIISKARPQLLKSHFLPLMEKLKKKAATVLLDEE---HTKAEGRGEMSEAELLILDEFTILVRDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIFWAKSHNFKREEQNFVVQNEINNMSFLITD----TKSKMSKGAVSDQERKKMKKRGDRYSMQTSLIVAALKRLLPVGLNICAPGDQELIALAKNRFT------------------QKDTEDEVREIIRNNLHLQGKLEDPAIRWQMALYKDMPNR----SEDTSDPEKTVERVLDIAHVLFHLDQVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAK-----------------------PGGEEPSEEDEG-----------VKRIDPLHQLIQLFSRTALTEKWCFSSVYVS---VCPQSCHDEEEDEEEE------VKSFEVGGEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGEMGLMVASTLKLGIAVLNGGNSTVQQKMLDYLKDKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGL---GMVTEEGSGEKVMQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAINVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIDLLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDAFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENELLDYEEFVERFHEPAKDIGFNVAVLLTNLSEHMPHDSRLQTFLELAESVLNYFQPYLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQMSDAGE 4107          

HSP 3 Score: 556.214 bits (1432), Expect = 1.267e-157
Identity = 286/490 (58.37%), Postives = 366/490 (74.69%), Query Frame = 2
Query: 14603 FEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEV-------EQK-----PSSDP----EKMNSTDPD-DMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQP----SEASGSRGWLRKKMIAW-----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDG-VKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            F  K I     +++ FA+N YN ++ AL +AF INF+LLFY+V       E+K      SSD     + +    PD  +    +L +S  YM    +ILA LH+  +   +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP++D++K  WD+LV++T SFP NYWDKFVK+KV +KY E Y  + I  LLGM++     S+A   R   +   +A      D++Y IWK GV+FTDN+FLYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGD+IE P GD YE YRI+FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD +PHGFE H  +EHN ANY++F+M++INK +TE+TGQE+YVW++YQ+RCW+FFP GDCFRKQYE++L
Sbjct: 4366 FWKKIIAYQRKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSAVLEEKQVIYSASSDTGLRWDPLGEAPPDRPVTVHFVLEESSGYMEPTLRILAILHTIISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGHDRISELLGMDKAALDFSDAHEKRKPKKDSSLAAVLNSVDVKYQIWKLGVVFTDNSFLYLAWYMTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGESPDMKCDDMLTCYMFHMYVGVRAGGGIGDQIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFVMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQL 4855          

HSP 4 Score: 104.375 bits (259), Expect = 4.490e-21
Identity = 58/201 (28.86%), Postives = 102/201 (50.75%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI---INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDTS I LP  LE + ++ A+++H+ W +  ++ G++YG  R+D  + HP L+ F  L + ++   ++  +E LK ++A G  +     R     +R + +    ++ GY P P DL  + +      M +KLAENAHN+WA+ +            +    +  LVP+ +L ++ K   +    E ++ L   GY
Sbjct:  844 FTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIDLGWMYGAIRDDNKRQHPCLVEFSKLPEQERSYNLQMSLETLKTLLALGCHVGVADERAVEKVKRLKLSAKYELSSGYKPTPMDLSHIKLASTQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNKRNPRLVPYVLLDERTKKSNKDSLREAVRTLLGYGY 1044          

HSP 5 Score: 81.6481 bits (200), Expect = 3.352e-14
Identity = 56/209 (26.79%), Postives = 106/209 (50.72%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSE----GSRLKTIKLPN--SFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F P+PV+T+ + +P  +++  +K AE+ HE W+M+K+ +                 L +   L   +++       ETL+T+++ G++I     S+     SR + I L +  S   ++G+ P+P+D+ N++LS  L ++   LAEN HNIWA  +  +  + G   +      P LVPY+ +    K  +R+ + + +K L    Y++
Sbjct: 2668 FNPQPVDTSNVNIPEKLDHFINKYAEHSHEKWSMEKVMR-----------------LISVATLSVTDKEVYRWPIRETLKTMLSWGWSIERTRESDPASLHSRTRRISLSSQLSIEGAHGFSPRPVDMSNVTLSRDLHSMAELLAENYHNIWAKKKKLELEAKGGGSH------PLLVPYDTLTAKEKSKDREKAQDILKFLQINGYTV 2853          

HSP 6 Score: 71.2478 bits (173), Expect = 4.186e-11
Identity = 27/91 (29.67%), Postives = 61/91 (67.03%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA 9352
            +KP P+D SHI+L ++ E+++D+ A++ H+ WA + + +G+ YG+ ++  NK +P L+ + LL +  +    + + EA++ ++ +G+ ++A
Sbjct:  958 YKPTPMDLSHIKLASTQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNKRNPRLVPYVLLDERTKKSNKDSLREAVRTLLGYGYNLEA 1048          
BLAST of Ryanodine receptor related vs. Ensembl Cavefish
Match: ryr1b (ryanodine receptor 1b (skeletal) [Source:ZFIN;Acc:ZDB-GENE-070705-417])

HSP 1 Score: 1430.23 bits (3701), Expect = 0.000e+0
Identity = 854/2078 (41.10%), Postives = 1221/2078 (58.76%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQ-QKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID---------------ADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVS--LNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASD---DSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            GG GLL AM+E I +S                 A + P  +K    +F   E                 + + + V LG AI++FYS L+DLLGRCAPE       K  +LR+RAIL+SLV +EDL GV+SL   +P      T  +DG+     +  M    +P+HKAS+VLFL+RVYGI + +  L +LE  FL DMRAA  LD  +   ++ ALALNRYL ++VLPLLTK +      +  A ++++ LHT YRLSR R+LTK QR+ + D L++L + L P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY    G    GI +EEE  L+ +LF GIF++LA   +D ELF  A+PC+ AI  A+ PDY               S+SA                  E++  V+A       + +F P+PV+T++  +P  L++ ++++A+H HD WA E ++  + YG T ++  KTHP L  +   S+ D+  Y  P+ E++KAM+AW WT++               A   +I    +       + GY+P P DL  + +++E+  MAE+LAEN HN W + KK ++ + GGG H +LVP++ LT KEK+R R+   +LLK+LQ  GY                     GL      I                     SS   RFAY  L KLL+++E A   I  ++ +  S R  ++ P  QE   IKFF K++LPLV +YF  H  YF+       G    A N+EK+M A++FCKL +L+R +++  G ++  S            I     +  +  + V+  L  FF + ADD+  +++NL +       G V   +VS  +NY  + LLPVL S+FDH+++   G D+++ D+Q++CY+++ ++Y +GT  + + ++          RP LGEC+A +A   PVA+LE  LN+ N +S+    T       R ILG      EL  ++P LD +++EI  LAESG +YTE PHVIE+TLPMLC+YLP WW RG EN       E+  +  T VT++ +N +LG+++K++ NN+    A WM R+A+  QPIV  A   ML  HF+P  EKLK  + +   EEE  + E K+  ++       +  +  +L R+++A YPLLI+YVD +R  W+  P  D + LF +V E+F+ WSKS +FKREEQNFV  NEI+++S +M D    +KS+ S+    D+   K   R  + S  TSL VA +K+LLPIGL+M    +QELI  AK R                     K+ D ++ E+L+N + L+ + +D +  WQ  LYK+  GKA+  ++ E V     +KRV  ++ VL+ + + +HP    K  W KL+S QR+RAV+ACFRM PL+++PRHRG N+FL  Y+  WL  E      ++I++++++ ++ E  E                                        PDPL QLI    RTA+ + +    D LY+SYA IM+K                       E+EMEK ++L +Q+RL DRGAAEMVL  I   +G   A+V  +++LGIS+L GGN+ VQ RML +LK+KK +GFF+S+  LMQ CSVLDL+ FER NKAEGL   G+   +G     + D EFTC LFRFLQLLCEGHN  FQ+YLR+Q G+TTT+NIIICTVDYLLRLQESI DFYW+Y+GKD ID  GK N  KA+ + KQIF +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LEGN+VNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF+ +  +  G IS K+F  AM+ QK Y+P EI++++ C +++ +  ++F EF +RF +PAKDIGFN+AVLLTNL EH+P+D RL+  + +A+ ++  F P+LGRIEI G S RIER+YFEI +++ +QWE PQ+++SKR F+  VVNEG + EK+E FVNFCEDTI+EM  + +IS
Sbjct: 2329 GGAGLLAAMEEAIKISED--------------PARDGPTVKKDRRFMFGGEE-----------------QHEENRVHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPVQIP------TFGKDGQ---LVEPKMSASFVPDHKASMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAAASLDTLAFSTTEMALALNRYLCSAVLPLLTKCAPLFAGTDHRAIMIDSMLHTIYRLSRGRALTKAQRDVIEDCLMSLVKYLHPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWANFGITSEEELHLSRKLFWGIFESLAHKKFDAELFKIAMPCICAIAGAIPPDYV------------DASYSAT-----------------EKKATVDA-------EGNFDPRPVETTNTIIPEKLDAFINKYAEHTHDKWAFEKIQNNWTYGETMDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWTLEKARDEGEKAEKAAAAATTRKISQTAQATYDP--SQGYSPQPIDLTTMALSRELQSMAEQLAENYHNTWGRKKKMELQAKGGGTHPLLVPYDTLTAKEKARDREKAQDLLKFLQAEGY-----------------AVTRGLKDMEQEI---------------------SSIEKRFAYGFLQKLLKWMEIAQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLVNQYFKNHCLYFLSTPAKVLGSGGHASNKEKEMIASIFCKLAALVRHRVSLFGKNLFCSY----------SITLCRTVMKSGPEIVKAGLRSFFESAADDIEKMVENLKL-------GKVSTKSVSQNINYTTIALLPVLTSLFDHIAQHQFGDDVILDDLQISCYRLMCSIYSVGTVKTPHAEK---------MRPALGECLAHLAAAMPVAYLEPSLNEFNGFSVYTTKTPR----ERAILGLPDQVQELCLDIPELDVLMKEIGHLAESGARYTEMPHVIEITLPMLCNYLPRWWERGVENF-----PEQEGQLCTDVTSEQLNQLLGSIMKIVVNNLGIDEASWMKRLAVFAQPIVSRAKPEMLKSHFIPTMEKLKKRSGKVVAEEEQLRMEGKTEVDSEGGT---IRDEFAVLCRDLYALYPLLIRYVDNNRARWLTCPDPDAEDLFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLMGD----SKSKMSKGGGADAERTKKKRRGDRYSVQTSLIVAALKKLLPIGLNMCSPADQELINLAKIR------------------YSLKDTDEEVREFLQNNLHLQGKVEDPSMRWQMALYKETSGKAEDAENPEKV-----VKRVQEVSAVLYHIEVTEHPFKSKKMVWHKLLSKQRRRAVVACFRMTPLYNIPRHRGSNMFLNGYKRNWLENEGYSFEDKMIDDLSKTLEEEEEEEEEK----------------------------------EAKPDPLHQLILHFSRTALTEKTKLDVDHLYMSYADIMAK-----------------------EKEMEKQRLLYQQSRLHDRGAAEMVLQMISACKGEPGAMVSSTLKLGISILNGGNSDVQQRMLDYLKDKKDVGFFLSLQALMQTCSVLDLNAFERQNKAEGL---GMVSEEGTNEKVMADDEFTCDLFRFLQLLCEGHNNDFQNYLRTQTGSTTTINIIICTVDYLLRLQESISDFYWYYSGKDIIDEPGKRNFSKAMTVAKQIFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNIVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFMDYVTDPRGLISKKDFSKAMDSQKQYSPSEIQFLLSCSEADENEMINFEEFANRFQEPAKDIGFNIAVLLTNLSEHVPHDTRLQNFLEQAESVLNYFRPFLGRIEIMGASKRIERIYFEISEANRNQWEMPQVRESKRQFIFDVVNEGCESEKMEMFVNFCEDTIFEMNIASQIS 4161          

HSP 2 Score: 1110.52 bits (2871), Expect = 0.000e+0
Identity = 587/1291 (45.47%), Postives = 841/1291 (65.14%), Query Frame = 2
Query:  200 RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTV-PHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQ--KSEMEFLRLGLPIKCKDHF 4033
            + CLS  GFG+R CFLEN S  +N PPDL++C F+L+Q+LSVRALQE++A   D +       H+TLLYGHA+LL+H  S+M+LSCL+TS S  DKLA DVGLQE++  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +G+ +   V ASF QTLW + PV SG   + + G + GG VLRLFHG  DECL + P   GE     +   YE GAV S ARSLWRLE ++  WSGG + WG   R+RH+++GRY+ +      +  +   +A    +AF  R SK+ K    ++ + + MG  +IK+GE+  F+QHVS+  WL+Y A    K       +++ ++  EGHMDD   +++ Q EES++A  I     +F +FI+ LD    + +      + L  VI  L+DLI +F  P  + EHE KQ KL +LRNRQ+LFQEEG+I ++L  +D+    +     F +  GE+  E + ++ N LY LLA++IRGNR+NCA F     +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VL SLC+   G AVR NQ LI +NLLP RDLLLQT +V+  +SVRPN+F+G  E S  Y+KWYYE+ +D +E  VT   + LRVGW+  EG+ P+PGG +GWG   VGDDL+S+GFDG +LW+G  P+++ +  Q  IL   D++ C LDL+VP I F IN  PV+G F +FN+DG+F+P +S SA V  R + GG HG  ++ PP GY+  +EALLPKER+R+EP   + +    +  + G  E+  +  F P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGW YG  RDD  K HPCL  F+ LP  ER +++ ++ ETL+T++ALG  +          LK IKLP +++ ++GY+P PLDL ++ L+ +   LV +LAEN HN+WA DR++QGW+Y  V++   KR+P LVPY  +D+  KK+NR +    V+TL+ Y Y+IE P  +      S++F       SSA+R FRA+  + VTSGKWY+E E +T G MR GW   +  +G E+G++  +Y F+   A +W++ + P+G+  Q GDV+GCM+DL +  I F+LNGE+++   G E+AFK++    G++P  + G  Q  ++N G +V +L+YF  CGLQEG+ PF +NM R + +W+S+  P  FV +  +++ +EV    G+V   P LK+  K FG Q   ++M F RL +PI+  + F
Sbjct:   17 KLCLSCEGFGNRLCFLENTSNAQNVPPDLAICAFVLEQSLSVRALQEMLANTVDLSESSQGGAHRTLLYGHAILLRHNHSSMYLSCLTTSRSLTDKLAIDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSMASGDLM---VDASFMQTLWNMNPVCSGC--ELAEGFLTGGHVLRLFHGHMDECLAISPPDQGED----QIAQYESGAVCSQARSLWRLEPLRISWSGGHMKWGQAFRIRHISTGRYVCLDEEKG-LMVLDPEKANTKLSAFCFRASKE-KVEVAKKRDVEGMGIPEIKYGESMCFVQHVSTGLWLTYAA-LDAKAARLGTMKRRVILHQEGHMDDALLLSRSQTEESQAARMIYSTTGLFNQFIKGLDSLSGKNRAPGPVTLPLDAVILSLQDLIHYFRPPEEELEHEEKQTKLRSLRNRQNLFQEEGMITIVLECVDRLN-VYNTAAHFSEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFC--DNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLRSLCVC-NGVAVRSNQNLITENLLPGRDLLLQTSIVNYVTSVRPNIFLGTCEGSTQYKKWYYEMIVDYVEPFVTLQASHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGHVPRQVASPSQH-ILAADDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGLFFPVISFSAGVKARFLLGGRHGEFKFLPPPGYAPCYEALLPKERMRIEPIKEYKHDFDGVRNFLGPVESLTHTSFTPCPVDTAQIVLPPHLERIREKLAENIHELWAVTRIEQGWIYGVFRDDNKKLHPCLVDFQSLPEPERNYNLQMSGETLKTLLALGCHVGMGDEKAEENLKKIKLPKTYVMTSGYKPAPLDLSHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQDIMNKRNPRLVPYNLLDERTKKTNRDSVNNAVRTLIGYGYNIEPPDQE------SSAF-------SSAVRIFRAEKQYAVTSGKWYFEFEAVTTGEMRVGWARPNVRAGTELGADELAYVFNGNRAQRWHIGNEPFGRQWQSGDVVGCMIDLVEMNIMFTLNGEMLISDSGSEMAFKDIEIGDGFIPVCALGLSQVGRINLGQNVSSLRYFAICGLQEGFEPFAINMKRDITMWFSKSLP-QFVPVPPDHNHIEVSCVDGTVDSAPCLKVTHKTFGSQNANTDMLFFRLSMPIEFYETF 1276          

HSP 3 Score: 531.176 bits (1367), Expect = 4.763e-150
Identity = 273/511 (53.42%), Postives = 352/511 (68.88%), Query Frame = 2
Query: 14597 NPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEEF--------------------------------IILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMN-------------QPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFY-IKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            N  E+++I    Y+    ++N YN +  AL +AF +NF+LLFY+V   P  + E   S   +    F                                  L ++  YM       +  H+  +   +I Y CLKVPLV+FKREKE++R LEF+G+++TEQP DD++K  WD+LVL+TP+FP NYWDKFVK+KV  KY + Y    I  LLGM+             +P   +    WL     + DI+Y IWK+GV+FTDN FLYL  Y V SL+G++N FFFACHLLD+A+  KTLRTIL SVTHNGKQL++TV L +V++YLYTV+AFNFFRKFY + +++   DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQV+EDME+KCFICGIG +YFD  PHGFE H  +EHN ANYM+FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4454 NELEVQRIKFMNYL----SRNFYNLRFLALFVAFALNFILLFYKVSSSPPGEEEFEGSGAFEGSGLFEGSGLFEGSGGEAEGSGMEENGDEDDEEGPVYYFLEENTGYMEPALAFFSIFHTIISFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYVTEQPEDDDIKGQWDRLVLNTPTFPNNYWDKFVKRKVLEKYGDIYGRERIAELLGMDLAALDVSQMTHEKKPEPDTSMFTWL----TSIDIKYQIWKFGVVFTDNTFLYLVWYLVMSLLGHYNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNMSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 4956          

HSP 4 Score: 365.925 bits (938), Expect = 4.230e-100
Identity = 220/549 (40.07%), Postives = 303/549 (55.19%), Query Frame = 2
Query: 6053 QLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISC-CAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTT 7693
            ++C LL   CD +LRHR+E I+  S+ FV NIQ +Q  RY E+ ++  + ++ TA+ T+EFR PP++Q+  + NF      C    DD  C   EE++ ++  FH                 NE+LN C        +H+         E     + L+ +  +   R  E  +      +   +  L ++I  T+I WA+ +FI+N +L+R MFSLL RQY++LGE+  +L K Y I+  S  D   +L  LG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+ L     G  D++                                                   +MV  CCRFLCYFCR S QNQ++MF+HLSY+L+NS + L    +RG+ PLDVA +S +DNNELALA++E+ LE V  YL+  G+Q    LLSKGYPDIGW+P  GER+LDFLRF V+VNGE +EENAN+VVRLLIRRPEC GPALRG   A   A     A E  +  S   A +G T
Sbjct: 1896 KMCTLLQYFCDCELRHRVEAIIAFSDTFVKNIQTNQRERYNELMRAFTMSAAETARRTREFRSPPQEQVILLTNFK----NC---LDDEECPVPEEVRDQLQQFH-----------------NEILNHC-------GVHVEEEEEEEEVETSLTGRLLKLVEKVKAIRKKEVEEEPEPEEEPKPS-TLQELISHTMIHWAQESFIQNPELVRMMFSLLHRQYDSLGELIRALPKAYAITAISVQDTMDMLECLGQIRSLLIVQMGPEEERLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLG----GGGDSKIRF-----------------------------------------------PQMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSGIGLG---MRGSTPLDVAAASCIDNNELALALQEQDLEMVVTYLAGCGLQMCPMLLSKGYPDIGWNPSGGERYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRGEGGAGLLA-----AMEEAIKISEDPARDGPT 2353          

HSP 5 Score: 247.284 bits (630), Expect = 3.187e-64
Identity = 159/493 (32.25%), Postives = 251/493 (50.91%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEK--SYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKL-DMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF 5974
            YY+SV +  GQ+   +++GWV+  +            + +FD                       + V  VT+   ++  ++  S+  S  Y++   D+++  G+Q    +   + + +GC +D ATG + F  N +E+   +QV P T L+PA+FV+P ++    FELG+ +N +P+ A M R  R+   P    RL  +ML    WSR+ N   K  + K++E  GW +   E + MMA+H+PEE+RC+DILEL E    L+FH  TL LY  +C  GN+ VA +L +H+DE+Q FY I+N YL G LR+ ++DLLI++HLES  R +L T  E ++P+         TE+  S   Y + ++               H +P    +  + P L    +        G D  P L  + P    + LK  +L  L  AV  G+Q + +P+GGS E  FVP+LK++  LLIMG+    D+  IL ++D   F
Sbjct: 1393 YYYSVRIFAGQEPAGVWVGWVSPDYH---------QYDLNFDL----------------------FKVRTVTVTVGDDRGNIHDSIKRSNCYMVWGGDLIS--GSQQRFSQ---EDLVVGCLVDLATGLMNFTANGKEINTFYQVEPNTKLFPAVFVQPFSQNMLQFELGKLKNIMPLSAAMFRSERKNPVPQCPPRLNAEMLTPVIWSRMPNHFLKPEVGKVSERHGWMVECTEPLTMMALHVPEENRCIDILELSERQDWLKFHYHTLMLYCAVCALGNNRVAHALCSHVDESQLFYAIENTYLPGHLRSGYYDLLISIHLESAKRNRLGTNREFIIPM---------TEETLSITLYPDTERA--------------HDLPGVGLTTCLRPKLHFSPINFV-----GTD--PDLYTISPIFPLQELKTKALSMLTEAVMDGSQAMRDPVGGSVEFHFVPILKLISTLLIMGIFNDEDVKHILKMIDPNVF 1819          

HSP 6 Score: 112.079 bits (279), Expect = 1.842e-23
Identity = 65/211 (30.81%), Postives = 111/211 (52.61%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDT+ I LP  LE + ++ A+++H+ WA+  +E+G++YG+ R+D  K HP L+ F  L + ++   ++   E LK ++A G  +       + +L +I++     +  ++  GY P P DL  V +T     + EKLAEN HN+WA+ +       + +  I    +  LVP+ +L ++ K   R   N  ++ L   GY
Sbjct:  825 SLTHTSFTPCPVDTAQIVLPPHLERIREKLAENIHELWAVTRIEQGWIYGVFRDDNKKLHPCLVDFQSLPEPERNYNLQMSGETLKTLLALGCHVGMGDEKAEENLKKIKL----PKTYVMTSGYKPAPLDLSHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQDIMNKRNPRLVPYNLLDERTKKTNRDSVNNAVRTLIGYGY 1031          

HSP 7 Score: 107.457 bits (267), Expect = 5.326e-22
Identity = 62/214 (28.97%), Postives = 107/214 (50.00%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEG-----------SRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            F PRPVET    +P  ++   +K AE+ H+ WA +KI   WTYG+  D+  KTHP L  ++     +++       E+++ ++A  +T+  +   EG           +R  +     ++  S GY PQP+DL  ++LS  L+++  QLAEN HN W   +  +      ++       P LVPY+ +    K  +R+ + + +K L A  Y++
Sbjct: 2691 FDPRPVETTNTIIPEKLDAFINKYAEHTHDKWAFEKIQNNWTYGETMDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWTLE-KARDEGEKAEKAAAAATTRKISQTAQATYDPSQGYSPQPIDLTTMALSRELQSMAEQLAENYHNTWGRKKKME------LQAKGGGTHPLLVPYDTLTAKEKARDREKAQDLLKFLQAEGYAV 2897          

HSP 8 Score: 65.4698 bits (158), Expect = 2.406e-9
Identity = 26/90 (28.89%), Postives = 57/90 (63.33%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            +KP P+D SH++L  +   L+++ A++ H+ WA + V +G+ Y + ++ +NK +P L+ ++LL +  +    + V  A++ +I +G+ I+
Sbjct:  945 YKPAPLDLSHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQDIMNKRNPRLVPYNLLDERTKKTNRDSVNNAVRTLIGYGYNIE 1034          
BLAST of Ryanodine receptor related vs. Ensembl Cavefish
Match: ryr1a (ryanodine receptor 1a (skeletal) [Source:ZFIN;Acc:ZDB-GENE-020108-2])

HSP 1 Score: 1361.67 bits (3523), Expect = 0.000e+0
Identity = 806/1993 (40.44%), Postives = 1169/1993 (58.66%), Query Frame = 2
Query: 8003 VDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIIND----------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
            V LG AI++FY+ L+DLLGRCAPE       K  +LR+RAIL+SLV +EDL GV+SL   +PA   + ++ E           M    +P+HKA +VLFL+RVY I + +  L +LE  FL DMRAA  LD  +   ++ ALALNRYL ++VLPL+TK +      +  A ++++ LHT YRLSR RSLTK QR+ + + L++L + L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY    G    G+++EEE  LT +LF GIF++LA   YD ELF  A+PC+ AI  A+ PDY               S+S+++                E++  V+A       + +F P+PV+T++  +P  L+  ++++A++ HD WA E ++  + +G   ++  KTHP L  +   S+ D+  Y  P+ E++KAMIAW WT+D      E   E++    I+           GYNP P ++ G+ +++E+  MAE+LAEN HN W + KK ++ + GGG H +LVP++ LT KEK+R R+   ELL++LQ NGY                   R   D   D                       SS   RFAY  L KLL++++ A   I  ++ +  S R  ++ P  QE   IKFF K++LPLV +YF  H  YF+       G    A N+EK+M A L   +FS           D    V CL  L +++D R ++K   +  + V+  L  FF + ADD+  +++NL + + S     V+  + ++NY  + LLPVL S+FDHV++   G D+++ D+Q++CY+I+ ++Y LGT  + + +R+         RP LGEC+A +A   PVA+LE  LN+ N +S+    T       R ILG      EL  ++P LD +++EI  LAESG +YTE PHVIE+TLPMLC+YLP WW RG EN  +   E ++    T VT+  +N +LG+++K++ NN+    APWM R+A+ +QPIV  A   ML  HF+P  EKL+    +   EEE  + E KS  +        +  +  +L R+++A YPLLI+YVD +R  W+  P  D + LF +V E+F+ WSKS +FKREEQNFV  NEI+++S +  D    +KS+ S++  +D            +   TSL VA +K++LPIGL+M    +QELI  AK R                     K+ D ++ E+L+N + L+ + ++ +  WQ  LYK++ GKA+  D+ E V     +KRV  ++ VL+ + + +HP    K  W KL+S QR+RAV+ACFRM PL++LPRHR  N+FL  Y+  WL  E      R+I++++++ +  E  E                                      T PDPL QLI    RTA+ + S       + G   +    ED     E    E  +S  E+EMEK ++L +Q+RL +RGAAEMVL  I   +G   ++V  +++LGIS+L GGN+ VQ +ML +LK+KK +GFF+S+  LMQ CSVLDL+ FER NKAEGL   G+   +G +   + D EFTC LFRFLQLLCEGHN     Y                   +   + ESI DFYW+Y+GK+ ID  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LEGNVVNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF  +  +  G IS K+F+ AM+ QK Y P EI++++ C +++ +  +++ EF +RF +PAKDIGFN+AVLLTNL EH+P+D RL+  + +A+ ++  F P+LGRIEI G S +IER+YFEI + +  QWE PQ+++SKR F+  VVNEGG+ EK+E FVNFCEDTI+EM  + +IS
Sbjct: 2385 VHLGNAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPVQIPAFGKDNSIIE---------PKMSASFVPDHKAPMVLFLDRVYSIDNQDFLLHVLEVGFLPDMRAAASLDTAAFSTTEMALALNRYLCSAVLPLITKCAPLFAGTDHRAIMIDSMLHTIYRLSRGRSLTKAQRDVIEECLMSLCRYLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWANFGVSSEEELHLTRKLFWGIFESLAHKKYDAELFKIAMPCICAIAGAIPPDYVDA------------SYSSKT----------------EKKASVDA-------EGNFDPKPVETTNTIIPEKLDGFINRYAEYTHDKWAFERIQNNWTFGEMLDENAKTHPMLRPYKTFSEKDKEIYRWPIKESVKAMIAWEWTLDKARDGDEDKTEKKAARKISQTAQATYDPSHGYNPQPINISGMTLSRELQSMAEQLAENYHNTWGRKKKMELQAKGGGTHPLLVPYDTLTAKEKARDREKAYELLRFLQLNGY----------------AVTRGLKDMEGD----------------------VSSIEKRFAYGFLQKLLKWMDIAQEFIAHLEAVVSSGRVEKS-PHEQE---IKFFAKILLPLVNQYFKNHCLYFLSTPAKILGSGGHASNKEKEMIARL---IFST----------DAPAIVNCLHILARSLDARTVMK---SGPEIVKAGLRSFFESAADDIEKMVENLKLGKVSKGNQPVKGVSQNINYTTVALLPVLTSLFDHVAQHQFGDDVILDDLQMSCYRIMCSIYSLGTVKTPHAERQ---------RPALGECLAHLAAAMPVAYLEPQLNEYNAFSVYTTKTPR----ERAILGLPNEVQELCLDIPELDILMKEIGHLAESGARYTEMPHVIEITLPMLCNYLPRWWERGLENFPQ--LEGQL---CTDVTSDHLNQLLGSIMKIVVNNLGIDEAPWMKRLAVFSQPIVSRAKPEMLKSHFIPTMEKLRKRTAKVVAEEEHLRMEGKSEGDEEEGT---IRDEFAVLCRDLYALYPLLIRYVDNNRARWLTCPDPDAEELFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTAD----SKSKMSKAGGSD------------VELQTSLIVAALKKMLPIGLNMCSPADQELINLAKIRYS------------------LKDTDEEVREFLQNNLHLQGKVENPSMRWQMALYKEMAGKAEDADAPEKV-----VKRVQEVSAVLYHIEVTEHPFKSKKMVWHKLLSKQRRRAVVACFRMTPLYNLPRHRASNMFLDGYKRNWLQTEGYSFEDRMIDDLSKAMEQEEEEEEET----------------------------------ETKPDPLHQLILHFSRTALTEKS------CHMGEEDEC-EEEDQGGGAEEMSFEVRQSETEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGSMVSSTLKLGISILNGGNSEVQQKMLEYLKDKKDVGFFLSVQALMQTCSVLDLNAFERQNKAEGL---GMVSEEGTSEKVMADDEFTCDLFRFLQLLCEGHNNGQSLY------------------QWFFSV-ESISDFYWYYSGKEIIDEPGKRNFSKAMTVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYTPSEIQFLLSCSEADENEMINYEEFANRFQEPAKDIGFNIAVLLTNLSEHVPHDTRLQNFLEQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEVNRRQWEMPQVRESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMNIASQIS 4152          

HSP 2 Score: 1031.17 bits (2665), Expect = 0.000e+0
Identity = 568/1297 (43.79%), Postives = 812/1297 (62.61%), Query Frame = 2
Query:  200 RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSK-MNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQ--KSEMEFLRLGLPIKCKDHFTTKSLQ 4051
            + CLS  GFG+R CFLE  S  +N PPDL++C FIL+Q+LSVRALQE+++   +++  GG   H+TLLYGHA+LL+HT S+M+LSCL+TS S  DKLAFDVGLQE++  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +G+ +   V ASF QTLW + PV SG   + + G + GG VLRLFHG  DECL +P ++ + + Q  +  YE GAV SHARSLWRLE ++  WSG  I WG   R+RH+T+GRYLS+      +  V   +A   S+AF  R SK +K    ++ + + MG+ +IK+GE+  F+QHV+++ WL+Y A    K       +++A++  EGHMDD  TVA+ Q  ES++A  I   A +FT+FI+ LD    + +     + + L  V+  L+DLI +F  P  + EHE KQ+KL +LRNRQ+LFQEE   N                     A  ED+ E           +  ++IRGNRANCA F     +DW+  +L+  +++ G+L+VL+C+L +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP RDLLLQT +++  +S+RPN+F+G  E S  Y+KWYYE+ +D +E+ +T     LRVGW+  EG+ P+PGG +GWGS  VGDDL+S+ FDG +LW+G  P+++ +  Q  +     ++                +E +KG              V       VR + GG HG  ++ PP GY+  FEA+LPK+RLR+EP   + +    +    G +++  +  F P PV+T +I LP ++E IR+KLAEN HE+WA+ +I+QGWTYG  RDD  K HPCL  F+ LP  E+ +++ ++ ETL+T++ALG  +          LK  KLP +++QSNGY+P PLDL ++ L+ +  TLV +LAEN HN+WA DR++QGW+Y  V++   KR+P LVPY  +D+  KK+NR T    V+TL+ Y Y+IE P  + S   V +          + IR FRA+ ++ VT GKWY+E E +T G MR GW      +  E+GS+  +Y F+   A +W++ S P+G+  Q GDV+GCM+DL +Q I F+LNGE+++   G E+AFK++    G++P  S G  Q  ++N G +V +L+YFT CGLQEG+ PF +NM R + +W+S+  P  FV +  ++   EV    G+V   P LKL  K FG Q   +++ F RL +PI+  + F   + Q
Sbjct:   31 KLCLSCEGFGNRLCFLETTSNAQNVPPDLAICCFILEQSLSVRALQEMLSHTSESSQGGG---HRTLLYGHAILLRHTHSSMYLSCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYASGDLM---VDASFMQTLWNMNPVCSGC--ELAEGYLTGGYVLRLFHGHMDECLAIPAAD-QGADQRRNAHYEGGAVCSHARSLWRLEPLRIGWSGSHIKWGQAFRIRHITTGRYLSLDDEKG-LLLVDPEKANTKSSAFCFRASK-EKTEVTQKRDVEGMGTPEIKYGESMCFVQHVATSLWLTY-ASVDAKSARLGPLKRKAILHQEGHMDDALTVARSQTMESQAARMIYSTAGLFTQFIKSLDSLSGKNKTPGPPQPLPLDAVVLSLQDLIFYFRPPEEELEHEEKQSKLRSLRNRQNLFQEEVRHN--------------------TACAEDRPE-----------MSTSLIRGNRANCALFC--DNLDWLVSKLDRLEASSGILEVLYCILIESPEVLNIIQENHIKSIIALLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQNLITENLLPGRDLLLQTSIINYVTSMRPNIFLGTCEGSTQYKKWYYELIVDHVESFLTPQAGHLRVGWALTEGYSPYPGGGEGWGSNGVGDDLYSYSFDGLHLWSGRVPRQVASPSQHTLATSNLLM----------------SECIKG-------------AVCFVLLCRVRFLLGGRHGDFKFVPPPGYAPCFEAVLPKDRLRIEPIKEYKHDLNGVRNLLGPTQSLSHTAFTPNPVDTVQIVLPPHLERIREKLAENSHELWAVTRIEQGWTYGPFRDDNKKLHPCLVDFQGLPDPEKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKRTKLPKTYMQSNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIVQDIVNKRNPRLVPYNLLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGHGVGDG-------SGNKIRVFRAERSYAVTQGKWYFEFEAVTVGEMRVGWARPSVHADKELGSDDLAYVFNGFKAQRWHVGSEPFGRQWQSGDVVGCMIDLTEQNIMFTLNGEMLISDSGSEMAFKDIEIGEGFIPVCSLGLSQVGRINLGQNVSSLRYFTICGLQEGFEPFAINMKRDITMWFSKSLP-QFVPVPTDHPHFEVSRVDGTVDSAPCLKLTHKTFGSQNANTDLLFFRLSMPIEFHETFKVPAGQ 1244          

HSP 3 Score: 546.199 bits (1406), Expect = 1.258e-154
Identity = 275/489 (56.24%), Postives = 351/489 (71.78%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKP--------------------------SSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRK------KMIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
             ++  ++N YN +  AL +AF +NF+LLFY V   P                          S+  + M   D ++   +  L +S  YM      LA LH+  +   +I Y CLK+PLV+FKREKE++R LEF+G++ITEQP DD++K  WD+LVL+TPS+P NYWDKFVK+KV +KY + Y    I  LLGM+  S     +   +K       M+AW    D++Y +WK+GV+FTDN FLYL  Y V SL+G++N FFFACHLLD+A+  KTLRTIL SVTHNGKQL++TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4448 FMNYLSRNFYNLRFLALFIAFALNFILLFYRVSDTPPGEEFEGSAMFEGSGIFESSGEEIEGSAAEDSMGDDDDEEGPVYYFLEESTGYMQPTLSFLAVLHTVISFICIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNTPSYPNNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLDVSKQQTDKKPEEQDNSMLAWLTAVDLKYQVWKFGVVFTDNTFLYLVWYTVMSLLGHYNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDENEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 4936          

HSP 4 Score: 400.593 bits (1028), Expect = 1.556e-110
Identity = 231/535 (43.18%), Postives = 319/535 (59.63%), Query Frame = 2
Query: 6005 VTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENK--NLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            V   +L M L ESVKLQ+C LL   CD +LRHR+E IV  S+ FV+ +Q +Q +RY E+ Q+  + ++ TA+ T+EFR PP++Q+  ++NF      C EE+D      EE++  + +FH  L+ +CG+     ++  E   Q   + R R + LL                 + + NL  RR  +E+    E    DE K   L ++I  T+I WA+ +FI+N +L+R MFSLL RQY+ALGE+  ++ K Y I+  S  D  +LL  L ++R LL VQ+G  EE L+   + +IM+NKVF+QHPNL R L +HETVM++MV+ L     G  D++   ++ F                                             MV  CCRFLCYFCR S QNQ++MF+HLSY+L+NS + L    +RG+ PLDVA +S +DNNELALA++E+ LEKV  YL+  G+QS   LLSKGYPDIGW+P  GE++LDFLRF V+VNGE +EENAN+VVRLLIRRPEC GPALRG
Sbjct: 1891 VGEGLLHMKLPESVKLQMCTLLQYFCDCELRHRVEAIVAFSDRFVNQVQTNQRQRYNELMQAFTMSAAETARKTREFRSPPQEQVNMLMNFK----NCPEEED--CPVPEEVRSGLQLFHNDLLAHCGVH----IEEEEEEEQVDTSLRGRLVRLL-----------------EKVKNL--RRRKQEA----EPEPEDEKKPSTLQELISHTMIHWAQESFIQNPELVRIMFSLLHRQYDALGELIRAVPKAYTINAVSVQDTMELLECLSQIRSLLIVQMGPEEERLMIQSIGNIMSNKVFYQHPNLMRALGMHETVMEVMVNVL-----GGGDSK---EIRF-------------------------------------------PRMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSGIGLG---MRGSTPLDVAAASCIDNNELALALQEQDLEKVVKYLAGCGLQSCPMLLSKGYPDIGWNPCGGEKYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRG 2338          

HSP 5 Score: 246.514 bits (628), Expect = 5.046e-64
Identity = 156/490 (31.84%), Postives = 246/490 (50.20%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF 5974
            YY+SV V  GQ+   +++GWVT              D   +D      K                  V +VT+   ++  ++  S+  S  Y++   +      +     +   +   IGC +D  TG +TF  N +E+   +QV P T L+PA+F  P+++     ELG+ +N +P+ A M R  R+   P    RL +QML    WSR+ N        +++E  GW +   E + MMA+HIPEE+RC+DILEL E   L++FH  TL+LY ++C  GN+ V+ +L +H+DE+Q FY I+N YL G +R+ ++DLLI+MHLES  R +L T  E +VP+    +S  +       Y + +K               H +P    +  + P L         +G N  D++    + P I  + LK+ +L  L  AV  G Q + +P+GGS E  FVP+LK++  LLIMG+    D+  IL +++ + F
Sbjct: 1357 YYYSVRVFAGQEPSGVWVGWVTP-------------DYHQYDLHFDLSK------------------VRNVTVTVGDDKGNIHESMKRSNCYMVWGGEF-----SSSQQTRISQEDFVIGCLVDLDTGLMTFAANGKEVNTFYQVEPNTKLFPAVFCLPSSQNMLQVELGKLKNIMPISAAMFRSDRKNPVPQCPPRLDMQMLTPVIWSRMPNDFLAPDTGRVSEKLGWMVQCTEPLTMMALHIPEENRCIDILELSERMDLMKFHYHTLKLYGSVCALGNNRVSHALCSHVDESQLFYAIENTYLPGPIRSGYYDLLISMHLESAKRNRLMTNREFIVPMTDETRSITL-------YSDAEKA--------------HALPGVGLTTCLRPKL--HFAPTGFVGTNA-DLY---TLSPVIPLQMLKDHALSMLTEAVQDGGQAMRDPVGGSVEFHFVPILKLISTLLIMGVFEDEDVKHILKLIEPSVF 1783          

HSP 6 Score: 101.679 bits (252), Expect = 2.565e-20
Identity = 67/274 (24.45%), Postives = 132/274 (48.18%), Query Frame = 2
Query: 2633 YAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINY-------EMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI----ETPPTDVSEMAVSNSFNILKR--KGSSAIRTFRAQSTWKVTSGK 3403
            Y+  +E K +V     F P+PVET    +P  ++   ++ AE  H+ WA ++I   WT+G+  D+  KTHP L  ++     +++       E+++ ++A  +T++        +   + +R  +     ++  S+GY PQP+++  ++LS  L+++  QLAEN HN W   +  +      ++       P LVPY+ +    K  +R+ + E ++ L    Y++    +    DVS +    ++  L++  K     + F A     V+SG+
Sbjct: 2688 YSSKTEKKASVDAEGNFDPKPVETTNTIIPEKLDGFINRYAEYTHDKWAFERIQNNWTFGEMLDENAKTHPMLRPYKTFSEKDKEIYRWPIKESVKAMIAWEWTLDKARDGDEDKTEKKAARKISQTAQATYDPSHGYNPQPINISGMTLSRELQSMAEQLAENYHNTWGRKKKME------LQAKGGGTHPLLVPYDTLTAKEKARDREKAYELLRFLQLNGYAVTRGLKDMEGDVSSIEKRFAYGFLQKLLKWMDIAQEFIAHLEAVVSSGR 2955          

HSP 7 Score: 101.679 bits (252), Expect = 2.586e-20
Identity = 62/201 (30.85%), Postives = 101/201 (50.25%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERR---RPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDT  I LP  LE + ++ A++ H+ WA+  +E+G+ YG  R+D  K HP L+ F  L   ++   +    E LK ++A G  +     + E + +R    +  + ++GY P P DL  V +T     + E+LAEN HN+WA+ +       + +  I    +  LVP+ +L +K K   R      ++ L   GY
Sbjct:  787 FTPNPVDTVQIVLPPHLERIREKLAENSHELWAVTRIEQGWTYGPFRDDNKKLHPCLVDFQGLPDPEKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKRTKLPKTYMQSNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIVQDIVNKRNPRLVPYNLLDEKTKKTNRDTVCAAVRTLIGYGY 987          

HSP 8 Score: 67.0106 bits (162), Expect = 7.972e-10
Identity = 32/125 (25.60%), Postives = 68/125 (54.40%), Query Frame = 2
Query: 9005 GPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHG 9379
            G G  + EE L       +    + +KP P+D +H++L  +  +L+++ A++ H+ WA + V +G+ Y + ++ +NK +P L+ ++LL +  +    + V  A++ +I +G+ I+        HG
Sbjct:  876 GMGDEKAEENLKRTKLPKTYMQSNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIVQDIVNKRNPRLVPYNLLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGHG 1000          
BLAST of Ryanodine receptor related vs. Ensembl Cavefish
Match: ryr2b (ryanodine receptor 2b (cardiac) [Source:ZFIN;Acc:ZDB-GENE-061226-3])

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 737/1996 (36.92%), Postives = 1093/1996 (54.76%), Query Frame = 2
Query: 8003 VDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGE-WERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPG-QGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAH-NIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAI-----VTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFN-------EEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESG--GKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIE-DANLISRDTAHWMEVVIQKENDGDIEEYLKNAI-------DLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWL-SREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAM---EQASDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEG 13894
            + +G AI+TFYS L+DLLGRCAPE    +  K  ++R+RAIL+SL+ ++DLEGV+S+ F LP       V+ DG     D + +     P+HK+++VLFL+RVYG+QD    L LL+N FL D++AA  +D    G +D ALALNRY+  +VLP L+K+S  L +      + ++  L   Y LS+   LTK QR+ + D L+ +  +L+P ++  LL+ L++DVP LT  + +PL+LLT  Y+    YY   G  G  G A+EEE QL+ +LF  +F  L+K  +  +LF   L CL+A+  A+ PD++                           P   G +E    LD E           F PQP+DTS++ +P +L+ +++++A+H H+ W+LE    G+ +G  + + +K HP L  +  LS+ D+  Y   + E +K+M+  GWTI+                           + RG++      ++A +++++    ++  G       +GGG H +LVP+E+L+ +EKSR R+   ++LK+   NGY                                + W+ Q    T       + +  +RFAY LL + L   +QA      + V Q R     +  +P  Q+   I FF KV+LPL+++YF  H  YF+     + +       +E +M  +LFCKL +L R++++  G D            QA  + A+++    S   V+  L  FF +   DL L ++++    +   +      A  L Y+   L+PVL ++F H    ++   L+VG+V+  CY+IL +LY LGT +  + +R+         RP+LGEC+AA++  FPV FLE  L  ++        T   S            +LP+L     E+ DLAE+G   ++     V+EVTLP+LCSY+  W          +    E+    ++VT +  N +LG  L +I++ + +P   W+ RIA+  QP+V  +   +L  HFLP+ EKLK  A    +EEE  + E  S    A      +  +  ++V++++AFYPLLI +VD HR +W+++  ++ + LF +VAE+F+ W+KS +FK EEQNFV QN+I++L+ ++       +S+   + +     K+  ++  + S++TSL VA +K+LLP+GL+     +++L   AK R  E D     R    +    +  +   +I + LK  +        +E     K  +WQK+L K+  +A                                                     V+AC RM PL++LPRHR V LFL  YR +W+ + EE    +LIE++ ++T                       G       EG  E            DPL QLIT  +++A+    +  +D+LYL+YA IM+K               D       E+E+EK ++L +Q RL DRGAAEMVL ++ G RG +  +V  +++LGI++L GGNT+VQ +ML +L+EK+ +GFF S++GLMQ CSVLDL+ FER  KAEGL                 E + K            +  FQ+YLR+Q GN TTVNIII TVDYLLR+QESI DFYWHY+GKD ID  G+ N  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHMQ KLS+D  Q++LL+E M L K+M++MLLS+LEGNVVNG IGKQMVD LVESS+NVEMILKFFD+FL++K++ SS+AF  +D ++ G IS K+F+ AME  K Y P E E+I+ CV++N    +D+  F  RFH+PAKDIGFNVAVLLTNL EHMP+D +L   +  A  ++  F+P+LGRIEI G   RIERVYFEI +S   QWEKPQ+K+SKR F+  +VNEGG+KEK+E FVNFCEDTI+EMQ + +ISG G G
Sbjct: 2305 IHMGHAIMTFYSALIDLLGRCAPEMHLIEAGKGEAVRIRAILRSLIPVKDLEGVISIPFSLP------FVDTDGSVMEPDMSRL---FCPDHKSAMVLFLDRVYGVQDQNFLLCLLKNGFLPDLKAAVTMDTSGLGGTDMALALNRYVCVAVLPFLSKNSFLLCDPTPAQTTAVDALLQELYSLSKASGLTKAQRDSIQDCLLCVCGKLKPSLVQPLLQNLVLDVPQLTENTKMPLKLLTNHYEHSWKYYCMAGAQGGSGSASEEELQLSRKLFWAVFRALSKKSFAADLFELTLGCLSAVSGAIPPDHT--------------------------DPSYAGGLEGNSSLDSEGR---------FCPQPLDTSNVIVPETLDYVVNKYAEHTHEKWSLEKFASGWAHGEQKCESSKVHPLLKPYRALSERDKESYRGAIKETVKSMLVLGWTIE----------------------RTKEGEARGLH------NLARRISQSGQVTVFILG-------VGGGSHSLLVPYEVLSAREKSRVRERAQDVLKFFHMNGY--------------------------------TVWREQTPADT------DSPATASRFAYCLLQQALSITDQAQEQMLELEVVQARGQMGRTEKIPHEQQ---IFFFTKVLLPLIDQYFKNHHIYFLSRTLCSLSSSSHASIKETEMVTSLFCKLGALTRRRISLFGKDFYF---------QASYLMAVIRTPGES---VQSALCVFFEDAEVDLELAVESVNAGPYGQSRSQARGDAELLTYITTALIPVLTALFQHTEHCHSSEQLMVGEVRGCCYRILCSLYTLGTCNHSFMERQ---------RPVLGECLAALSAAFPVCFLELSLTTSSDEEREGKSTDITSF-----------HLPSLQDAFSEVEDLAEAGSAARHAALSRVMEVTLPLLCSYVCRWGEAA------DPGSSELDGSCSSVTTRDTNVLLGQALSIIQSQLGTPDCSWIKRIAVFVQPLVCKSEPRLLKSHFLPLMEKLKKRAESVLQEEERMKTEGCSDLAEAELA---IQSKFTVMVQDLYAFYPLLIPFVDNHRMSWLREMNEEAERLFFLVAEVFIFWAKSHNFKWEEQNFVVQNDINNLNFLV----GGGRSQKVLAEDERRRMKR--SKDERYSAHTSLIVAALKKLLPVGLNRCCHDDRDLFAVAKGRFSEKDTEEEVRACVRYNLQEVSLKPAHNILDALKLHLFTCFAFAQVEHPQRSKRAVWQKLLSKQRKRA-----------------------------------------------------VVACLRMTPLYNLPRHRAVGLFLLGYRKIWVEAEEEDCENKLIEDLAKTTG---------------------IGMLEEGRREGMKEKE--------KIDPLHQLITFFRQSALTERRKLDEDTLYLAYADIMAK----------VGLTDDHNIYCCCEKELEKQRLLFQQARLHDRGAAEMVLQKLSGSRGTMGLMVASTLKLGIAILNGGNTAVQQKMLDYLREKRDVGFFHSLAGLMQSCSVLDLNAFERQIKAEGL-----------------EVSAK-----------DSAGFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWHYSGKDVIDDHGQRNFSKAIRVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIDLLKELMDLLKDMVVMLLSLLEGNVVNGMIGKQMVDMLVESSSNVEMILKFFDMFLKLKELVSSDAFKEYDPDRQGLISKKDFQRAMEGYKRYTPSETEFILSCVETNESKLLDYRAFVSRFHEPAKDIGFNVAVLLTNLSEHMPHDGQLRNFLELADSVLSYFQPHLGRIEIMGSGKRIERVYFEISESSRTQWEKPQVKESKRQFIFDIVNEGGEKEKMELFVNFCEDTIFEMQLAAQISGSGHG 4013          

HSP 2 Score: 945.651 bits (2443), Expect = 0.000e+0
Identity = 545/1361 (40.04%), Postives = 788/1361 (57.90%), Query Frame = 2
Query:  128 EEEISFLRTDDHV---CLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVL-LKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEE-HEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYA---GNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISK-IFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELM--RRQLDPIQVPTTQDLILEQMPSYPGT 4156
            EE+  FLRT D +   C SSV      + CL+  GFG R CFLE+ S   N P DLS CVF+LD+ +SVRALQ+++A   D          K  ++    + L   +        S+  SADKLAFDVGLQE+   EA                                              Q +     Q    ++ VS      +  G + GGD LRL HG  DECLT+P + G    Q  SV +E G+ SS ARSLWR+E++   WSG    WG   RLRHVT+GRYL +   G  +  V R QA   STAF +R +KD  +   +   + + MG+ ++K+G++  F+QHV +  WL+Y+  ++K+R   K   KQA++  EGHMDDG T+++ Q EES++A  IR  A +F+ FI+ LDE        S S++ +  +   L+DLI +F  P   + HE KQ+ + AL+NRQ LFQEEGII L+L  ID     +     F +  G++  + ++ + + LY LLAA+IRGNR NC+QF+  + +DW+  RLE  +++ G+L+VLHCVL +S EALN I + HIR +I LLDK GR+P++L VLCSLC+   G AVR NQ LI D LLP+RDLLLQ+RLV+  +S+RPN+++ + + SA ++KWYYE+ ++  +  VT     LRVGW+   G+ P P G  GWGS  VGDDL S+GFDG +LWTGG  +R+ ++  Q +L   D+I C LDL+   I F +N +PV+G   +F  DG+ +P VS SA V VR++FGG  G  ++ PP G+S   EALLP  R RLE C  F   + S      G +     V+F P PV+T+++ LP  +E IR++LAEN+HE+W + KI+QGWT+G  RDD  K HP L  F +LP  ERQ ++  A  T+RT++ALG  I          +K ++L N +   NGYRP P+D   ISLS+  E LV  L EN HN+WA +RI+QGWSY    +   KRSP LVP+  +++ IK  +R+ + + + TLL   Y++E+     +E   + +   +K  G    R FR + ++ V  GKWY+E E++T G MR GW     +   E+GS+ Q++ FD      W+  +   G+  Q GDVIGC+LDL  +T+  +LNGEL ++  G EIA K+ S   G++P  S G  Q  +LN G    +LKYF+ CGLQEGY PF +NMSR +PLW S ++P +FV I ++++ ++V    G+    P L++  K +     + +EF RL +PI+C   F+  +     AS  ++   R+LD  +V +  +++++ +  Y G+
Sbjct:    9 EEDFQFLRTSDELALRCCSSVP--LQQKLCLAVEGFGCRLCFLESTSNSKNVPADLSRCVFVLDRCVSVRALQQMIANHEDLQI-------KVQIFSLTYIDLSFPLFQYLSCLSSSGLSADKLAFDVGLQEDVEGEA----------------------------------------------QMIHCQSHQFFKNILTVS------EFTGHLRGGDTLRLLHGHTDECLTIPPA-GRGEEQRRSVHFEGGSASSQARSLWRVEMLCVSWSGSHTRWGQSFRLRHVTTGRYLGLLRDGG-LQLVEREQADIKSTAFCLRPAKDAGQEYVDVVRKREGMGAPEVKYGDSVCFVQHVDTCLWLTYQTSDLKRRKEEKGLHKQAILHSEGHMDDGLTLSRSQREESQAAGLIRSSAFLFSSFIRGLDE----RANISSSELQIDRLSLSLQDLIRYFRSPGEGQGHEAKQSSIRALKNRQHLFQEEGIITLVLDCIDHLH-LYSSAAHFARVAGKEAGDAWEAILSSLYELLAALIRGNRNNCSQFS--TSLDWLVSRLEKLEASTGILEVLHCVLKESPEALNFIKEGHIRSIISLLDKHGRNPKILDVLCSLCVC-HGMAVRCNQNLICDALLPERDLLLQSRLVNQVTSIRPNIYLCMGDDSAQHRKWYYEVVVEKAQPFVTAEPTHLRVGWACTAGYRPSPTGGHGWGSNGVGDDLCSYGFDGLHLWTGGTGRRVSSL-NQHLLREDDVISCCLDLSASCISFRVNGQPVQGMLENFTADGLLFPVVSFSAGVRVRLLFGGKQGEFKFLPPSGFSPCAEALLPGGRCRLELCEEFTRFQGSGQCDLLGPTVPLGPVIFTPTPVDTSQLVLPPQLELIRERLAENLHELWLLDKIEQGWTHGPVRDDSKKVHPGLAEFSKLPEQERQSNLQAAENTIRTLLALGAHIGLSEDHAEENVKYVRLSNKYELCNGYRPAPVDQSGISLSAGQEALVEALTENEHNLWARERIRQGWSYATQLDVKGKRSPQLVPFSLLEERIKCCSREAARDALGTLLGLGYAVES-----TEHQQALTGPEVKTAGEETFRIFRVEHSFAVWDGKWYFEFEVVTDGEMRVGWAQPGSKPDVELGSDDQAFVFDGCKGQWWHGSAVRLGRPWQEGDVIGCLLDLSQKTMMVTLNGELQLNSSGSEIAAKDFSVSGGFLPVCSLGVNQVGRLNLGRQFDSLKYFSVCGLQEGYQPFGLNMSRDLPLWMSWKEP-MFVSILEDHTSIQVTRTDGTADCPPALRVSQKSVVAPDSTAVEFYRLSMPIECAQVFSKPAEGAVPASSSVICHARELDEGEVDSDFEVLMKSVHRYTGS 1291          

HSP 3 Score: 578.17 bits (1489), Expect = 2.407e-164
Identity = 385/1069 (36.01%), Postives = 560/1069 (52.39%), Query Frame = 2
Query: 4508 QYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFD-TRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNK-GAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF--------------------KSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIE-------------PPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNAL-GEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            +YY+S+ +L GQ+   +++GW+TS+F             Q FD  +VH    TL           +DW               +  SV  SC Y++  A              + S G+ IGC +D ATG LTF  N +++   FQV P T L+PA+F K T+ +   F+LGR +  LP+ AGM R  R  A P    RL +Q L ++ W+R+ +    + + +L E  GW     +S+Q+M ++IPEE+RCLDILEL E   LL+FH  TL LY  +C +GN +V+ +L +++D++Q  + +Q   + G LR  F++LL + HL +H+  +  T +E +VP+  + +S  +  KS  K H+    SD ++S+          P    S    P  IS    ++     G   FP LD+        LK ++   L  AV+  G  + +PIGGS E + VPLL+++  LL+MG+   +D+  +LS++  + +                    K +   R   V    L M L E+VKL+LCHLL  LCD Q+RHR+E ++  S+D V ++Q++Q  RY E+ ++ ++ +++TA+ TKEFR PP++QM  +LNF  +   C         C EE+K  +  FH  L  +C +E             PP    +  L+++  + KR  S      GI                               +E   + ++ +L Q+I  T++ WA    +EN  L+R  FSLL  QY  L G++   L+K Y IS  S +D   L  +LGR+R LL  ++G  EE L+   L DIM NKVF+QHPNL R L +HETVM++MV+ L          R S ++ F                                            +MV  CCRFLCYFCR S  NQK MF+HLSY+L++SS+ LA PS+RG+ PLDVA +S+MDN ELAL++ E  LEKV  YL+  G++S   L+SKGYPDIGW+PVEGER+LDFLRF V+ NGE +EENA +VVRLLIRRPEC GPALRG
Sbjct: 1350 KYYYSLKILNGQEPSCVWVGWITSTFH---------PPEQPFDLEKVHTVMVTL----------GDDWG-------------KVLESVRRSCCYMVCAAA-----EGSSLSHSRSSSGLEIGCLVDTATGLLTFTANGKDMETFFQVEPGTKLFPAVFAKATSLDVFQFQLGRIKGVLPLSAGMFRSERNNAVPQCPPRLSVQRLTRARWARLPDHSPHVQLTRLGEGHGWRAQCTDSLQVMTLYIPEEERCLDILELSELEHLLKFHEHTLNLYSALCAHGNLHVSHALCSYIDQSQLLFALQCPRMPGTLRESFYNLLTSAHLSAHASAQQATTHEYIVPMTDATRSIALF-KSDGKRHS-LPGSDISTSLR---------PRMHFSS---PCFISSSNPIQAGSPPG---FP-LDI--------LKGVTTAMLEEAVHAVGQSVRDPIGGSIELLLVPLLQLLHTLLLMGVFQGSDLRRVLSLILPSAYMGENDMERWADGDEEGNGEKKDEDKERWVSVPLLELKMKLPEAVKLKLCHLLQYLCDCQVRHRVEAVLAFSDDLVDHLQDNQRYRYNEVMEALNMSAALTARKTKEFRSPPQEQMNMLLNFQESQQECP--------CPEEIKDLLWDFHIDLRRHCEVEVDDEDQATKDEVDPPNRYRLKGLVDRIVRLKRRMS------GI-------------------------------VEEDIVTKSVSLQQLISDTMLRWAHEGLLENPTLVRAAFSLLQWQYAGLSGQMAAPLRKAYCISQSSVEDTLYLQEALGRIRSLLRARMGREEEELMIRGLGDIMKNKVFYQHPNLMRALGMHETVMEVMVNVL--------GARESKEIMF-------------------------------------------PKMVAHCCRFLCYFCRISRHNQKAMFDHLSYLLDHSSVGLASPSMRGSTPLDVAAASVMDNYELALSLTEADLEKVVQYLAGCGLRSCSLLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENAYVVVRLLIRRPECFGPALRG 2259          

HSP 4 Score: 472.241 bits (1214), Expect = 2.699e-132
Identity = 251/468 (53.63%), Postives = 332/468 (70.94%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEV-----EQKPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQ-----PSEASGSRGWLRKKMI---AWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVK-DMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            T +++ FA++ YN ++ AL +AF INF+LLFY+V     E++  SD  +  S D   +    +L +S  YM  +   LA LH+  A   +I YYCLKVPLV+FKREKE++R LEF+G+++T+QP++D++K  WD+LV++TPS+P NYWDKFVK+KV  KYSE Y  + I  LLG+++      SEA   R  +R+ +I   A D++Y IWK GV+FTDN      + F++  + + ++                              LVLTV L +V++YLYTV+AFNFFRKFY K  DG   DMKC +MLTC++FH++ G+RAGGGIGDEIE P GD  E YR++FDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG EYFD +PHGFE H  +EHN ANY++F+M++INK  TE+TGQE+YVW++YQ+RCW+FFPVGDCFRKQYE++L
Sbjct: 4256 TKLLNYFARHFYNIRVLALCVAFTINFILLFYKVSSSKAEEESGSDLREEWSGDSGAV--CFVLGES-GYMEPVLHCLAVLHTLIAFCSIIGYYCLKVPLVIFKREKELARNLEFDGLYVTKQPSEDDIKGQWDRLVINTPSYPSNYWDKFVKRKVMEKYSELYGSDRISELLGLDKTALDFSSEAQERRKPVRESLITTLAVDMKYQIWKLGVVFTDN------VSFLSVKLQDLDFL-----------------------------LVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGEPLDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDESEFYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSEYFDAVPHGFESHTLQEHNLANYLFFVMYLINKDVTEHTGQESYVWKMYQERCWEFFPVGDCFRKQYEDQL 4685          

HSP 5 Score: 105.145 bits (261), Expect = 2.553e-21
Identity = 71/254 (27.95%), Postives = 115/254 (45.28%), Query Frame = 2
Query: 8966 SAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDD-----------DFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI-------INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S  SP  ++L PGG   +E  E+         S   D            F P PVDTS + LP  LE + ++ A++LH+ W L+ +E+G+ +G  R+D  K HP L  F  L + ++   ++     ++ ++A G    A +   E H E     +       + +GY P P D  G++++     + E L EN HN+WA+ +       A    + G     LVPF +L ++ K   R+   + L  L   GY
Sbjct:  750 SGFSPCAEALLPGGRCRLELCEEF---TRFQGSGQCDLLGPTVPLGPVIFTPTPVDTSQLVLPPQLELIRERLAENLHELWLLDKIEQGWTHGPVRDDSKKVHPGLAEFSKLPEQERQSNLQAAENTIRTLLALG----AHIGLSEDHAEENVKYVRLSNKYELCNGYRPAPVDQSGISLSAGQEALVEALTENEHNLWARERIRQGWSYATQLDVKGKRSPQLVPFSLLEERIKCCSREAARDALGTLLGLGY 996          

HSP 6 Score: 72.7886 bits (177), Expect = 1.349e-11
Identity = 49/231 (21.21%), Postives = 94/231 (40.69%), Query Frame = 2
Query: 2639 GNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI--ETPPTDVSEMAVSNSF 3325
            GNS       F P+P++T+ + +P  ++ + +K AE+ HE W+++K   GW +G+ + + +K HP L  +  L   +++       ET+++++ LG+TI      E   L  +                     IS S  +   +  +   +H++                         LVPYE +    K   R+ + + +K      Y++  E  P D    A ++ F
Sbjct: 2615 GNSSLDSEGRFCPQPLDTSNVIVPETLDYVVNKYAEHTHEKWSLEKFASGWAHGEQKCESSKVHPLLKPYRALSERDKESYRGAIKETVKSMLVLGWTIERTKEGEARGLHNLA------------------RRISQSGQVTVFILGVGGGSHSL-------------------------LVPYEVLSAREKSRVRERAQDVLKFFHMNGYTVWREQTPADTDSPATASRF 2802          
BLAST of Ryanodine receptor related vs. Ensembl Cavefish
Match: ryr3 (ryanodine receptor 3 [Source:ZFIN;Acc:ZDB-GENE-041001-165])

HSP 1 Score: 1026.93 bits (2654), Expect = 0.000e+0
Identity = 565/1306 (43.26%), Postives = 811/1306 (62.10%), Query Frame = 2
Query:  155 DDHVCLSSVG--HGSSDRFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSG-HKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYL-YLLL--AAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCK 4024
            DD V L  V      + +FCLSA G G+R C+LE  S  +  PPDL +C F+L+Q+LSVRALQE++A         GQ G H+TLLYGHA+LL+H+ S M                          EACWWT+HPA+KQRSEGEKVRIGDDLILVSVSSER+LHL+  NG  IQ  V ASF QTLW V P  SG+    ++G + GG V+RLFHG DE LTVP S+ +   Q     YE G   S ARSLWRLE ++  WSG  I WG   RLRH+++G YL  +     +  + R ++  ++TAF  R SK+ K     + + + MG A+IK+G++  F+ HV++  WLSY+A    K     + +++A +  EGHMDDG  +   Q EES++A  IR    +FT+FI+      +     SL    + EV++ L+DLI +F +P+ D EHE KQ +L +L  RQDLF+EE  ++L +             R  I         W  QLSN+L Y++L   A+I+GNR NC QF++  ++DW+  +LE  +S+ G+L+ LHC+LT+S EALNII  +HI+ +I LL K GR+ ++L +LCSLC+   G AVR NQ  I ++LLP RD+LLQT+LV+   S+RPN+F+G+ E SA Y+KWY+E+ ID +++ VT     LRVGW+  +G+ P+PGG +GWG   VGDDL+S+ FDG +LW+G  P+ + ++  Q +L   D++ C LDL  P + F IN +PV+G F DFN DG F+P VS SA V VR + GG HG  ++ PP GY+  +EALLPKE++R+EP   +    + +    G ++      FIP PV T EI LP ++EN+RDKLAENIHE+W M KI+ GWTYG+ RDD  + HPCL  F +LP  E+ +++ ++ ETL+T++ALG  +          LK IKLP  ++ SNGY+P PL+L  + L+   E LV++LAEN HN+WA DRIKQGW+YG  ++   +R+P LVPY  +D+  KKSNR +  E ++TL+ Y Y+I+ P  + +        N++++     IR FR + T+ VTSGKWY+E E +T G M  GW         E+G + Q++ FD     + ++ S  +G+    GDV+GCM++++D+++ F+LNGE+++   G E+ F +   + G++P  S G  Q  ++N G D  T KY+T CGLQEG+ PF VNM+R V +W+S+  P  FV++ +++  +EV    G+V   P LK+  + FG Q S  +M + RL +P+ C+
Sbjct:    7 DDEVVLQCVATIQKENRKFCLSAEGLGNRLCYLEPTSEAKYVPPDLCICNFVLEQSLSVRALQEMLANTGQNGEGAGQGGGHRTLLYGHAILLRHSFSGMV----------------------RMREACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERFLHLSMSNG-NIQ--VDASFMQTLWNVQPTCSGS--NVAVGYLLGGHVIRLFHGHDESLTVPGSD-QSGEQQRVANYEAGKGGSRARSLWRLEPLRISWSGSHIRWGQPFRLRHLSTGHYLGQT-EDRGLVLLDREKSDTTATAFCFRPSKE-KVDSGSKRDIEGMGVAEIKYGDSVCFIMHVATGLWLSYQA-PDAKSSRLGLLKRRAFLYPEGHMDDGLILQLCQHEESRAARIIRNTTQLFTQFIRYSISVPVTASEVSLP---VGEVMQTLDDLITYFQQPDPDLEHEEKQRQLRSLIKRQDLFKEE--VSLFIC------------RLLI---------WV-QLSNHLLYIILHATALIQGNRPNCTQFSR--KLDWLISKLERLESSSGILEALHCILTESPEALNIIQKVHIKSIISLLYKHGRNHKILDILCSLCVC-NGVAVRTNQNFISEHLLPRRDVLLQTKLVNDVQSMRPNIFLGMSEGSAQYRKWYFELIIDQVDHFVTGEPTHLRVGWATTKGYAPYPGGGEGWGGNGVGDDLYSYSFDGLHLWSGRIPRAVASI-NQHLLTSDDVVSCCLDLGAPSMSFRINGQPVQGMFEDFNTDGFFFPVVSFSAGVKVRFLLGGRHGDFKFMPPAGYAPCYEALLPKEKMRVEPVKEYKRDLEGVRDLLGTTKLLSQASFIPIPVNTAEIVLPPHLENVRDKLAENIHELWGMNKIELGWTYGKIRDDNKRQHPCLVDFSKLPETEKNYNLQMSTETLKTLLALGCHVAQVQVDAEEDLKRIKLPKDYMMSNGYKPAPLELSEVKLTPGQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSRRNPRLVPYALLDERTKKSNRDSLREAIRTLIGYGYNIDPPDQETA--------NVIEKLNVENIRFFRVEKTYAVTSGKWYFEFEAVTGGEMCVGWARPGCRPDIELGLDDQAFVFDGCRGRRVHMGSHFFGRSWNKGDVVGCMINMEDKSMIFTLNGEILITNRGSELCFADFDTEGGFIPVCSLGLSQIGRMNLGKDASTFKYYTMCGLQEGFEPFAVNMNRDVTMWFSKRLPT-FVNVPEDHKHIEVTRIDGTVDTPPCLKVTHRTFGTQASNNDMIYCRLSMPLFCR 1241          

HSP 2 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 513/1357 (37.80%), Postives = 760/1357 (56.01%), Query Frame = 2
Query: 7973 NLPPED--DPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIIN------DGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA---IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQ-------SMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYS--LEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDS--IGKKFLARKAKLSSY-TSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRM 11962
            NL  ED  + +   +G +I++FYS L+DLLGRCAPE    +  K  +LR+RAIL+SLV ++DL G++S+   +P       +N+DG     D   M     P+HK+ +VLFL+RVYGI+D    L L+E  FL D+RA+  LD   S  ++ ALA+NRY+G++VLPLLT+ +      E  A ++++TLHT YRLS+ RSLTK QR+ + + L+A+ Q L+P M+ +LLR+L+ DVP LT    +P++LLT  Y++   YY   +G+   G+A+EEE  LT +LF G+FD L++  YD ELF  A+PCL+AIG AL PDY                    SPT   +           +Q+ V+       T  +F P+P++T++I LP  LE + +++A+H H+ W+ E   +G+  G   N+  KTHP L  +  LS+ D+  Y  PV E+LK+M+A  W I+       M  +R    +        DG+NP P DL  V +++E+  M E +AEN HNIWA+ KK ++ S GGG H +LVP++ LT KEK R R+   EL K+LQ NGY                  +R   D   DS                      SS   R AY  L +LL YV+ A   I  ++ M  S +  ++ P  QE   IKFF KV+LPL+++YF  H  YF+            A N+EK+M        FS+L Q LTA   D    V CL  L  ++D R ++K  S   + V+  +  FF N A+DL   ++NL + +    +  ++  A  + Y    LLP+L ++F HV++   G DLL+ DVQ++CY+IL +LY LGT  + Y +++          P LGEC+A +    PVAFLE  LN +N  S+    T      L   + + E+   +P LD ++++I D++ESG +YT+ PHVIEV LPMLC+YL  WW +GPEN   +          TTVT++ ++ +LGN+L+++ NN+    A WM R+A+ TQPI+  A  ++L  HFLP  EKLK   ++   EEEL +AE ++ ++ A      +  +  +L R+++AFYP+LI+YVD +R+ W+K+P  D+  LF +VAEIF++W KS +FKREEQNFV QNEI++L+ +  D    +KS+ S+S   D    GKK   RK +L S  TSL V+  K+LLPIGL+M    +Q LI  AK R                     K+ D +++++LK  + L+E+ +D    WQ  LYK +     + S E+   E  ++R+  ++  +  L  V+ P    K   +KL+S QRKRAV+ACFRM
Sbjct: 2193 NLIGEDGEEEEVAHMGNSIMSFYSALIDLLGRCAPEMHLINKGKGEALRIRAILRSLVPIKDLVGIISIPLKVP------VINKDGTVTEPD---MNSSFWPDHKSPMVLFLDRVYGIEDQSFLLNLVEVGFLPDLRASASLDTVLS-TTETALAMNRYIGSAVLPLLTRCASLFAHTEHYAQLVDSTLHTIYRLSKGRSLTKAQRDSIEECLLAICQHLRPSMLQQLLRRLVFDVPQLTEYCKMPIKLLTNHYEQNWKYYCLPSGLGSYGMASEEELHLTKKLFWGLFDALSQKKYDSELFKMAMPCLSAIGGALPPDYV-----------------DTSPTTTLV-----------KQVSVD-------TQGNFDPKPINTANISLPEKLEYIANKYAEHCHEKWSSEKFAQGWTAGEKVNEQAKTHPLLKPYKALSEKDRETYRYPVKESLKSMLAMSWNIERTKEGEAMFQQRETEKLKTTEPSQGDGFNPTPVDLDNVILSRELQSMVETVAENYHNIWAKKKKMELSSKGGGTHPLLVPYDTLTAKEKYRDREKAQELFKFLQLNGY----------------ALSRGFKDMEQDS----------------------SSMEKRTAYKFLKRLLSYVDSAQEFIAHLEAMASSGKTDKS-PHEQE---IKFFAKVLLPLIDQYFKNHCLYFLSSPSISLSSSGYASNKEKEMITR-----FSILLQSLTARS-DSATMVSCLHILACSLDFRTVMKSGS---ELVKAGVRTFFENAAEDLEKTMENLKLGKLGQSRTQMKGVAQIIVYTSTALLPILTALFQHVTQHQFGVDLLLDDVQLSCYRILTSLYSLGTGKNSYVEKQ---------LPALGECLATLVGAMPVAFLEPDLNMHNPCSVFNTKTPRERAILSMPDTVEEMCPEMPRLDGLMKDIHDISESGARYTDMPHVIEVILPMLCNYLSYWWEKGPENSPSDM------DCCTTVTSEHLSLILGNILRILNNNLGIEEASWMKRLAVYTQPIISKAGADLLRTHFLPTLEKLKKKTVKVVSEEELLRAESRADTQEAELQ---ILDEFAVLCRDLYAFYPMLIRYVDNNRSKWLKKPHADSTELFKMVAEIFILWCKSHNFKREEQNFVVQNEINNLAFLTGD----SKSKMSKSGGQDQERRGKK---RKRELYSVQTSLIVSAHKKLLPIGLNMCTPGDQMLISLAKIR------------------YCLKDTDDEVKDHLKQNLHLQEKSEDPGVQWQLNLYKDVE----MKSEEASDVEHTVERIQGISAAVFHLEQVELPLRNKKLVAQKLLSKQRKRAVVACFRM 3406          

HSP 3 Score: 589.341 bits (1518), Expect = 9.403e-168
Identity = 371/1071 (34.64%), Postives = 550/1071 (51.35%), Query Frame = 2
Query: 4508 QYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPIS----FQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRR-PRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF---------------------------------KSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            QY++SV V  GQD   +++GWVT  +                                  SK  +   V  VT+   +    +  SV  S  Y++   ++ N+   + +      + + + C L     ++ F      LP      +QV P T L+PA+F++PT+     FE  + ++ +P+ + + +   R   P    RL +Q +    WSR+ N+   +   +++E  GW +   E +QMMAVHIPEE+RC+DI+EL E+  L  FH +TL+LY  +C  GN  VA +L +H+D++Q  Y I N YL G+LR  F+D+LI++ LE+    +L   NE ++P+    +S R+     ++                     H +P    S S+ P L  +      +    E  +      P+I    LK  ++  L  AV  G   I +P+GGS E  FVP+LK++  LLIMG + S ++ +IL +++   F                                 +SK + + P+    +L+  L E VK Q+C LL+  CD +L+ RIE IV  S+ FV+ +Q +Q  RY E+ Q+ ++ ++VTAK TKEFR PP++Q+  +LNF            +   C EE++ ++  FH  L  +CGI                           PM     E+  SI   L ++L   + RP +  +   E  +     NL ++I  T+++WA+   I++ +L+R MFSLL RQY+ +GE+  +++K+Y IS +S  D   LL SLG++R LL V++GE E  L+ + L DIMNNKVF+QHPNL R L +HETVM++MV+ L   K                                     S  A P+               MV  CCRFLCYFCR S +NQK MF+HLSY+LENSS+ LA P++RG+ PLDVA SS+MDNN LALA+ E  LEKV  YL+  G+QS   L++KGYPDIGW+P+EGER+L FLRF V+VNGE +EENAN+VV+LLIR PEC GPALRG
Sbjct: 1257 QYFYSVRVFAGQDPAAVWVGWVTPDYHYY-------------------------------SKHFSLNKVRTVTVTLGDERGRVHESVRRSNCYMVCAGEISNSSSGRSNTDL---ESIKVSCALQLKIMSVVF------LPSPLWRYYQVEPNTKLFPAVFIEPTSPNLFQFEFPKIQDAMPLSSAIFKSLHRNPEPQCPPRLDVQTIVSVLWSRMPNSFLSVETARVSERHGWVVQCLEPLQMMAVHIPEENRCIDIMELSENEDLRMFHYQTLKLYCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLTGQLREGFYDVLISICLETAKEARLMMNNEFIIPVTDETRSIRLFPDESKR---------------------HSLPGVGLSTSLTPRLNFNPPCF--ITTKREHTY-----SPQIPLGILKEKAISMLTEAVQGGGTHIRDPVGGSVEYQFVPILKLIGTLLIMGALTSEEVRLILLLIEPNVFADNKEEEKPAAEEAVEKEEASSNEEKTVEAGEEESKDSKQAPK---GLLEKSLPEPVKRQMCELLNYFCDCELKQRIEAIVAFSDHFVAKLQYNQKFRYNELMQAFNMSAAVTAKKTKEFRSPPQEQINILLNF---------SAGEDCPCPEEIQEELQNFHDDLRLHCGI---------------------------PMEEEEEEQDTSIKGRLLSLLYKIKGRPQKTEEEPSEQEQATPT-NLKELISQTMVSWAQECTIQDPELVRIMFSLLRRQYDGIGELLRAMRKSYTISEKSVQDAINLLASLGQIRSLLSVRMGEEEGQLMIDGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGGDK-------------------------------------SKIAFPK---------------MVASCCRFLCYFCRISRENQKAMFDHLSYLLENSSVGLACPAMRGSTPLDVAASSVMDNNSLALALEEPDLEKVVTYLAGCGLQSCPMLVAKGYPDIGWNPIEGERYLSFLRFAVFVNGESVEENANVVVKLLIRHPECFGPALRG 2167          

HSP 4 Score: 587.415 bits (1513), Expect = 3.574e-167
Identity = 326/631 (51.66%), Postives = 434/631 (68.78%), Query Frame = 2
Query: 12230 PDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN--LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDII--------------GTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDIVVGVF 14074
            PDPL+QLI      A+   ++ S+ + Y  I+   C                    QE+EMEK + L +Q RL  RGAAEMVL  I   +G +  +V  +++LGIS+L GGN  VQ +ML +LKEK+  GFF S+SGLM  CSVLDL+ FER NKAE L   G+   +G ++  L + +FT  LFRFLQLLCEGHN  FQ++LR+Q GNTTTVNIII TVDYLLRLQESI DFYW+Y+GKD ID  G+ N  KA+ + KQIF +LTEYIQGPC+GNQ +LAHSRLWDA+ GFL +FA+MQ KLS+D  Q+ELL+E M LQK+M++M+LS+LEGNVVNG IGKQMVDTLVESS+NVEMILKFFD+FL++KD+T+S+ F  +D    G IS KEF+ +ME QK Y   EIE+++ C +++ +   ++ EF +RFH+PAKDIGFNVAVLLTNL EHMP+D+RL   +  A+ ++  FEPYLGRIEI G + RIERVYFEI +S  +QWEKPQ+K+SKR F+  VVNEGG+ EK+E FVNFCEDTI+EMQ + +IS +    R  +       +               ++  L  T    K+++   +L   +++  +K  + +++K+++ G F
Sbjct: 3425 PDPLNQLILHFSHNAL---TERSMCICYEFIIHCVCLPS-----------------QEKEMEKQKTLYQQARLHARGAAEMVLQMISASKGRLGPMVTCTLKLGISILNGGNVVVQQKMLDYLKEKRDAGFFKSLSGLMMSCSVLDLNAFERQNKAESL---GMVTEEGSSSKVLQNDDFTKDLFRFLQLLCEGHNNDFQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDIIDEQGQRNFSKALAVAKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELMDLQKDMVVMMLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKLKDLTTSDNFKEYDPEGKGMISKKEFQKSMESQKQYTQSEIEFLLSCTEADENDMFNYAEFVERFHEPAKDIGFNVAVLLTNLSEHMPHDSRLGTFLDLAESVLSYFEPYLGRIEIMGGAKRIERVYFEISESSREQWEKPQVKESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMQLASQISEQDAAERPEEEEEELQSLLEELAEGEDGSQESASAFTLACTSVKKKMSNFRQMLTIKSMRKQFKKFKKLTIKEMITGFF 4032          

HSP 5 Score: 557.37 bits (1435), Expect = 4.224e-158
Identity = 280/471 (59.45%), Postives = 358/471 (76.01%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVE------QKPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQ------PSEASGSRGWLRKKMIAW----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            T +++  A+N YN ++ AL++AF INF+LLFY+V       ++  S     +  +     EF +L +S  YM      LA LH+  +L  ++ YYCLKVPLV+FKREKEI+R LEF+G++ITEQP+DD++K  WD+LV++TPSFP NYWDKFVK+KV NKY + Y    I  LLG+++      P+E +  +      +++W    D +Y IWK GV+ TDN++LYL  Y   S++G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GDPYE YRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQ EQVKEDME+KCFICGIG +YFD  PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4235 TKMLNYLARNFYNLRMLALLVAFAINFILLFYKVSGETEEEEEDESPWGGDDEDEDGGGMEFFVLQESTGYMAPTLTFLAVLHTIISLLCVVGYYCLKVPLVVFKREKEIARTLEFDGLYITEQPSDDDIKGQWDRLVIATPSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDKSALDFDPTEEAVVK---EASLLSWLSSIDTKYHIWKMGVVLTDNSYLYLIWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDAPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYELYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 4702          

HSP 6 Score: 117.857 bits (294), Expect = 3.240e-25
Identity = 81/258 (31.40%), Postives = 129/258 (50.00%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEG-------SRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDV----SEMAVSNSFNILKRKGS--SAIRTFRAQSTWKVTSGK 3403
            F P+P+ T  I LP  +E I +K AE+ HE W+ +K  QGWT G+  ++  KTHP L  ++ L   +R+       E+L++++A+ + I      E         +LKT + P+   Q +G+ P P+DL N+ LS  L+++V  +AEN HNIWA  +  +  S G   +      P LVPY+ +    K  +R+ + E  K L    Y++     D+    S M    ++  LKR  S   + + F A      +SGK
Sbjct: 2523 FDPKPINTANISLPEKLEYIANKYAEHCHEKWSSEKFAQGWTAGEKVNEQAKTHPLLKPYKALSEKDRETYRYPVKESLKSMLAMSWNIERTKEGEAMFQQRETEKLKTTE-PS---QGDGFNPTPVDLDNVILSRELQSMVETVAENYHNIWAKKKKMELSSKGGGTH------PLLVPYDTLTAKEKYRDREKAQELFKFLQLNGYALSRGFKDMEQDSSSMEKRTAYKFLKRLLSYVDSAQEFIAHLEAMASSGK 2770          

HSP 7 Score: 106.301 bits (264), Expect = 1.097e-21
Identity = 64/208 (30.77%), Postives = 110/208 (52.88%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQ---------GKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PV+T+ I LP  LE++ D+ A+++H+ W +  +E G+ YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G  +       + DL RI++     +  ++++GY P P +L  V +T     + +KLAENAHN+WA+         G + D+ S     +  LVP+ +L ++ K   R    E ++ L   GY
Sbjct:  794 FIPIPVNTAEIVLPPHLENVRDKLAENIHELWGMNKIELGWTYGKIRDDNKRQHPCLVDFSKLPETEKNYNLQMSTETLKTLLALGCHVAQVQVDAEEDLKRIKL----PKDYMMSNGYKPAPLELSEVKLTPGQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKS---RRNPRLVPYALLDERTKKSNRDSLREAIRTLIGYGY 994          

HSP 8 Score: 63.5438 bits (153), Expect = 8.559e-9
Identity = 25/92 (27.17%), Postives = 58/92 (63.04%), Query Frame = 2
Query: 9074 DDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            + +KP P++ S ++L    E L+D+ A++ H+ WA + +++G+ YG+ ++  ++ +P L+ + LL +  +    + + EA++ +I +G+ ID
Sbjct:  906 NGYKPAPLELSEVKLTPGQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSRRNPRLVPYALLDERTKKSNRDSLREAIRTLIGYGYNID 997          
BLAST of Ryanodine receptor related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010602.1 (pep scaffold:Pmarinus_7.0:GL476450:29:322425:-1 gene:ENSPMAG00000009553.1 transcript:ENSPMAT00000010602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1142.49 bits (2954), Expect = 0.000e+0
Identity = 620/1320 (46.97%), Postives = 851/1320 (64.47%), Query Frame = 2
Query:  155 DDHVCLSSVGHGSSD--RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVA---KGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG-DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQ---RSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQP---ILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQKS--EMEFLRLGLPIKCKDHFTTKSL 4048
            +D V L S      +  +FCL+A GFG+R CFLE++S  +N PPDLS+C F+L+Q+LSVRALQE++A   +  +  A+GG  GH+TLLYGHA++L+H  S M+LSCL TS SS+DKLAFDVGLQE+   EACWWT+HPA+KQRSEGEKVR+GDDLILVS+SSERYLHL+  NG      V ASFQQTLW V PV SG+  + + G + GGDVLRLFHG DEC+TVP ++        SV YE GAV SHARSLWRLE ++  WSG  + WG   RLRHVT+G+YL+++     +  V R  A   ++AF +R SK+ K       + D MGS +IK+G++  ++QHV S RWL+Y+A    K        ++A++  EGHMDDG T+++ + EES++A  IR   ++F  FI+ L  + +  +   R +  ++ +  V   L+DLI +F  P  D EHE +Q  L AL+NRQ+LFQEEG+I L+L  ID+ +  +     F    GE+  E + ++ N LY LLAA+IRGN  NCAQF+  S +DW+  RLE  +++ G+L+VLHCVL +S EALNII + HI  +I LLDK GR+ +VL VLCSLC    G AVR NQ LI DNLLP RDLLLQTRLV+  +S+RPN+++GV E SA Y+KWYYE+ +DS+E  VT     LRVGW+N EG+ P+PGG +GWG   VGDDL+S+GFDG +LW+G    RI   V  P   +L+  D++ C+LDL +P I F IN +PV+G F +FN DG+F+P VS SA VSVR + GG HG  ++ PP GY+  FEALLPK+R+R+E    + +         G + + +   F P PV+T++I L  ++E +R+KLAENIHE+WAM KI+ GWTYG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +        + LK  KLP ++L S+ Y+P PLDL N  L+   E LV++LAEN HN+WA DRI+QGW+YG  ++   +R+P LVPY  +D+  KKSNR +  E V+TLL Y Y IE P  D +     +   + KR+       FR +  + V +GKWY+E EL+T G MR GW          +GS+ Q++ FD   + KW+     +G+  QPGDV+GC++DL D          +M+D  G E AF  +    G++P  S G  Q  +LNFG D   LKYF  CGLQEGY PF V M+R + LWYS+     F+ +  ++   EV    G++   P LK+  K FG Q S  ++ F RL +P++C+++F  + L
Sbjct:    1 EDEVVLQSTATIQKEQLKFCLAAEGFGNRLCFLESISNAKNVPPDLSICKFVLEQSLSVRALQEMLANTEEKAEGTALGG--GHRTLLYGHAIILRHAHSGMYLSCLRTSHSSSDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSISSERYLHLSHANGSL---HVDASFQQTLWNVSPVCSGS--EMAQGYLIGGDVLRLFHGHDECVTVPPAD-RGDEHRRSVHYEGGAVCSHARSLWRLETLRVSWSGNHLHWGQPFRLRHVTTGKYLALTEE-RVLLLVDRGCADVKTSAFSMRSSKE-KLDSGPRRDIDGMGSPEIKYGDSVCYMQHVESGRWLTYQA-ADAKTARMGSYTRKAIMHQEGHMDDGLTLSRSRHEESRTARVIRCTTNLFNGFIRGLLTFSVYSKAAGRGAGVELPIEGVKLSLQDLILYFQPPKDDLEHEEQQNHLRALKNRQNLFQEEGMITLVLDCIDRLS-VYSSAAYFADVAGEEAGEAWKEILNTLYELLAALIRGNHRNCAQFS--SSLDWLVSRLERLEASSGILEVLHCVLIESPEALNIIKEAHITSIISLLDKHGRNHKVLDVLCSLCEC-NGVAVRANQNLICDNLLPGRDLLLQTRLVNNVTSMRPNIYLGVSEGSAQYRKWYYELIVDSVEPYVTAAPTHLRVGWANGEGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSG----RIARAVGSPNRHVLSADDVVSCLLDLNIPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVSVRFLLGGRHGEFKFLPPAGYAPCFEALLPKDRMRVEHVKVYKHDHDGTRDLLGPTVSLKQSAFTPVPVDTSQIALLPHLERVRNKLAENIHELWAMNKIEMGWTYGTVRDDNKRQHPCLVDFHKLPEQERNYNLQMSSETLKTLLALGCHVGIADEQAEATLKRFKLPRNYLMSSNYKPSPLDLTNTKLNPTQEALVDRLAENAHNVWARDRIRQGWTYGIQQDIKNRRNPRLVPYALLDERTKKSNRDSLREAVRTLLGYGYHIEAPDQDPATRV--DVHGVHKRQ-------FRTERFYAVRTGKWYFEFELVTAGDMRVGWARPGCRPDVALGSDDQAFVFDGLKSQKWHQGGEHFGRAWQPGDVVGCLVDLNDS---------IMLDDSGSEFAFSELEIGEGFMPICSLGLSQVGRLNFGKDATKLKYFPICGLQEGYEPFAVYMNRDITLWYSKR-LAQFMPVMADDDHFEVTRIDGTIDSPPCLKVSHKTFGSQHSNTDLAFFRLSMPVECEENFGRRGL 1282          

HSP 2 Score: 1077.39 bits (2785), Expect = 0.000e+0
Identity = 685/1703 (40.22%), Postives = 973/1703 (57.13%), Query Frame = 2
Query: 8003 VDLGAAILTFYSVLVDLLGRCAPEHD---TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA---DLSRIEMH-----GERRRPTIIND------GYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDS-IGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQM------RPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSM-------AFNEEKKMAATLFCKLFSLLRQKLTALGH---DINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILG------ELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEE-DDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGI--------TNLYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQES-IMDFYWHYTGKD 12946
            V +G AI+TFY+ L+DLLGRCAPE     T K  ++R+R+IL+SLV +EDLEGV+S+ F +P      T+++DG     D   M  G  P+HKA++VLFLERVYGI+  +  L +LE  FL D+RAA  LD  +   +D ALALNRYL ++VLP+LT+ +      E  +S++++ LHT YR+S+ RSLTK QR+ + + L+A+  QL+P M+  LLR+ + DVP L   S +PL++LT  ++RC  YY  ++G    G A+EEE  LT +LF G+F+ L+K PY+ ELF  ALPCL AI  AL PDY     + S ++ ++ S S+                     LD E          +FKPQP+DTS I +P  L+  ++++A+H+HD W++E   +G+ YG   N+ +K+HP L  F L S  D ++    V E   A     W I +   D   + +H     G  RR +          G+ P P D+  V + +++ +M+E LAEN HN WA  KK ++++  GGG H +LVP++ LT KEKS+  +   EL K+LQ NGY                  +R   D   D+                      SS   RFAY +L +L+ YVE A   + Q+      R   R S   P  QE   IKFF KVVLPL+++YF  H+ YF+   S        A N+EK+M  +LFCKL  L+R +++  G    D    V CL  L  ++D R ++K+     D V+  L  FF + A+DL   ++NL   RF+H +  ++  A ++NY  + LLP+L S+FDH+ +   G DL++ DVQV+CY+IL++L+ LGT  + Y +R+         RP LGEC++A+A  FPVAFLE  LNK N +S+    T       R ++G      ++ K++P+LD +++EI DLAESG +YTE PHVIEV LPMLCSYL  WW  G E     A EE +    T  T++ +N +LGN+LK+I NN+    A WM RIA+  QPI+G A   +L  HFLP  EKLK    +   EE+  +AE K        +      +  IL R+++AFYPLL+++VD  R  W+ +P  D + LF +VA++F++W+KS +FKREEQNFV  NEI+++S ++ D  S         A  D   KK   R  + +  TSL VA +KR+LPIGL++    +QELI  AK R                     K+ D ++ ++++N + L+ +  D  T  WQ  LYK++   +     E+   E  + R+L ++ VL+ L  V+ P    K  W K++S QR+RAV+ACFRM PL++LPRHR +NLFL+ Y+  W+  EE     RLIE++  S                        G+E  E+ +G               DPL QLI     TA+ + S   +D LY++YA IM+KSC  +++D++ E E     KS +E+EMEK ++L +Q RL DRGAAEMVL  I   +G    +V  +++LGI++L GGNT+VQ +ML +LKEKK +GFF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G           + D EFTC LFRFLQLLCEGHN  FQ+YLR+Q GN TTVNIII TVDYLLRLQ S I DFYW+Y+GKD
Sbjct: 2389 VHMGNAIMTFYAALIDLLGRCAPETHLILTGKGEAIRIRSILRSLVPIEDLEGVISIPFKMP------TIDKDGMVMEPD---MSAGFCPDHKAAMVLFLERVYGIETQDFLLHMLEVGFLPDLRAAAALDTLALSATDMALALNRYLCSAVLPVLTRCASLFAGTEHHSSLIDSMLHTIYRISKGRSLTKAQRDAIEECLIAVCGQLRPSMMQHLLRRFVFDVPLLNQNSKMPLKVLTNHFERCWKYYCLASGWGSYGAASEEELHLTRKLFWGVFNALSKKPYEQELFKLALPCLGAISGALPPDY-----MESSRMVAMDSQSS---------------------LDAEG---------NFKPQPIDTSSITIPEKLDFFINKYAEHVHDHWSMEKYAEGWSYGEVLNEESKSHPLLKPFKLFSDKDTVETPWCVQEVHTACTVNCWVIRSCRVDEGELLVHSCSKNGNCRRLSHKQSSFESPHGFTPRPLDMTNVTLPRDLQNMSETLAENYHNTWASKKKMEIEAKAGGGTHPLLVPYDTLTAKEKSKDLEKAEELFKFLQINGYT----------------VSRGAKDMEMDA----------------------SSIEKRFAYGILQQLINYVESAHGYITQLDFAMTKRKEERASNKYPHEQE---IKFFAKVVLPLIDQYFQNHRQYFLSTPSSLLSSGGHASNKEKEMVTSLFCKLAVLVRHRISLFGRAGSDATAMVNCLHILAGSLDCRTVMKVGP---DSVKAALRAFFESAAEDLEKTMENLKQGRFTHSRSALKGVAQTINYTSVALLPLLCSLFDHIGQHQFGVDLILDDVQVSCYRILSSLFALGTGKNIYVERQ---------RPALGECLSALATAFPVAFLEPELNKFNPHSVFNTKTAR----ERAMMGLPVHVEDVCKDIPSLDKLLQEIGDLAESGARYTEMPHVIEVVLPMLCSYLSRWWEHGAEEDPRRALEEPV---CTATTSEHMNALLGNILKIIVNNLGISEAAWMKRIAVFAQPIIGKAKPELLRSHFLPTMEKLKRKTGKVVAEEDRVRAEAKGDMSEDELLVL---DEFAILARDLYAFYPLLVRFVDCGRAKWLMEPNADAEQLFFMVADVFVMWAKSPNFKREEQNFVVSNEINNMSFLISDTMSKMSK-----AGGDRERKKSKKRGERYTVQTSLIVAALKRMLPIGLNICAPGDQELISLAKNRFA------------------MKDTDDEVRDFIRNNLHLQGKMADSPTVRWQMSLYKELPHRR----EENGDPERSVTRLLEISSVLYHLEQVELPYKSKKAVWHKILSKQRRRAVVACFRMAPLYNLPRHRAINLFLSGYQRTWIETEEHSFEDRLIEDLALSG-----------------------GEEDGESEDGGKRR-----------DPLHQLILHFSHTALTEKSKLEEDFLYIAYADIMAKSCHAQEEDEEGEEE----VKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQMISASKGSTGPMVTATLKLGIAILNGGNTTVQQKMLDYLKEKKDVGFFQSVAGLMQSCSVLDLNAFERQNKAEGL---GMVTEEGSDINGQRTDKAMQDVEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRLQVSKISDFYWYYSGKD 3916          

HSP 3 Score: 338.961 bits (868), Expect = 9.883e-93
Identity = 171/331 (51.66%), Postives = 217/331 (65.56%), Query Frame = 2
Query: 6608 LSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            L Q+I GTL+ WA+ + + +  L+  MF+LL RQY+ +GE+  +L + Y IS  S +D   LL +L ++R LL V++G  EE L+   L DIMNNKVF+QHPNL R L +HETVM++MV+ L   K        S ++ F                                            +MV  CCRFLCYFCR S QNQ+ MFEHL Y+LENSS+ LA PS+RG+ PLDVA +S+MDNNELALA+RE +LEKV  YL+R G+QS   LL++GYPDIGW+PVEGER+LDFLRFTV+VNGE +EENAN+VVRLLIRRPEC GPALRG
Sbjct: 2064 LQQLISGTLVRWAQESHVADPALVTAMFTLLHRQYDGVGELVRALPRAYTISAASVEDTIALLAALTQIRSLLSVRMGREEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGK--------SKEIAF-------------------------------------------PKMVANCCRFLCYFCRISRQNQRAMFEHLGYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPELEKVGRYLARCGLQSCPMLLTRGYPDIGWNPVEGERYLDFLRFTVFVNGESVEENANVVVRLLIRRPECFGPALRG 2343          

HSP 4 Score: 317.005 bits (811), Expect = 5.164e-86
Identity = 208/640 (32.50%), Postives = 315/640 (49.22%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGA-QIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVIL-----SVLDCATFKSKPALRMPRVT--------------------------------------------RSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNF 6274
            YY+SV + PGQ+   +++GWVT  F    S         SFD         LD              V  VTI   ++   +  S+  S  +++   DV     ++++       G+ IGC +D A G L+F  N +E+   +QV P T L+PA FV+PT+     FELGR +NTLP+ A + +  RR + P    RL +Q ++   WSRV N   K+   +++E  GW +   E +  MA+ IPEE+RC+DILEL E   L +FH  TL+LY  +C  GN+ VA +L +H+D+ Q  + I+N YL G LR+ ++ LLI++HL++ S  +L T  E +VP+  + ++ R+T      + +  K               H +P    S S+ P +    V       +G    P   +        LK  ++  L+ AV +GA Q  +P+GGS E++FVPL+K+V  LL MG+  + D+  IL     SV  C            R +                                              +L M L+E VKLQ+CHLL  LCD QLRHRIE +V  S+ FV  +Q +Q  RY E+ Q+ ++ +++TA+ TKEFR PP++Q+  +LNF
Sbjct: 1405 YYYSVRIFPGQEQATVWVGWVTPDFHQYDS---------SFD---------LDR-------------VRTVTITLGDDKGKVHESIKRSNCFMVWAGDVPAAEQSRNN------SGLEIGCLVDVANGVLSFTANGKEMHTFYQVEPSTKLFPAAFVQPTSPGMFQFELGRFKNTLPLSAALFKSERRNSVPQCPPRLVVQQIKPVLWSRVPNLFLKVETGRVSERHGWKVQCTEPLVFMALRIPEENRCMDILELSERRDLRKFHAHTLKLYSAVCALGNNRVAHALCSHVDQAQLLFAIENQYLPGLLRSGYYQLLISLHLQACSTARLMTNREFIVPM--TDETRRIT-----LFPDESKR--------------HGLPGVGLSTSLRPRMRVSSVGFLSRSLDGAQFSPDFPLAV------LKEKAIGMLSEAVREGACQPRDPVGGSTEHLFVPLIKLVHTLLTMGVFGNEDVKRILMLVDPSVFACQGGGGGGGGGEDRASDRRAPLAIANGGRDERRRAEVAGEEGELAVQQQQRPQQQDEEPVEGLLQMKLEEPVKLQMCHLLQFLCDCQLRHRIEALVAFSDGFVIKMQENQKFRYNEVMQALNMSAALTARKTKEFRSPPQEQINTLLNF 1980          

HSP 5 Score: 100.908 bits (250), Expect = 9.982e-21
Identity = 60/205 (29.27%), Postives = 102/205 (49.76%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI-------DADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK------KADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVDTS I L   LE + ++ A+++H+ WA+  +E G+ YG  R+D  + HP L+ F  L + ++   ++   E LK ++A G  +       +A L R ++     R  +++  Y P+P DL    +      + ++LAENAHN+WA+ +            I    +  LVP+ +L ++ K   R    E ++ L   GY
Sbjct:  837 FTPVPVDTSQIALLPHLERVRNKLAENIHELWAMNKIEMGWTYGTVRDDNKRQHPCLVDFHKLPEQERNYNLQMSSETLKTLLALGCHVGIADEQAEATLKRFKLP----RNYLMSSNYKPSPLDLTNTKLNPTQEALVDRLAENAHNVWARDRIRQGWTYGIQQDIKNRRNPRLVPYALLDERTKKSNRDSLREAVRTLLGYGY 1037          

HSP 6 Score: 93.2041 bits (230), Expect = 2.267e-18
Identity = 60/230 (26.09%), Postives = 113/230 (49.13%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVAL------------GYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRS-PHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSN 3319
            F P+P++T+ I +P  ++   +K AE++H+ W+M+K  +GW+YG+  ++ +K+HP L  F +L  ++   +     + + T   +            G  + +     G+  +     +SF   +G+ P+PLD+ N++L   L+ +   LAEN HN WA  +  +      +E  A   + P LVPY+ +    K  + + + E  K L    Y++     D+ EM  S+
Sbjct: 2708 FKPQPIDTSSITIPEKLDFFINKYAEHVHDHWSMEKYAEGWSYGEVLNEESKSHPLLKPF-KLFSDKDTVETPWCVQEVHTACTVNCWVIRSCRVDEGELLVHSCSKNGNCRRLSHKQSSFESPHGFTPRPLDMTNVTLPRDLQNMSETLAENYHNTWASKKKME------IEAKAGGGTHPLLVPYDTLTAKEKSKDLEKAEELFKFLQINGYTVSRGAKDM-EMDASS 2929          

HSP 7 Score: 70.8626 bits (172), Expect = 1.281e-11
Identity = 29/109 (26.61%), Postives = 69/109 (63.30%), Query Frame = 2
Query: 9077 DFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDA----DLSRIEMHGERRR 9391
            ++KP P+D ++ +L  + E+L+D+ A++ H+ WA + + +G+ YG+ ++  N+ +P L+ + LL +  +    + + EA++ ++ +G+ I+A      +R+++HG  +R
Sbjct:  950 NYKPSPLDLTNTKLNPTQEALVDRLAENAHNVWARDRIRQGWTYGIQQDIKNRRNPRLVPYALLDERTKKSNRDSLREAVRTLLGYGYHIEAPDQDPATRVDVHGVHKR 1058          

HSP 8 Score: 64.3142 bits (155), Expect = 9.709e-10
Identity = 43/165 (26.06%), Postives = 76/165 (46.06%), Query Frame = 2
Query: 2738 LAENIHEMWAMQKIDQGW-TYGQ-NRDDLNKTHP----CLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPS---EGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDD 3205
            L  +    W    +  GW +YG  + ++L+ T            + P+ +  F + L          LG  I+  +P    E SR+  +   +S      ++PQP+D  +I++   L+  +N+ AE+ H+ W+M++  +GWSYG V N   K  P L P++   D
Sbjct: 2617 LTNHFERCWKYYCLASGWGSYGAASEEELHLTRKLFWGVFNALSKKPYEQELFKLALP--------CLG-AISGALPPDYMESSRMVAMDSQSSLDAEGNFKPQPIDTSSITIPEKLDFFINKYAEHVHDHWSMEKYAEGWSYGEVLNEESKSHPLLKPFKLFSD 2772          
BLAST of Ryanodine receptor related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007424.1 (pep scaffold:Pmarinus_7.0:GL479485:48975:92409:1 gene:ENSPMAG00000006697.1 transcript:ENSPMAT00000007424.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 8.988e-71
Identity = 167/426 (39.20%), Postives = 237/426 (55.63%), Query Frame = 2
Query: 11618 NLISRDTAHWMEVVIQKEN--DGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKI-GKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQAS---DDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKS---LQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLY---------DAEFTCKLFRFLQLLCEGHNLAFQDYLRS 12838
            N ++R       +V  +E   D ++ +Y++N +  + + DD    WQ  LYK + GKA+  D S+    +  + RV  +A VL+ L +V+HP    K  W KL+S QRKRAV+ACFRM PL++LPRHR +NLFL AY+  W+  EE     +LI+++ +S                                + + E   E     T PDPL QLI    RTA+ + S   + + +     IM KSC       +  G           ++E+EMEK ++  +Q+RL +RGAAEMVL  +   +GV + +V+ +++LGI++L GGN +VQ++ML +LK+KK   FF S++GLMQ CSVLDL+ FER NKAEGL   G+   +G  NLY         D  FTC LFRFLQLLCEGHN  FQDYLR+
Sbjct:   10 NEVARRDVEPCSLVCLREQLMDDEVRDYIRNNLHSQSKMDDPAIRWQISLYKDLPGKAE--DCSDP---DKTVDRVAEIAAVLYHLEMVEHPHRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAINLFLDAYKKHWIETEENAYEDKLIDDIAKSI------------------------------DDDEEEKESEDTEVETHPDPLHQLILYFSRTALTEKSKLEEKNPHRFMISIMRKSCQVTQRLRERAGAVPSQKNKYTHVKEKEMEKQKLQYQQSRLHERGAAEMVLQMLGASKGVKSPMVRSTLKLGIAVLNGGNCTVQNKMLDYLKDKKDSTFFQSVAGLMQICSVLDLNAFERQNKAEGL---GMVTEEGSVNLYLYKSDKVMQDDSFTCDLFRFLQLLCEGHNSDFQDYLRT 397          
BLAST of Ryanodine receptor related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006032.1 (pep scaffold:Pmarinus_7.0:GL479783:2772:29565:-1 gene:ENSPMAG00000005457.1 transcript:ENSPMAT00000006032.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.876 bits (590), Expect = 2.031e-67
Identity = 126/292 (43.15%), Postives = 182/292 (62.33%), Query Frame = 2
Query: 14630 TYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDME----------------------------EFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPS-------EASGSRGWLRKKMIAW-DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQL 15397
            T++ SL A+N YN ++ AL +AF INF+LLFY   ++ + + E+ +  D DD+                              + IL +S  YM    K L+  H+  ++  +I YYCLKVPLV+FKREKE++R LEF+G++ITEQP DD++K  WD LV++T SFP NYWDKF+K+KV  KY + Y  + +  LLG+++ +        A   +  L   +I + D +Y +WK GV+FTDN++LYL  Y + S++G++N FFFA HLLD+A+  KTLRTIL SVTHNGKQ+
Sbjct:   48 TFVNSL-ARNFYNLRMLALFVAFAINFILLFY---KEMAEELEEASGIDLDDLLGSAAGDDDDGGGDNGGGGGGDDDDDEGLSYFILEESTGYMAPSLKFLSIAHTVLSILCIIGYYCLKVPLVVFKREKELARNLEFDGLYITEQPDDDDIKGQWDGLVINTQSFPNNYWDKFIKRKVMEKYGDFYGRDRMSELLGLDKNTLDFSKEMSAPEEQESLLTIIINYIDFKYQLWKLGVVFTDNSWLYLTWYMIMSMLGHYNNFFFATHLLDIAMGVKTLRTILSSVTHNGKQV 335          
BLAST of Ryanodine receptor related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007822.1 (pep scaffold:Pmarinus_7.0:GL476823:160879:181935:-1 gene:ENSPMAG00000007060.1 transcript:ENSPMAT00000007822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 6.415e-16
Identity = 38/92 (41.30%), Postives = 61/92 (66.30%), Query Frame = 2
Query: 15683 GLIIDAFGELRDQLEQVKEDMESKCFICGIG--KEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP 15952
            G+IID F +LR + ++ +E +++ CFIC  G  ++ FD     FE+H++ EHN  NY+YF++ I  K  TEYTG E+YV ++ ++   D+FP
Sbjct:  305 GVIIDTFADLRSEKQKKEEVLKTTCFICAAGLERDKFDNKTVSFEEHIKVEHNMWNYLYFIVLIKVKDPTEYTGPESYVAQMIREENVDWFP 396          

HSP 2 Score: 52.7582 bits (125), Expect = 1.993e-6
Identity = 26/93 (27.96%), Postives = 54/93 (58.06%), Query Frame = 2
Query: 15242 DNAFLYLGLYFVTSLIG-NFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHN 15517
            D  FL+   Y +   +G   + FF++  L D+    +TL  +++SVT NG+ +VLT +L  +++YL++++ F F +  ++ + D +  +  H+
Sbjct:  107 DVEFLFHLSYLIICALGLVMHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGFLFLKDDFVMEVDRLPALTVHS 199          
BLAST of Ryanodine receptor related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007816.1 (pep scaffold:Pmarinus_7.0:GL476823:160879:205429:-1 gene:ENSPMAG00000007060.1 transcript:ENSPMAT00000007816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 2.510e-15
Identity = 38/92 (41.30%), Postives = 61/92 (66.30%), Query Frame = 2
Query: 15683 GLIIDAFGELRDQLEQVKEDMESKCFICGIG--KEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP 15952
            G+IID F +LR + ++ +E +++ CFIC  G  ++ FD     FE+H++ EHN  NY+YF++ I  K  TEYTG E+YV ++ ++   D+FP
Sbjct:  760 GVIIDTFADLRSEKQKKEEVLKTTCFICAAGLERDKFDNKTVSFEEHIKVEHNMWNYLYFIVLIKVKDPTEYTGPESYVAQMIREENVDWFP 851          

HSP 2 Score: 52.7582 bits (125), Expect = 2.642e-6
Identity = 27/102 (26.47%), Postives = 57/102 (55.88%), Query Frame = 2
Query: 15224 WGVIFTDNAFLYLGLYFVTSLIG-NFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLT 15526
            +  +  D  FL+   Y +   +G   + FF++  L D+    +TL  +++SVT NG+ +VLT +L  +++YL++++ F F +  ++ + D +  +  H+  T
Sbjct:  548 YQAMVMDVEFLFHLSYLIICALGLVMHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGFLFLKDDFVMEVDRLPALTVHSRGT 649          
BLAST of Ryanodine receptor related vs. Ensembl Nematostella
Match: EDO37876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK1])

HSP 1 Score: 133.65 bits (335), Expect = 2.013e-30
Identity = 86/262 (32.82%), Postives = 153/262 (58.40%), Query Frame = 2
Query: 15218 WKWGV--IFTDNAFLYLGLYFVTSLIG-NFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-------------GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDG-DPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP 15952
            +++GV  I TD   +    YF   ++G   + FF++  LLDV     TL  +++SVT NG+ ++LT +L  +I+Y+++++ F F +  ++ + D              VK+  C  ++ C V  L+ GLR GGGIGD +      +     R+++D+ FFF VI+I+L +I G+IID F +LR + +  +E +++ CFICG+ +  FD     F++H++ +HN  +Y+Y+++ +  K  TE+TG E+YV  + + +  D+FP
Sbjct: 2286 FQYGVRRILTDKELILHLTYFGFGVLGLTVHTFFYSVLLLDVIFREDTLLNVIRSVTRNGRSIILTGILALIIVYMFSIVGFLFLKDDFLIETDPPPALPSIGEGGESVKERACDTLIMCIVTTLNQGLRNGGGIGDVLRRRSSKEKMFAGRVVYDLMFFFIVIIIVLNLIFGVIIDTFADLRSEKQNKEEVLKNTCFICGLDRSAFDNKSVSFDEHIKSQHNMWHYLYYIVLLRVKDPTEFTGPESYVSHMTKDKNLDWFP 2547          

HSP 2 Score: 70.4774 bits (171), Expect = 2.385e-11
Identity = 70/273 (25.64%), Postives = 119/273 (43.59%), Query Frame = 2
Query:  401 YGHAVLLKHTMSNMFLSC-LSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQ----QSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDE--CLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIK-TKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSK--DDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWL 1189
            YG  + L H  SN FL+      +  +K A  V L    N E  W+ + P  K R+ G+ V +GD +IL  V++ + LH  A N E I     + V     QT W +    S     + I  + GGDV+RLFH ++   LT      +      +   +    ++ +++LW +E+++     GG   W    R +H+ +G YL+     +      R +   S   F++  +   +D  S +E        S  +    + V L+H+ +N W+
Sbjct:  115 YGSVMQLLHVKSNKFLTVNKRLPALREKNAMRVTLDPNGN-EGSWFYIVPFYKLRAAGDNVVVGDMVILNPVNAGQPLH--ASNQELIDNPGCKEVNCVNCQTSWKISLFLSYDENDEDI--LKGGDVVRLFHAEQEKFLTCDDFKKKSYIFLRTTARQTATSATSSKALWEVEVVQHDPCRGGAGHWNCLFRFKHLATGDYLAAEADDDNTKDATRHKLKGSDPVFHLVPAPHGNDIASIFELDPTTLTRSDSLVPRCSYVRLRHLCTNTWV 382          
BLAST of Ryanodine receptor related vs. Ensembl Nematostella
Match: EDO28592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T616])

HSP 1 Score: 129.798 bits (325), Expect = 9.793e-30
Identity = 86/274 (31.39%), Postives = 153/274 (55.84%), Query Frame = 2
Query: 15218 WKWGV--IFTDNAFLYLGLYFVTSLIG-NFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-------------------------GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDG-DPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP 15952
            +++GV  I TD   +    YF   ++G   + FF++  LLDV     TL  +++SVT NG+ ++LT +L  +I+Y+++++ F F +  ++ + D                          VK+  C  ++ C V  L+ GLR GGGIGD +      +     R+++D+ FFF VI+I+L +I G+IID F +LR + +  +E +++ CFICG+ +  FD     F++H++ +HN  +Y+Y+++ +  K  TE+TG E+YV  + + +  D+FP
Sbjct:  422 FQYGVRRILTDKELILHLTYFGFGVLGLTVHTFFYSVLLLDVIFREDTLLNVIRSVTRNGRSIILTGILALIIVYMFSIVGFLFLKDDFLIETDPPPALPSIGSPRGGVCASSGGEGGESVKERACDTLIMCIVTTLNQGLRNGGGIGDVLRRRSSKEKMFAGRVVYDLMFFFIVIIIVLNLIFGVIIDTFADLRSEKQNKEEVLKNTCFICGLDRSAFDNKSVSFDEHIKSQHNMWHYLYYIVLLRVKDPTEFTGPESYVSHMTKDKNLDWFP 695          
BLAST of Ryanodine receptor related vs. Ensembl Nematostella
Match: EDO45063 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTP5])

HSP 1 Score: 85.1149 bits (209), Expect = 7.433e-16
Identity = 46/129 (35.66%), Postives = 68/129 (52.71%), Query Frame = 2
Query: 3395 SGKWYYEVELLTCGFMRFGWVMVDFESGCE------IGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMG--YVPGFSFGPGQYAKLNFG 3757
            +GKW YE+ L + G M+ GW  +    GC+      +G  + S+A+D     KWN+ +  YG+    GDVIGC +DL + TI++S NG+ +       +AF N+    G  Y P  S   G+   LNFG
Sbjct:    4 AGKWMYEILLGSKGIMQLGWATL----GCKFTNEEGVGDTADSFAYDGHRVRKWNVSTAKYGEEWMAGDVIGCAIDLDEGTISYSRNGKHL------GVAFDNVRFGPGFAYFPAISLSYGESCHLNFG 122          
BLAST of Ryanodine receptor related vs. Ensembl Nematostella
Match: EDO32929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM6])

HSP 1 Score: 65.855 bits (159), Expect = 3.435e-10
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 3413 EVELLTCGFMRFGWVMVDFESGCEIGS----NSQSYAFDTESATKWNLESG-PYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPV 3844
            +V   + G+M+ GW    F +  + G     +S S+A+D     KW+  +  PYG+  + GD +G  +DL    ++FSLNG+    PMG   AF  ++ D G  P  S   GQ   ++ G   +   Y       EGY P  + +++PV
Sbjct:  110 KVLTFSGGYMQLGWADDGFSAAADTGQGCGDDSHSWAYDGTRTLKWHANAKEPYGRKWKEGDTVGIAVDLDQGEVSFSLNGD-WSSPMG--TAFTGITPDGGIYPCLSLIRGQRVSVHLGTPSNPFDY----NPPEGYLP--LRVTQPV 249          
BLAST of Ryanodine receptor related vs. Ensembl Nematostella
Match: EDO42570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S130])

HSP 1 Score: 59.3066 bits (142), Expect = 5.140e-8
Identity = 40/131 (30.53%), Postives = 58/131 (44.27%), Query Frame = 2
Query: 3404 WYYEVELLTCGFMRFGWVMVDF----ESGCEIGSNSQSYAFDTESATKWNLESGP--------YGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGN 3760
            WYYEV L + G M+ GW   +     E G  +G +  S AFD      W   SGP        YG   Q GDV+ C+   +   ++F LNG          +AF +++  + + P  S    Q+   NFG+
Sbjct:  961 WYYEVILKSNGIMQIGWQTEECRYGPERGVGVGDDKHSCAFDGARCKIW---SGPPSEQQNNDYGVEWQIGDVLSCLFSWEGD-VSFWLNGR------DHGVAFTSLNTSINWYPAVSLAMDQHCIFNFGS 1081          
BLAST of Ryanodine receptor related vs. Ensembl Medaka
Match: ryr1b (ryanodine receptor 1 [Source:NCBI gene;Acc:101160087])

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 806/1967 (40.98%), Postives = 1165/1967 (59.23%), Query Frame = 2
Query: 8081 TSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYS-STGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTII-------------NDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVE--QAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTG-EYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREE-PITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAM-EQASD-DSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXT----KSLQEQEMEKLQILAEQNRLSDRGAAEMVL--LEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITN-LYDAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRIS 13879
              K  +LR+RAIL+SLV +EDL GV+SL   +PA      +          +  M    +P+HKAS+VLFL+RVYGI + +  L +LE  FL DMRAA  LD  +   ++ ALALNRYL ++VLPLLTK +      E  A ++++ LHT YRLSR R+LTK QR+ + + L++L   L+P M+  LLR+L+ DVP L   + +PL+LLT  Y+RC  YY    G    G+ +EEE  L+ +LF GIF++LA   +D ELF  A+PCL AI  A+ PDY          + +  S + +                           AS   + +F P+PV+T+ I +P  L++ ++++A+H HD WA E ++  + YG   ++  KTHP L  +   S+ D+  Y  P+ E++KAM+AW WT++   +R E  GE  +                 + GYNP P D+ G+ +++E+  MAE+LAEN HN W + KK ++ +  GG H +LVP++ LT KEK+R R+   +LLK+LQ NGY               A T    +++   SI++                        RFAY  L KLL++++  Q  +    +  S R  ++ P  QE   IKFF K++LPLV +YF  H  YF+       G    + N+EK+M A +FCKL +L+R +++ L  D    V CL  L +++D                                            +KG  +    ++NY    LLPVL S+FDH+++   G D++V D+Q++CY+++ ++Y LGT  + + ++          RP LGEC+A +A   PVAFLE  LN+ N +S+    T  E +L     + EL  ++P L+ +++EI DL+ESG +YTE PHVIE+TLPM+C+YLP WW RGPEN       E+  +  T+VT++ +N +LG+++K++ NN+    A WM R+A   QPIV  A   ML  HF+P  EKLK  + +   EEE  + E KS  ++       +  +  +L R+++A YPLLI+YVD +   W+  P  D + LF +V E+F+ WSKS +FKREEQNFV  NEI+++S +  D    +KS+ S+  +     KK   R  + S  TSL VA +K++LPIGL+M    +QELI  AK R                     K+ D ++ E+L N + L+ + +D    WQ  LYK+    +  ++ ++   E ++KRV  ++ VL+ +   +HP    K  W KL+S QR+RAV+ACFRM PL+++P HR +N+FL AY+  WL  E      R+I++++++ ++ E  E                                        PDPL QLI    RTA+ E+  D D LY+SYA IM+KSC   ++D+  E EG+E      ++  E+EMEK ++L +Q+RL +RGAAEMVL  +  C   GV+   V  +++LGIS+L GGN+ VQ +ML +LK+KK +GFF+S+  LMQ C VLDL+ FER NKAEGL   G+   +G    + D EFTC LFRFLQLLCEGHN  FQ+YLR+Q G+TTT+NIIICTVDYLLRLQESI DFYW+Y+GKD ID  GK N  KA+ + KQ+F +LTEYIQGPC GNQ +LAHSRLWDA+ GFL +FAHM  KL++D  Q+ LL+E + LQK+M++MLLS+LE N+VNG I +QMVD LVESS+NVEMILKFFD+FL++KDI +S+AF  +  +  G IS K+F  AM+ QK Y+P EI++++ C +++ +  ++F EF DRF +PAKDIGFN+AVLLTNL EH+P+D RL+  + +A+ ++  F P+LGRIEI G S +IER+YFEI +++ +QWE PQ+++SKR F+  VVNEG + EK+E FVNFCEDTI+EM  +  IS
Sbjct: 2192 AGKGEALRIRAILRSLVPIEDLVGVISLPVQIPAYGKGQII----------EPKMSASFVPDHKASMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAAASLDTVAFSTTEMALALNRYLCSAVLPLLTKCAPLFAGTEHRAIMIDSMLHTIYRLSRGRALTKAQRDVIEECLMSLCY-LRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWANFGVTSEEELHLSRKLFWGIFESLAHKKFDAELFKIAMPCLCAIAGAIPPDY----------VDATYSSNTEKK-------------------------ASVDAEGNFDPKPVETTTI-IPERLDAFINKYAEHTHDRWAFEKIQNNWTYGEVLDENGKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWTLEK--AR-EGEGEVEKKATSQKISQTAQATYDPSHGYNPQPIDITGMALSRELQSMAEQLAENYHNTWGRKKKLELQA-KGGTHPLLVPYDTLTAKEKARDREKAQDLLKFLQLNGY---------------AVTGLKDMEQDISSIEK------------------------RFAYGFLQKLLKWMDIAQEFIAHLAVVSSGRVEKS-PHEQE---IKFFAKILLPLVNQYFKNHCLYFLSTPAKVLGSGGHSSNKEKEMIA-IFCKLAALVRHRVS-LFTDAGAVVNCLHILSRSLDA-------------------------------------------VKGVSQ----NINYTTNALLPVLTSLFDHIAQHQFGDDVMVDDLQISCYRLMCSIYSLGTVKTPHVEQ----------RPALGECLAHLAAAMPVAFLEPALNEFNAFSVYTTKTPRERTLGIPNQVEELCPDIPELEVLIKEIHDLSESGARYTEMPHVIEITLPMMCNYLPRWWERGPENF-----PEQEGQLCTSVTSEHLNQLLGSIMKIVVNNLGIDEASWMKRLAF-AQPIVSRAKPEMLKSHFIPTMEKLKKRSSKVVAEEEHLRMEGKSEVDSENGT---IRDEFAVLCRDLYALYPLLIRYVD-NNARWLTCPDPDAEELFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTAD----SKSKMSKGGSEQERSKK-KKRGDRYSVQTSLIVAALKKMLPIGLNMCSPADQELINVAKIRYS------------------LKDTDEEVREFLHNNLHLQGKVEDPAMRWQMSLYKE----RSGNTEDAEDPEKVVKRVQEVSAVLYHIEQTEHPYKSKKMVWHKLLSKQRRRAVVACFRMTPLYNIP-HRAINMFLDAYKRNWLENEGYSFEDRMIDDLSKALEEEEEEEEET----------------------------------ERKPDPLHQLILHFSRTALTEKKLDVDHLYMSYADIMAKSCHIGEEDEGGEQEGEEPAFEVRQTEMEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKEPGVM---VSSTLKLGISILNGGNSDVQQKMLEYLKDKKDVGFFLSVQALMQTC-VLDLNAFERQNKAEGL---GMVSEEGSEKVMADDEFTCDLFRFLQLLCEGHN-NFQNYLRTQTGSTTTINIIICTVDYLLRLQESISDFYWYYSGKDIIDGPGKRNFSKAMTVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLE-NIVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFSKAMDSQKQYSPSEIQFLLSCSEADENEMINFEEFADRFQEPAKDIGFNIAVLLTNLSEHVPHDTRLQNFLEQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEANRNQWEMPQVRESKRQFIFDVVNEGCESEKMEMFVNFCEDTIFEMNIAASIS 3924          

HSP 2 Score: 804.668 bits (2077), Expect = 0.000e+0
Identity = 457/1076 (42.47%), Postives = 673/1076 (62.55%), Query Frame = 2
Query:  851 YEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEE--GIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKAL-LRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQN---RDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNAL-KRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMG-YVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSV---PTLKLISKIFGVQ--KSEMEFLRLGLPIKCKDHF 4033
            YE GAV S ARSLWRLE ++  WSG  + WG   R+RH+T+GRYL +      +  V   +A    +AF  R SK+ K    ++ + + MG  +IK+GE+  F+QHVS+  WL+Y A    K     + +++ ++  EGHMDD  TV++ Q EES++A  I     +F +FI+ LD    + +      + L  VI  L+DLI +F  P  + EHE KQ KL +LRNRQ+LFQEE  G+I ++L  ID+    +     F +  GE+  E + ++ N LY LL+ +IRGNR+NCA F     +DW+  +L+  + A  +L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VL SLC+   G AVR NQ LI +NLLP RDLLLQT +V+  ++VRPN+F+G  E S  Y+KWYYE+ +D +E     +A  LRVGW+  EG+ P+PGG +GWG   VGDDL+S+GFDG +LW+   P+++ +      L   D++ C LDL+VP I F IN  PV+G F +FN+DG+F+P +S SA V  R + GG HG  ++ PP GY+  +EA+LP+ER+R+EP   + +  + +    G + +  +  F P PV+T +I LP ++E IR+KLAENIHE+WA+ +I+QGWTYGQ    RDD  K HPCL  F+ LP  ER +++ ++ ETL T++ALG  +          LK IKLP  ++ SNGY+P PLDL ++ L+ +   LV +LAEN HN+WA DR++QGW+Y  V+ + + KR+P LVPY  +D+  KK+NR +    V+TL+ Y Y+IE PP       + N       +G   +R FRA+ ++ VT GKWY+E E +T G MR GW      S  E+G++  +Y F+   A +W++ + P+G+    GDV+GCM+DL D  I F+LNGE+++   G E+AFK++  ++G ++P  + G  Q  ++N G +V +L+YF  CGLQEG+ PF +NM R + +W+S+  P  FV +  +++ +EV    G+V   P LKL  K FG Q   ++M FLRL +P++  + F
Sbjct:   20 YEGGAVCSQARSLWRLEPLRI-WSGSHMKWGQSFRIRHITTGRYLCLDEEKG-LMVVDPEKANTKLSAFCFRASKE-KVDVAQKRDVEGMGIPEIKYGESMCFVQHVSTGLWLTYAA-LDAKAARLGMMKRRVILHQEGHMDDALTVSRSQTEESQAARMIYSTMGLFRQFIRGLDSLSGKSKSLGTVSLPLAGVILSLQDLIFYFRPPEEELEHEEKQTKLRSLRNRQNLFQEEFQGMITIVLECIDRLN-VYNTAAHFSEFAGEEAAESWKEIVNLLYELLS-LIRGNRSNCALFC--DNLDWLVSKLDRLE-ASSILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLRSLCVC-NGVAVRSNQNLITENLLPGRDLLLQTNIVNY-ATVRPNIFLGTCEGSTQYKKWYYEMMVDYVEPFMTAQATHLRVGWAMTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWST-VPRQVASP-NAHTLAADDVVSCCLDLSVPSISFRINGHPVQGMFENFNVDGLFFPVISFSAGVRARFLLGGRHGEFKFMPPPGYAPCYEAVLPRERMRIEPIKEYKHDFEGVRNLLGPTLSLTHTSFTPCPVDTVQIVLPPHLERIREKLAENIHELWAITRIEQGWTYGQVLQFRDDNKKLHPCLVDFQNLPEPERNYNLQMSGETL-TLLALGCHVGMGDEKAEENLKKIKLPK-YVMSNGYKPAPLDLNHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQQDIVNKRNPRLVPYNLLDERTKKTNRDSVNNAVRTLIGYGYNIE-PPDQEGGHGLENI------RGDK-VRIFRAEKSYAVTQGKWYFEFEAVTTGEMRVGWARPSVRSDTELGADELAYVFNGNKAQRWHIGNEPFGRQWLSGDVVGCMIDLIDMNIMFTLNGEMLISDSGSEMAFKDI--EIGEFIPVCALGLSQVGRINLGQNVSSLRYFAICGLQEGFEPFAINMKRDITMWFSKGLP-QFVPVPTDHNHIEVSRVDGTVDSAPCLKLTHKTFGSQNANTDMMFLRLSMPVQFHETF 1069          

HSP 3 Score: 500.36 bits (1287), Expect = 9.535e-141
Identity = 269/490 (54.90%), Postives = 348/490 (71.02%), Query Frame = 2
Query: 14597 NPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEE----------------FIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRK--------KMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            N  E+++I    Y+    ++N YN +  AL +AF +NF+LLFY+ E     +   +      + E                 +  L +S  YM      L+  H+  +   +I Y CLKVPLV+FKREKE++R LEF+G+++TEQP DD++K  WD+LVL+T +FP NYWDKFVK+KV +KY + Y    I  LLGM+  S    +    +K         + + DI+Y IWK+GV+FTDN FLYL  Y V S++G++N FF+ACHLLD+A+  KTLRTIL SVTHNGKQLV+TV L +V++YLYTV+AFNFFRKFY K  D    DMKC +M+TC++FH++ G+RAGGGIGDEIE P GD YE YR++FDITFFFFVIVILLAIIQ LIIDAFGELRDQ EQV+EDME+KCFICGIG +YFD  PHGFE H  +EHN ANY +FLM++INK +TE+TGQE+YVW++YQ+RCWDFFP GDCFRKQYE++L
Sbjct: 4194 NELEVQRIKFMNYL----SRNFYNLRFLALFIAFALNFILLFYKFEGSGLFEGSGLFEGSGAEEEGSGLEEGGEDEDEEGPLYYFLEESTGYMEPALAFLSISHTIISFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYVTEQPEDDDIKGQWDRLVLNT-TFPNNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLDVSAMTHGKKPEPDTSMFSITSIDIKYQIWKFGVVFTDNTFLYLVWYMVMSVLGHYNNFFYACHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQ-LIIDAFGELRDQQEQVREDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANY-FFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQL 4676          

HSP 4 Score: 354.755 bits (909), Expect = 9.859e-97
Identity = 216/561 (38.50%), Postives = 308/561 (54.90%), Query Frame = 2
Query: 6014 SILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTT 7693
             +L M L ESVKLQ+C LL   CD +LRHR+E IV  S++FV  ++++Q  RY ++ ++  + ++ TA+ T+EFR PP+DQ+  + NF      C E++D      EE++  +  FH                 N++L  C   +       +   +     G  +   L + +    R+  E  +      + +    L ++I  T+I WA+ +FI+N +L+R MFSLL RQY+ +GE+  +L K Y I+  S  D   LL  LG++R LL VQ+G  EE L+   + +IMNNKVF+QHPNL R L +HETVM++MV+      +G   +   I+                                               +MV  CCRFLCYFCR S +NQ+ MF+HLSY+L+NS + L    + G+ PLDVA +S +DNNELALA++E+ LE V  YL+  G+Q+   LLSKGYPDIGW+P  GE++LDFLRF V+VN E +EENAN+VVRLLIRRPEC GPALRG        +    A E  +  S   A +G T
Sbjct: 1711 GLLQMKLPESVKLQMCTLLQYFCDCELRHRVETIVAYSDNFVQGVKSNQRVRYNQLMRAFTMSAAETARKTREFRSPPQDQVLLLTNFK----NCPEDED--CPVPEEIRDTLTGFH-----------------NDILLHCIHIEEEVVEEEVDTSL----RGRLLS--LVDKVKSLRRKKEEGEEEEKPEVEEEPKLTLQELISHTMIHWAQESFIQNPELVRLMFSLLHRQYDGIGELIRALPKAYAINAVSVQDTMDLLECLGQIRSLLIVQMGPEEERLMIQSI-NIMNNKVFYQHPNLMRALGMHETVMEVMVNV-----LGGGGDSKVIRF---------------------------------------------PQMVTNCCRFLCYFCRISRRNQRAMFDHLSYLLQNSGIGL----MSGSTPLDVAAASCIDNNELALALQEQDLEMVVTYLAGCGLQTCPMLLSKGYPDIGWNPCGGEKYLDFLRFAVFVN-ESVEENANVVVRLLIRRPECFGPALRGEG-----GNGLLAAMEEAIKISEDPARDGPT 2181          

HSP 5 Score: 244.973 bits (624), Expect = 1.291e-63
Identity = 161/493 (32.66%), Postives = 249/493 (50.51%), Query Frame = 2
Query: 4511 YYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFG---NQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIV-EPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATF 5974
            YY+SV +  GQ+   ++IGWVT  F            +Q+FD    +  +     T GD +  N  D+ H                  S  Y++   D+++N     +Q+DM         +GC +D ATG +TF  N +E+   +QV P T L+PA+F++PT +  A  ELG+ +N +P+ A M R  R+   P    RL +QML    WSR+ N      + K++E  GW +   E + MMA+HIPEE+ C+DILEL E   L++FH  TL LY  +C  GN+ VA +L +H+DE+Q FY I+N +L G LR+ ++DLLI++HLES  R +L T  E ++P+     S ++       Y + +K+              H +P    +  + P L    +       +   + P   +  E     LK  ++  L  AV  G+Q + +P+GGS E  FVP+LK++  LL+MG+    D   IL ++D   F
Sbjct: 1185 YYYSVRIFAGQEPSAVWIGWVTPDFH---------QYDQNFDLSKVRNVTL----TVGDDR-GNIHDMKH------------------SNCYMVWGGDLVSNQQTRFSQEDM--------VVGCLVDLATGLMTFTANGKEINTFYQVEPNTKLFPAVFIQPTNQNMAQLELGKLKNIMPISAAMFRSERKNPVPQCPPRLDVQMLTPVIWSRMPNHFLNPEVGKISERLGWMVECTEPLIMMALHIPEEN-CIDILELSERQDLMKFHYHTLMLYCAVCALGNNRVAHALCSHVDESQLFYAIENTFLPGPLRSGYYDLLISIHLESAKRARLGTNREFIIPMTEETLSIKL-------YPDTKKS--------------HSLPGVGLTTCLRPKLHFSSINFVGTDPDLYTLSPTFPLQQE-----LKTRAISMLTEAVMDGSQAMRDPVGGSVEFHFVPILKLISTLLMMGIFNDEDTMHILKMIDPNVF 1610          

HSP 6 Score: 109.383 bits (272), Expect = 1.246e-22
Identity = 66/228 (28.95%), Postives = 116/228 (50.88%), Query Frame = 2
Query: 2627 SIYAGNSETKENV----VFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEG-------SRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI 3277
            + Y+ N+E K +V     F P+PVET  I +P  ++   +K AE+ H+ WA +KI   WTYG+  D+  KTHP L  ++     +++       E+++ ++A  +T+      EG       S+  +     ++  S+GY PQP+D+  ++LS  L+++  QLAEN HN W   +  +  + G          P LVPY+ +    K  +R+ + + +K L    Y++
Sbjct: 2462 ATYSSNTEKKASVDAEGNFDPKPVETTTI-IPERLDAFINKYAEHTHDRWAFEKIQNNWTYGEVLDENGKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWTLEKAREGEGEVEKKATSQKISQTAQATYDPSHGYNPQPIDITGMALSRELQSMAEQLAENYHNTWGRKKKLELQAKGGTH-------PLLVPYDTLTAKEKARDREKAQDLLKFLQLNGYAV 2681          

HSP 7 Score: 97.8265 bits (242), Expect = 3.848e-19
Identity = 63/210 (30.00%), Postives = 105/210 (50.00%), Query Frame = 2
Query: 9062 SSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMT---RNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRR--PTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKAD-------MDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            S T   F P PVDT  I LP  LE + ++ A+++H+ WA+  +E+G+ YG     R+D  K HP L+ F  L + ++   ++   E L  ++A G  +     + E + ++ +    ++++GY P P DL  V +T     + EKLAEN HN+WA+ +             I    +  LVP+ +L ++ K   R   N  ++ L   GY
Sbjct:  612 SLTHTSFTPCPVDTVQIVLPPHLERIREKLAENIHELWAITRIEQGWTYGQVLQFRDDNKKLHPCLVDFQNLPEPERNYNLQMSGETL-TLLALGCHVGMGDEKAEENLKKIKLPKYVMSNGYKPAPLDLNHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQQDIVNKRNPRLVPYNLLDERTKKTNRDSVNNAVRTLIGYGY 820          

HSP 8 Score: 65.0846 bits (157), Expect = 3.248e-9
Identity = 56/226 (24.78%), Postives = 105/226 (46.46%), Query Frame = 2
Query: 2735 KLAENIHE-MWAMQKIDQGWT-YG-QNRDDLNKTHPCL-TTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSG 3400
            KL  N +E  W    +  GW  +G  + ++L+ +       FE L H  ++FD  L    +  + A+   I  +         T K  +   + N + P+P++   I +   L+  +N+ AE+TH+ WA ++I+  W+YG V +   K  P L PY+   +  K+  R    E++K +LA+ +++E       E         +++K +S   +  AQ+T+  + G
Sbjct: 2387 KLLTNHYERCWKYYCLPNGWANFGVTSEEELHLSRKLFWGIFESLAH--KKFDAELFKIAMPCLCAIAGAIPPDYVDATYSSNTEKKASVDAEGN-FDPKPVETTTI-IPERLDAFINKYAEHTHDRWAFEKIQNNWTYGEVLDENGKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWTLEKAREGEGE---------VEKKATSQKISQTAQATYDPSHG 2599          
BLAST of Ryanodine receptor related vs. Ensembl Medaka
Match: ryr2b (ryanodine receptor 2 [Source:NCBI gene;Acc:101164337])

HSP 1 Score: 1209.51 bits (3128), Expect = 0.000e+0
Identity = 789/2075 (38.02%), Postives = 1140/2075 (54.94%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGL----LPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGM-PGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID----ADLSRIE--MHGERRRPTIINDG---YNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQA------IVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFS--HLKGTVERG-AVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKY--TEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIA-MRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCSXXXXXXXXXXXXXXXTKSLQEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLY-DAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEG 13894
            GG GLL AMKE I++S         Q+V           QK+L                    H +  +DD D + +G AI+TFYS L+DLLGRCAPE       K  ++RVRAIL+SL+ ++D+EGV+S+   LP      +V++DG         M P L     P HKA++VLFL+RVYGI+     +RLLE  FL D++AA  LD    G +D ALALNRYL  SVLPLLTK S  L + E    +++  +   YRLS   SLTK QRE   D L+AL  +LQ  ++  LLR+L+ D   LT  S + L+LL + Y +   YYS  G    Q +A+EEE  L+  LF G+F  LAK PY+P+L+     CL  +  AL PD+     + S+ +S                           Q++ ++ M    TD  F PQPV+TS++ +P  LE +++++A+H H+ W+LE    G+V+G    +  K HP L  +  L + ++  Y   + E +K+M+A+GWTI+     D   I+    G  +   +  +G   ++P P D+  V ++ +   MAE+LAEN HN WAQ KK ++DS GGG H  LVP++ LT KE++++R+   ++LK+   NGY                 T R                  + + TA  ++  T++    FA  LL +LL + ++A      +V   Q+   S  S   P            +VV+P++E+Y  +H  YF+       G +S A  +EK+M A LFCK+   +RQ+++ +G + +    CL  L QA+D R ++K   + ++ ++  L  FF   A DL + ++ L+    S    +G + RG A +L+Y   +LLP L S+F H++  N G D L G    + Y +    + +                     P+ G C+AA+   FPV FLE  LN+NN +SI YN   +        + ++   LP+L+  +E++ +LA +G     T   HV E+TLPMLCSY+  WW   P+ + +       S   T+V  +  +++LG++L++  N++ + H  WM ++A +       +A + +L  HFLP+ EKL+  A    +EEE    + K+ S   +E E  + ++  +LVR+++AFYPLLI++VD   + W+K+P  + + LF++VAE+F+ W+KS HFK EEQN+V QNEI++L+ ++                ND   K+   +  + S++TSL V  +K+L+P+GL      +Q LI  AK       N  S+  + + E + Q     D +                               K VD            R+L +A+VL+ L  V+HP    K + +K++S QRKRAV+A  RM PL++ PRHR VNLFL  Y  +W+S  +     ++ EV   +                      +GK  ++  EG               D L QLIT   R+A+               M   C                    QE+EM+K ++L +Q RL  RGA+EMVL  I    G + +++  +++LGI+LL GGN +VQ +ML +L+EK+ + FF S+SGLM+ CSVLD + FER  KAEGL   GL   +    +  D + TC LFRFLQLLCEGHN  FQDYLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD +D  G+LN  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL IFAH+Q KLS+D  Q ELL+E M LQK+M++ LLSMLEGNV+NG IGKQMVD LVESS NVEMIL FF++FL++KD+TSSE F  +D +  G IS K+F   ME    ++  EI +++ C+++N    VD+ +F DRFH+PAKDIGF++ VLLTNL EHMP D RL+  +  A+ ++  F+P LGRIEI G   R ER+YFEI      QWEKPQ+K+SKR F+  VVNEGG+ EK+E FVNFCEDTI+EMQ + +ISG   G
Sbjct: 2239 GGNGLLAAMKEAIMIS---------QDVSMDGPYPSQESQKSL--------------------HAVQDKDD-DRIQMGHAIMTFYSALIDLLGRCAPETHLIQEGKGEAIRVRAILRSLIPIQDIEGVVSIPLQLP------SVSKDG-------LLMEPDLSIVFCPCHKAAMVLFLDRVYGIESQSLLIRLLEVGFLPDIQAAVSLDTVELGSTDMALALNRYLCGSVLPLLTKFSALLHDLEDHILLVDCLIQGVYRLSGAFSLTKAQRETAQDCLLALCSKLQASVMQPLLRRLVFDALHLTDHSTMALKLLISHYMQRSSYYSQAGRRSDQSLASEEELHLSRTLFWGVFKALAKKPYNPQLYELCAQCLVTVAKALPPDH-----VESVCLS---------------------------QMERKSFM---DTDGHFDPQPVETSNMSVPERLEFVVNKYAEHTHEKWSLEKFANGWVHGEQLCEDTKVHPLLKPYRALVEKEKEAYRWAIKETIKSMLAFGWTIERTKEGDTFDIQACTRGVSQSGQLSFEGASTFSPKPLDMSSVTLSWDHCAMAEQLAENYHNAWAQAKKLELDSKGGGGHPKLVPYDTLTTKERTKFRERAQDILKFFLLNGY-----------------TVR------------------RDRKTAETDFPATAN---CFALTLLQRLLTHTDEAQDTMLKLVVAIQVNLQSYNSCATP-----------PQVVIPVLEQYVKSHHLYFISTCLGSSGNRSSATKKEKEMIACLFCKVAVFVRQRISHIGDEASAVASCLCVLSQALDARTLMK---SVQESIQTSLHLFFEAAAADLEMTVEKLSETSVSIPQSRGQLARGVAQALHYTTFILLPTLTSLFHHLANQNFGVDFL-GKSYFSAYFVKLLFFCV---------------------PVAGACLAALTGAFPVCFLEPSLNQNNPFSI-YNTMNQ--------VEDVCPLLPSLEEALEQVKELACAGAAAHQTHYIHVAEITLPMLCSYISHWWCWEPKELPD-------SPLFTSVGPQHASDLLGHMLRIFYNHVGASHCHWMKQLAGIVINKTDRSAPVELLKSHFLPLMEKLRKRAEGILREEE----QMKAESSCTSEGELLMQEKYTLLVRDLYAFYPLLIQFVD---SRWLKEPIPEAEQLFSMVAEVFIFWAKSHHFKWEEQNYVVQNEINNLASLI---------------KNDKALKRMKRKGDRYSAHTSLIVTSMKKLVPVGLKGCFQSDQSLITLAK-------NGFSQQESLYAEQLTQHSAVNDAQ-------------------------------KIVD------------RILEIARVLYYLDQVEHPERRKKLTRQKVLSRQRKRAVVASLRMTPLYNQPRHRAVNLFLFGYTKLWISTGDHKYEEMLIEVLAVSD---------------------RGK-IKDREEGARPI-----------DSLLQLITLFSRSAL---------------MDSRCMCCLS---------------QEKEMKKQKLLYQQARLHCRGASEMVLQSISASNGSMGSMIASTLKLGIALLNGGNAAVQQKMLKYLREKQDVCFFQSMSGLMRSCSVLDPNAFERQKKAEGL---GLTMAESSGKVMPDKDLTCDLFRFLQLLCEGHNADFQDYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVVDAEGQLNFSKAIEVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHIFAHLQMKLSQDSSQNELLKELMDLQKDMVVFLLSMLEGNVINGTIGKQMVDMLVESSGNVEMILNFFNMFLKLKDLTSSELFREYDPDCKGNISKKDFHKVMEYCNHFSQAEIHFLLSCMETNESEIVDYADFVDRFHEPAKDIGFSITVLLTNLSEHMPKDPRLKTFLEMAECVLTYFQPCLGRIEILGSGKRFERIYFEISDYSRTQWEKPQVKESKRQFIFDVVNEGGEMEKMEMFVNFCEDTIFEMQLAAQISGSNAG 4007          

HSP 2 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 545/1303 (41.83%), Postives = 766/1303 (58.79%), Query Frame = 2
Query:  200 RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNA-IGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVI--ASFQQTLWTVIPV-SSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGF--TVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKE---------NVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFD---TESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTG----SVPTLKLISKIFGVQK--SEMEFLRLGLPIKC 4021
            + CL+A GFGSR C LE +S  +N PPDLS+C F+L + LSVRALQE++A+     A +GG   H+TLLYG AVL KH+ S M+LSCLS+S S  DKLAFDVGLQ++   EACWWTVHP+++QRSEGEKVR+GDDLILVSV+SERYL         I++S+I  A+F QTLW+V P+ + GA+ Q   G + GG+ LRL H   D CLTVP++      Q   + YE G+VS++ARSLWRLE+++  WSG    WG   RL HVT+GRYL  +     +  V R +A  ++++F  R             + D MG  +IK+G++  ++QHV S  WL+Y+A                        DD     +     EE+ +A  IR    +F  FI+ LD    +    S+S +++  +   L+DLI++F  P      E KQ  L   + RQ++FQEEG+++L+L  ID     +     F++A  E    W + + N  Y LLAAMIRGNR NCA F+    MDW+F RL+  +++ G L+VLHC+L +S EAL  I   HI  +I  LDK GR  +VL+VLCSLC+   G AVR NQ LI D+LLPDRDLLLQTRL +  +S+RPN+FI   E S+ +++WY+E+ +D +   +T     LRVGW+  +G+ P P G +G+G   VGDDL S+GFDG +LW+G   +R+ +     +L   D++ C LDLTVP I F +N  PV+G   +F  +G+ YP VS SA V    +FGG HG  R+ PP GY++  EALLPK +L++EPC      +K +     E K+          V F P PV+ +++ LP  +E+IR KLAENIHE+W   KID GWTYG  RD+  +  PCL  F +LP  E+  ++  A +TLRT++ALG+ I        +R K  +L   +    GYRP P+D   + LSS  E +VN LAEN HN+WA +RIKQGW+YG  ++   K+SP LVPY  +D+  K++ R+   + V TLLA+ Y+  + P   S               +   R FR   ++ VT+GKWY+E E+ T G MR GW   D     E+GS+ Q++ FD      A  W     P+ +    GDV+ C+LD+ ++++  +LNGEL+ +  G E+A K+   + G++P  S G  Q  KLN G+ V +LKYF  CGLQEGY PF  NM+R  PLW S +   +F  I   +  ++V L  G     + +L++  ++       S M F RL LP++C
Sbjct:    1 KLCLAAEGFGSRLCKLEPVSNCKNVPPDLSVCGFVLARCLSVRALQEMLAQSEQAAAEVGG--SHRTLLYGQAVLFKHSYSGMYLSCLSSSQSSTDKLAFDVGLQQDKTGEACWWTVHPSSRQRSEGEKVRVGDDLILVSVASERYL-----VSRGIKESLIVNAAFHQTLWSVAPICAGGAVAQ---GYLKGGETLRLLHSHSDACLTVPYTEQGEELQ-RIIQYETGSVSTYARSLWRLEILRVAWSGRHTCWGQPFRLCHVTTGRYLGFTEEKG-LHLVDRDKANINTSSFCFRT------------DADGMGHPEIKYGDSVCYVQHVYSGLWLTYQA------------------------DDKHQSNIRPFGREEAHTARLIRSSLLLFNWFIRKLDGSHQDGNLPSIS-ISMPLMTSSLQDLINYFQSPCDALNQEDKQNYLNVQKKRQNMFQEEGVMDLVLECIDNLH-QYSSASHFVEAASEGGGGW-EVVLNCFYELLAAMIRGNRVNCAHFS--GSMDWLFSRLDRLEASSGALEVLHCILVESPEALKAIKKGHIESIISFLDKHGRINKVLEVLCSLCVC-HGVAVRSNQNLICDSLLPDRDLLLQTRLANQVTSMRPNIFIDPGEASSQHRRWYFELVVDHVNTFLTFEPTHLRVGWACTKGYQPRPRGGEGFGGNGVGDDLCSYGFDGLHLWSGCVGRRVSSRFPH-LLRDNDVVSCCLDLTVPCISFRVNGLPVQGMLENFVANGLLYPVVSISAGVRACFLFGGRHGEFRFLPPPGYASCSEALLPKVKLKVEPC------QKHVVECEKERKKLFGPLVPVTPVTFSPTPVDISKVVLPPQLEDIRQKLAENIHELWVKDKIDLGWTYGPMRDESKRHDPCLVEFSKLPEQEKSQNLQTAQDTLRTLLALGFHIGLTNDKAEARAKYTRLHTKYELLGGYRPAPIDFSKVFLSSADEEVVNLLAENDHNVWARERIKQGWTYGVQQDVKAKQSPQLVPYSLLDERTKRTVREGVRDAVCTLLAFGYTTLSQPCHFS---------------TEKCRVFRPDKSYAVTTGKWYFEFEVETDGTMRVGWARPDCTPDKELGSDDQAFVFDGFEGGEALGW-----PWIR----GDVVACLLDMGERSMMVTLNGELLFNQRGSELAAKDFEINDGFLPIVSVGVNQVGKLNLGHQVDSLKYFKACGLQEGYKPFAFNMARDPPLWMSWKQS-MFTSIHDSDQNIQVSLFIGGSTDGLSSLRVSRRLLAHHSAGSRMGFYRLSLPVEC 1217          

HSP 3 Score: 583.178 bits (1502), Expect = 7.368e-166
Identity = 376/1053 (35.71%), Postives = 560/1053 (53.18%), Query Frame = 2
Query: 4508 QYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNL-ISDDVTLKMLGENGED-IFPKLDMCPEINYERLKNISLKELANAVNK-GAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPR----------------VTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNAL-GEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            +YY++V VLPGQD   +++GWVTS F                    H  ++T D  +           V  VT+   ++   ++ SV  S  Y++   +      +      + S G+ IGC +D +TG LTF  N  E+   +QV   T L+PA+FVKPT      FELG  +N +P+ +G+LR  RR  TP    R+ +Q L+   W+RV +   K+ + +  E  GW +   E  Q M + IP+EDRC+D+LEL E   L  FH  T+ LY ++C +GN  V  +L +H+D++Q  Y IQN YL G+LR  ++ LLI ++L SH+  +L   +E +VP+   +                +++    +    IDF+   IP+   S S+ P +  S    ++  G   E  +       PEI  + LK+++L+ +   V+  G  + +P GG+ E + VPLLK++ HLL++G+    D+  IL +++   F S  A R  R                + + +L + L ESVKL+LCHLL  +CD Q+R  +E ++  S  FV  +Q +Q  RY +I Q+ ++ +++TA+ T+EFR PP++Q+  +L F        +E  +   C  E +  +  FH +L  +CG    +    +E  +      + R L ++    G                   + +P E+     E  +    K+L+++I  T+I WA+ + IE  +L+R MF+LL RQY  L G+++  L K Y+IS  S  D   LL SL  +R LLG+++G+ EE L+   L +IMNNKVF+QHPNL R L +HETVM++MV+ +                                               +E+ EV   K      MV  CCRFLCYFCR S  NQ  MF+HLSY+L+NSS+ LA PS+RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+ S +QS   L++KGY DIGW+PV+GER+LDFLRF V+ NGE +EENA  V+RLLIRRPEC GPALRG
Sbjct: 1320 RYYYTVRVLPGQDPFNVWVGWVTSDF--------------------HHYETTFDTNS-----------VHTVTVTLGDDSGKVQESVKRSSCYMVCAGEATGLSQS------RRSTGLEIGCLIDSSTGLLTFTSNGVEMSTFYQVEAQTKLFPAVFVKPTTSNMFQFELGCVKNAMPLSSGLLRSQRRNPTPQCPPRIHVQHLRPVSWTRVPDKALKVLVDQPAEHHGWRIQAFEPQQYMGLQIPDEDRCIDVLELSECRDLQTFHHNTILLYCSLCSHGNSRVCHALCSHIDQSQILYAIQNPYLAGQLRDAYYQLLIQIYLSSHTTERLMMNDEYIVPMTGQI----------------RESPSHCALDGGIDFEGAGIPNNDHSTSLKPQIHCSCPCFVRERGMKDESAVVLGCTDSPEIPLDMLKDLTLEMVTAGVSAVGHDVRDPAGGNAELLLVPLLKLLYHLLVIGVFRDEDLGKILWLMEPNEF-SIIAQRSERENEQETQGRTTQVEDTIKQGLLQLQLPESVKLELCHLLSYMCDCQVRQSVEAVMAFSEGFVHKLQENQQVRYNQIMQAFNMSTALTARRTREFRLPPQEQINMLLMFK------DDELQENCPCPLETQHLLKDFHHQLKTHCGGNSAD-YTASEDEDSAEMPLKVRLLRMVESATG------------------LKNKPKEK-----EQCRSQRPKSLNKLISETMIRWAQESEIEKPELVRTMFTLLHRQYEGLKGQMEEPLSKAYMISQASVGDTVALLSSLCEIRSLLGIRMGKEEEQLMIRSLGEIMNNKVFYQHPNLMRALGMHETVMEVMVNVMEE---------------------------------------------DESKEVTFSK------MVASCCRFLCYFCRISRHNQGAMFDHLSYLLKNSSIGLALPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVQYLAGSCLQSCPTLVAKGYTDIGWNPVKGERYLDFLRFAVFCNGESVEENAYEVLRLLIRRPECFGPALRG 2237          

HSP 4 Score: 499.59 bits (1285), Expect = 1.350e-140
Identity = 253/468 (54.06%), Postives = 349/468 (74.57%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDME--EFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSE--ASGSRGWLR-KKMIAW-----DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXX----QGLIIDAFGELRDQLEQVKEDM-ESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            ++S FA+N Y  +  AL + F INF+LLFY+V +  S D E ++S   +D    ++ +L +S  +M     +LA  H+  +   +I YY LKVPL++FKREKE++R LEF+G+++T+QP+++++K  WD+LV++TPSFP NYWDKFVK+KV +KY +      I +LLG+++ +   +S  +  +R KK  AW     D++Y IWK GV+FTDN FLYL  Y + S +G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K +D   +DMKC++MLTC++FH++ G+RAGGGIGDEIE P GD +E  RI+FDITFFFFVIVILL I+     G  + +F  L+  +  +K  + ++KCFICGIG EYFD +PHGFE H  +EHN ANY++FLM++INK +TE+TGQE+YVW++YQ+RCW+FFPVGDCFRKQYE++L
Sbjct: 4265 LLSFFARNFYTMRFVALFVTFAINFILLFYKV-RITSVDREDLDSVIEEDSRGRDYFVLEESSGWMEPSLHLLAFAHTVISFCCIIGYYYLKVPLLIFKREKEVARKLEFDGLYVTKQPSEEDIKGQWDRLVINTPSFPSNYWDKFVKRKVMDKYGDLCGSEKISDLLGLDKAALDFSSVRKDMMRVKKDTAWAALSIDVKYQIWKLGVVFTDNCFLYLTWYMLVSSLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSDDIDTQDMKCNDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEFEVERIIFDITFFFFVIVILLNIMFICLLGFFLFSFVSLKKYIISIKTCLLQTKCFICGIGSEYFDAVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPVGDCFRKQYEDQL 4731          

HSP 5 Score: 105.145 bits (261), Expect = 2.278e-21
Identity = 65/236 (27.54%), Postives = 115/236 (48.73%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPN--------SFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSI----ETPPTDVSEMAVSNSFNILKR 3340
            F P+PVET+ + +P  +E + +K AE+ HE W+++K   GW +G+   +  K HP L  +  L   E++       ET+++++A G+TI  E   EG                  SF  ++ + P+PLD+ +++LS     +  QLAEN HN WA  +  +      +++      P LVPY+ +    +   R+ + + +K  L   Y++    +T  TD    A   +  +L+R
Sbjct: 2602 FDPQPVETSNMSVPERLEFVVNKYAEHTHEKWSLEKFANGWVHGEQLCEDTKVHPLLKPYRALVEKEKEAYRWAIKETIKSMLAFGWTI--ERTKEGDTFDIQACTRGVSQSGQLSFEGASTFSPKPLDMSSVTLSWDHCAMAEQLAENYHNAWAQAKKLE------LDSKGGGGHPKLVPYDTLTTKERTKFRERAQDILKFFLLNGYTVRRDRKTAETDFPATANCFALTLLQR 2829          

HSP 6 Score: 85.1149 bits (209), Expect = 2.504e-15
Identity = 53/203 (26.11%), Postives = 97/203 (47.78%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI---INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQ--------MLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVD S + LP  LE +  + A+++H+ W  + ++ G+ YG  R++  +  P L+ F  L + ++ + ++   + L+ ++A G+ I     + E   +  R      +  GY P P D   V ++    ++   LAEN HN+WA+ +     +   GV Q         LVP+ +L ++ K   R+   + +  L   GY
Sbjct:  783 FSPTPVDISKVVLPPQLEDIRQKLAENIHELWVKDKIDLGWTYGPMRDESKRHDPCLVEFSKLPEQEKSQNLQTAQDTLRTLLALGFHIGLTNDKAEARAKYTRLHTKYELLGGYRPAPIDFSKVFLSSADEEVVNLLAENDHNVWARERIKQGWTY--GVQQDVKAKQSPQLVPYSLLDERTKRTVREGVRDAVCTLLAFGY 983          

HSP 7 Score: 57.7658 bits (138), Expect = 5.447e-7
Identity = 25/88 (28.41%), Postives = 54/88 (61.36%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWT 9343
            ++P P+D S + L ++ E +++  A++ H+ WA E +++G+ YG+ ++   K  P L+ + LL +  +    E V +A+  ++A+G+T
Sbjct:  897 YRPAPIDFSKVFLSSADEEVVNLLAENDHNVWARERIKQGWTYGVQQDVKAKQSPQLVPYSLLDERTKRTVREGVRDAVCTLLAFGYT 984          
BLAST of Ryanodine receptor related vs. Ensembl Medaka
Match: ryr2b (ryanodine receptor 2 [Source:NCBI gene;Acc:101164337])

HSP 1 Score: 973 bits (2514), Expect = 0.000e+0
Identity = 566/1321 (42.85%), Postives = 797/1321 (60.33%), Query Frame = 2
Query:  128 EEEISFLRTDDHVCLSSVGHGSSD--RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPV-SSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKE---------NVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESG-PYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGS---VPTLKLISKIFGVQK--SEMEFLRLGLPIKC 4021
            E++  FLRT D V L S      +  + CL+A GFGSR C LE +S  +N PPDLS+C F+L + LSVRALQE++A+     A+G    H+TLLYG AVL KH+ S M+LSCLS+S S  DKLAFDVGLQ++   EACWWTVHP+++QRSEGEKVR+GDDLILVSV+SERYL ++    E+    V A+F QTLW+V P+ + GA+ Q   G + GG+ LRL H   D CLTVP++      Q   + YE G+VS++ARSLWRLE+++  WSG    WG   RL HVT+GRYL  +     +  V R +A  ++++F  R SK    +R    + D MG  +IK+G++  ++QHV S  WL+Y+A     +      +++AV+  EGHMDDG ++++ Q EE+ +A  IR    +F  FI+ LD    +    S+S +++  +   L+DLI++F  P      E KQ  L   + RQ++FQEEG+++L+L  ID     +     F++A  E    W + + N  Y LLAAMIRGNR NCA F+    MDW+F RL+  +++ G L+VLHC+L +S EAL  I   HI  +I  LDK GR  +VL+VLCSLC+   G AVR NQ LI D+LLPDRDLLLQTRL +  +S+RPN+FI   E S+ +++WY+E+ +D +   +T     LRVGW+  +G+ P P G +G+G   VGDDL S+GFDG +LW+G   +R+ +     +L   D++ C LDLTVP I F +N  PV+G   +F  +G+ YP VS SA V    +FGG HG  R+ PP GY++  EALLPK +L++EPC      +K +     E K+          V F P PV+ +++ LP  +E+IR KLAENIHE+W   KID GWTYG  RD+  +  PCL  F +LP  E+  ++  A +TLRT++ALG+ I        +R K  +L   +    GYRP P+D   + LSS  E +VN LAEN HN+WA +RIKQGW+YG  ++   K+SP LVPY  +D+  K++ R+   + V TLLA+ YS E  P +       N             R FR   ++ VT+GKWY+E E+ T G MR GW   D     E+GS+ Q++ FD   A  W+ + G   G     GDV+ C+LD+ ++++  +LNGEL+ +  G E+A K+   + G++P  S G  Q  KLN G+ V +LKYF  CGLQEGY PF  NM+R  PLW S +   +F  I   +  ++V    GS   + +L++  ++       S M F RL LP++C
Sbjct:    8 EDKFQFLRTGDEVVLQSTFTYQEEHLKLCLAAEGFGSRLCKLEPVSNCKNVPPDLSVCGFVLARCLSVRALQEMLAQS--EQAVGDGGSHRTLLYGQAVLFKHSYSGMYLSCLSSSQSSTDKLAFDVGLQQDKTGEACWWTVHPSSRQRSEGEKVRVGDDLILVSVASERYL-VSRGIKESDSLIVNAAFHQTLWSVAPICAGGAVAQ---GYLKGGETLRLLHSHSDACLTVPYTEQGEELQ-RIIQYETGSVSTYARSLWRLEILRVAWSGRHTCWGQPFRLCHVTTGRYLGFTEEKG-LHLVDRDKANINTSSFCFRSSKPHSGAR---TDADGMGHPEIKYGDSVCYVQHVYSGLWLTYQA--DDAKCQMGGTQRKAVLHSEGHMDDGLSLSRSQREEAHTARLIRSSLLLFNWFIRKLDGSHQDGNLPSIS-ISMPLMTSSLQDLINYFQSPCDALNQEDKQNYLNVQKKRQNMFQEEGVMDLVLECIDNLH-QYSSASHFVEAASEGGGGW-EVVLNCFYELLAAMIRGNRVNCAHFS--GSMDWLFSRLDRLEASSGALEVLHCILVESPEALKAIKKGHIESIISFLDKHGRINKVLEVLCSLCVC-HGVAVRSNQNLICDSLLPDRDLLLQTRLANQVTSMRPNIFIDPGEASSQHRRWYFELVVDHVNTFLTFEPTHLRVGWACTKGYQPRPRGGEGFGGNGVGDDLCSYGFDGLHLWSGCVGRRVSSRFPH-LLRDNDVVSCCLDLTVPCISFRVNGLPVQGMLENFVANGLLYPVVSISAGVRACFLFGGRHGEFRFLPPPGYASCSEALLPKVKLKVEPC------QKHVVECEKERKKLFGPLVPVTPVTFSPTPVDISKVVLPPQLEDIRQKLAENIHELWVKDKIDLGWTYGPMRDESKRHDPCLVEFSKLPEQEKSQNLQTAQDTLRTLLALGFHIGLTNDKAEARAKYTRLHTKYELLGGYRPAPIDFSKVFLSSADEEVVNLLAENDHNVWARERIKQGWTYGVQQDVKAKQSPQLVPYSLLDERTKRTVREGVRDAVCTLLAFGYSFE--PLNQEPGWSLN----------PKCRVFRPDKSYAVTTGKWYFEFEVETDGTMRVGWARPDCTPDKELGSDDQAFVFDGFEAL-WHHQGGEALGWPWIRGDVVACLLDMGERSMMVTLNGELLFNQRGSELAAKDFEINDGFLPIVSVGVNQVGKLNLGHQVDSLKYFKACGLQEGYKPFAFNMARDPPLWMSWKQS-MFTSIHDSDQNIQVIRVGGSTDGLSSLRVSRRLLAHHSAGSRMGFYRLSLPVEC 1288          

HSP 2 Score: 581.252 bits (1497), Expect = 2.924e-165
Identity = 378/1054 (35.86%), Postives = 559/1054 (53.04%), Query Frame = 2
Query: 4508 QYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRR-ATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNL-ISDDVTLKMLGENGED-IFPKLDMCPEINYERLKNISLKELANAVNK-GAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPR----------------VTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQS-DLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSR-SLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNAL-GEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRG 7600
            QYY++V VLPGQD   +++GWVTS F                    H  ++T D  +           V  VT+   ++   ++ SV  S  Y++   +      +      + S G+ IGC +D +TG LTF  N  E+   +QV   T L+PA+FVKPT      FELG  +N +P+ +G+LR  RR  TP    R+ +Q L+   W+RV +   K+ + +  E  GW +   E  Q M + IP+EDRC+D+LEL E   L  FH  T+ LY ++C +GN  V  +L +H+D++Q  Y IQN YL G+LR  ++ LLI ++L SH+  +L   +E +VP+   +                +++    +    IDF+   IP+   S S+ P +  S    ++  G   E  +       PEI  + LK+++L+ +   V+  G  + +P GG+ E + VPLLK++ HLL++G+    D+  IL +++   F S  A R  R                + + +L + L ESVKL+LCHLL  +CD Q+R  +E ++  S  FV  +Q +Q  RY +I Q+ ++ +++TA+ T+EFR PP++Q+  +L F        +E  +   C  E +  +  FH +L  +CG       +I  L++  F  +  R +L   P+                N+L L                     ++L+++I  T+I WA+ + IE  +L+R MF+LL RQY  L G+++  L K Y+IS  S  D   LL SL  +R LLG+++G+ EE L+   L +IMNNKVF+QHPNL R L +HETVM++MV+ +                                               +E+ EV   K      MV  CCRFLCYFCR S  NQ  MF+HLSY+L+NSS+ LA PS+RG+ PLDVA +S+MDNNELALA+RE  LEKV  YL+ S +QS   L++KGY DIGW+PV+GER+LDFLRF V+ NGE +EENA  V+RLLIRRPEC GPALRG
Sbjct: 1375 QYYYTVRVLPGQDPFNVWVGWVTSDF--------------------HHYETTFDTNS-----------VHTVTVTLGDDSGKVQESVKRSSCYMVCAGEATGLSQS------RRSTGLEIGCLIDSSTGLLTFTSNGVEMSTFYQVEAQTKLFPAVFVKPTTSNMFQFELGCVKNAMPLSSGLLRSQRRNPTPQCPPRIHVQHLRPVSWTRVPDKALKVLVDQPAEHHGWRIQAFEPQQYMGLQIPDEDRCIDVLELSECRDLQTFHHNTILLYCSLCSHGNSRVCHALCSHIDQSQILYAIQNPYLAGQLRDAYYQLLIQIYLSSHTTERLMMNDEYIVPMTGQI----------------RESPSHCALDGGIDFEGAGIPNNDHSTSLKPQIHCSCPCFVRERGMKDESAVVLGCTDSPEIPLDMLKDLTLEMVTAGVSAVGHDVRDPAGGNAELLLVPLLKLLYHLLVIGVFRDEDLGKILWLMEPNEF-SIIAQRSERENEQETQGRTTQVEDTIKQGLLQLQLPESVKLELCHLLSYMCDCQVRQSVEAVMAFSEGFVHKLQENQQVRYNQIMQAFNMSTALTARRTREFRLPPQEQINMLLMFK------DDELQENCPCPLETQHLLKDFHHQLKTHCGGNS----NIQNLISSVFILEHKRYNLPFPPL----------------NLLFL---------------------ESLNKLISETMIRWAQESEIEKPELVRTMFTLLHRQYEGLKGQMEEPLSKAYMISQASVGDTVALLSSLCEIRSLLGIRMGKEEEQLMIRSLGEIMNNKVFYQHPNLMRALGMHETVMEVMVNVMEE---------------------------------------------DESKEVTFSK------MVASCCRFLCYFCRISRHNQGAMFDHLSYLLKNSSIGLALPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVQYLAGSCLQSCPTLVAKGYTDIGWNPVKGERYLDFLRFAVFCNGESVEENAYEVLRLLIRRPECFGPALRG 2276          

HSP 3 Score: 556.599 bits (1433), Expect = 9.054e-158
Identity = 292/500 (58.40%), Postives = 372/500 (74.40%), Query Frame = 2
Query: 12398 QEQEMEKLQILAEQNRLSDRGAAEMVLLEICGGRGVVTAVVQXXXXXXXXXXXXXNTSVQSRMLAFLKEKKLMGFFMSISGLMQQCSVLDLDTFERCNKAEGLAAGGLYDLQGITNLY-DAEFTCKLFRFLQLLCEGHNLAFQDYLRSQAGXXXXXXXXXXXXDYLLRLQESIMDFYWHYTGKDSIDRAGKLNLVKAIKIGKQIFRTLTEYIQGPCVGNQLALAHSRLWDAISGFLFIFAHMQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEG 13894
            QE+EM+K ++L +Q RL  RGA+EMVL  I    G + +++  +++LGI+LL GGN +VQ +ML +L+EK+ + FF S+SGLM+ CSVLD + FER  KAEGL   GL   +    +  D + TC LFRFLQLLCEGHN  FQDYLR+Q GN TTVNIII TVDYLLR+QESI DFYW+Y+GKD +D  G+LN  KAI++ KQ+F TLTEYIQGPC GNQ +LAHSRLWDA+ GFL IFAH+Q KLS+D  Q ELL+E M LQK+M++ LLSMLEGNV+NG IGKQMVD LVESS NVEMIL FF++FL++KD+TSSE F  +D +  G IS K+F   ME    ++  EI +++ C+++N    VD+ +F DRFH+PAKDIGF++ VLLTNL EHMP D RL+  +  A+ ++  F+P LGRIEI G   R ER+YFEI      QWEKPQ+K+SKR F+  VVNEGG+ EK+E FVNFCEDTI+EMQ + +ISG   G
Sbjct: 3456 QEKEMKKQKLLYQQARLHCRGASEMVLQSISASNGSMGSMIASTLKLGIALLNGGNAAVQQKMLKYLREKQDVCFFQSMSGLMRSCSVLDPNAFERQKKAEGL---GLTMAESSGKVMPDKDLTCDLFRFLQLLCEGHNADFQDYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVVDAEGQLNFSKAIEVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHIFAHLQMKLSQDSSQNELLKELMDLQKDMVVFLLSMLEGNVINGTIGKQMVDMLVESSGNVEMILNFFNMFLKLKDLTSSELFREYDPDCKGNISKKDFHKVMEYCNHFSQAEIHFLLSCMETNESEIVDYADFVDRFHEPAKDIGFSITVLLTNLSEHMPKDPRLKTFLEMAECVLTYFQPCLGRIEILGSGKRFERIYFEISDYSRTQWEKPQVKESKRQFIFDVVNEGGEMEKMEMFVNFCEDTIFEMQLAAQISGSNAG 3952          

HSP 4 Score: 456.833 bits (1174), Expect = 1.274e-127
Identity = 240/480 (50.00%), Postives = 332/480 (69.17%), Query Frame = 2
Query: 14636 IISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPE--KMNSTDPDDME----------EFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSE--ASGSRGWLR-KKMIAW-------DIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDND-GVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXX----QGLIIDAFGELRDQLEQVKED-MESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEEL 15991
            ++S FA+N Y  +  AL + F INF+LLFY+V   P+S  E  ++ S D +D++          ++ +L +S  +M     +LA  H+  +   +I YY LKVPL++FKREKE++R LEF+G+++T+QP+++++K  WD+LV++TPSFP NYWDKFVK+KV +KY +      I +LLG+++ +   +S  +  +R KK  AW       D++Y IWK GV+FTDN FLYL  Y + S +G++N FFFA HLLD+A+ FKTLRTIL SVTHNGKQLVLTV L +V++YLYTV+AFNFFRKFY K +D   +DMKC++MLTC++FH++ G+RAGGGIGDEIE P GD +E  RI+FDITFFFFVIVILL I+     G  + +F  L+  +  +K   +++KCFICGIG EYFD +PHGFE H  +EHN                      E+YVW++YQ+RCW+FFPVGDCFRKQYE++L
Sbjct: 4145 LLSFFARNFYTMRFVALFVTFAINFILLFYKVASMPASKGEEVRITSVDREDLDSVIEEDSRGRDYFVLEESSGWMEPSLHLLAFAHTVISFCCIIGYYYLKVPLLIFKREKEVARKLEFDGLYVTKQPSEEDIKGQWDRLVINTPSFPSNYWDKFVKRKVMDKYGDLCGSEKISDLLGLDKAALDFSSVRKDMMRVKKDTAWAALFRSIDVKYQIWKLGVVFTDNCFLYLTWYMLVSSLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSDDIDTQDMKCNDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEFEVERIIFDITFFFFVIVILLNIMFICLLGFFLFSFVSLKKYIISIKTCLLQTKCFICGIGSEYFDAVPHGFETHTLQEHNL---------------------ESYVWKMYQERCWEFFPVGDCFRKQYEDQL 4603          

HSP 5 Score: 319.701 bits (818), Expect = 4.198e-86
Identity = 223/707 (31.54%), Postives = 361/707 (51.06%), Query Frame = 2
Query: 9965 KVVLPLVERYFGAHKNYFV-------GPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFS--HLKGTVERG-AVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKN---LPNLDAIVEEIVDLAESGGKY--TEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHL-SLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLS 12037
            +VV+P++E+Y  +H  YF+       G +S A  +EK+M A      ++L++                                  + ++ ++  L  FF   A DL + ++ L+    S    +G + RG A +L+Y   +LLP L S+F H++  N G D L    +++CY+ILN+LY   T SS Y +            P+ G C+AA+   FPV FLE  LN+NN +SI YN    Y +  + +  ++E     LP+L+  +E++ +LA +G     T   HV E+TLPMLCSY+  WW   P+ + +       S   T+V  +  +++LG++L++  N++ + H  WM ++A+ +Q I+G+A + +L  HFLP+ EKL+  A    +EEE    + K+ S   +E E  + ++  +LVR+++AFYPLLI++VD +R  W+K+P  + + LF++VAE+F+ W+KS HFK EEQN+V QNEI++L SLI  D+    K    R  +             + S++TSL V  +K+L+P+GL      +Q LI  AK                                               +Q+ Q   +  +  A+ +           + R+L +A+VL+ L  V+HP    K + +K++S QRKRAV+A  RM PL++ PRHR VNLFL  Y  +W+S
Sbjct: 2855 QVVIPVLEQYVKSHHLYFISTCLGSSGNRSSATKKEKEMIA------WTLMK----------------------------------SVQESIQTSLHLFFEAAAADLEMTVEKLSETSVSIPQSRGQLARGVAQALHYTTFILLPTLTSLFHHLANQNFGVDFLG---KMSCYRILNSLYSFRTTSSIYMEG-----------PVAGACLAALTGAFPVCFLEPSLNQNNPFSI-YNTMKLYFVLDQGLPDQVEDVCPLLPSLEEALEQVKELACAGAAAHQTHYIHVAEITLPMLCSYISHWWCWEPKELPD-------SPLFTSVGPQHASDLLGHMLRIFYNHVGASHCHWMKQLAVFSQRIIGSAPVELLKSHFLPLMEKLRKRAEGILREEE----QMKAESSCTSEGELLMQEKYTLLVRDLYAFYPLLIQFVDCNRARWLKEPIPEAEQLFSMVAEVFIFWAKSHHFKWEEQNYVVQNEINNLASLIKNDKALKVKKRMKRKGD-------------RYSAHTSLIVTSMKKLVPVGLKGCFQSDQSLITLAKNGF--------------------------------------------SQVKQLTQHSAVNDAQKI-----------VDRILEIARVLYYLDQVEHPERRKKLTRQKVLSRQRKRAVVASLRMTPLYNQPRHRAVNLFLFGYTKLWIS 3427          

HSP 6 Score: 318.931 bits (816), Expect = 5.772e-86
Identity = 223/642 (34.74%), Postives = 326/642 (50.78%), Query Frame = 2
Query: 7781 GGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEH---DTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGL----LPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTG-MPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTI----DADLSRIE--MHGERRRPTI---INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            GG GLL AMKE I++S         Q+V           QK+L                           D D + +G AI+TFYS L+DLLGRCAPE       K  ++RVRAIL+SL+ ++D+EGV+S+   LP      +V++DG         M P L     P HKA++VLFL+RVYGI+     +RLLE  FL D++AA  LD   S  +D ALALNRYL  SVLPLLTK S  L + E    +++  +   YRLS   SLTK QRE   D L+AL  +LQ  ++  LLR+L+ D   LT  S + L+LL + Y +   YYS  G    Q +A+EEE  L+  LF G+F  LAK             CL  +  AL PD+     + S+ +S                           Q++ ++ M    TD  F PQPV+TS++ +P  LE +++++A+H H+ W+LE    G+V+G    +  K HP L  +  L + ++  Y   + E +K+M+A+GWTI    + D   I+    G  +   +   ++  ++P P D+  V ++ +   MAE+LAEN HNI                   LVP++ LT KE++++R+   ++LK+   NGY
Sbjct: 2278 GGNGLLAAMKEAIMIS---------QDVSMDGPYPSQESQKSL--------------------------SDDDRIQMGHAIMTFYSALIDLLGRCAPETHLIQEGKGEAIRVRAILRSLIPIQDIEGVVSIPLQLP------SVSKDG-------LLMEPDLSIVFCPCHKAAMVLFLDRVYGIESQSLLIRLLEVGFLPDIQAAVSLDTVRS--TDMALALNRYLCGSVLPLLTKFSALLHDLEDHILLVDCLIQGVYRLSGAFSLTKAQRETAQDCLLALCSKLQASVMQPLLRRLVFDALHLTDHSTMALKLLISHYMQRSSYYSQAGRRSDQSLASEEELHLSRTLFWGVFKALAK--------KLCAQCLVTVAKALPPDH-----VESVCLS---------------------------QMERKSFM---DTDGHFDPQPVETSNMSVPERLEFVVNKYAEHTHEKWSLEKFANGWVHGEQLCEDTKVHPLLKPYRALVEKEKEAYRWAIKETIKSMLAFGWTIERTKEGDTFDIQACTRGVSQSGQVCVHMSSTFSPKPLDMSSVTLSWDHCAMAEQLAENYHNI-------------------LVPYDTLTTKERTKFRERAQDILKFFLLNGY 2807          

HSP 7 Score: 89.7373 bits (221), Expect = 1.207e-16
Identity = 57/210 (27.14%), Postives = 96/210 (45.71%), Query Frame = 2
Query: 2669 FIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQ--------SNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYS 3274
            F P+PVET+ + +P  +E + +K AE+ HE W+++K   GW +G+   +  K HP L  +  L   E++       ET+++++A G+TI  E   EG             Q        S+ + P+PLD+ +++LS     +  QLAEN HNI                         LVPY+ +    +   R+ + + +K  L   Y+
Sbjct: 2626 FDPQPVETSNMSVPERLEFVVNKYAEHTHEKWSLEKFANGWVHGEQLCEDTKVHPLLKPYRALVEKEKEAYRWAIKETIKSMLAFGWTI--ERTKEGDTFDIQACTRGVSQSGQVCVHMSSTFSPKPLDMSSVTLSWDHCAMAEQLAENYHNI-------------------------LVPYDTLTTKERTKFRERAQDILKFFLLNGYT 2808          

HSP 8 Score: 85.5001 bits (210), Expect = 2.336e-15
Identity = 53/203 (26.11%), Postives = 97/203 (47.78%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTI---INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQ--------MLVPFEILTDKEKSRYRKLTNELLKYLQYNGY 9655
            F P PVD S + LP  LE +  + A+++H+ W  + ++ G+ YG  R++  +  P L+ F  L + ++ + ++   + L+ ++A G+ I     + E   +  R      +  GY P P D   V ++    ++   LAEN HN+WA+ +     +   GV Q         LVP+ +L ++ K   R+   + +  L   GY
Sbjct:  846 FSPTPVDISKVVLPPQLEDIRQKLAENIHELWVKDKIDLGWTYGPMRDESKRHDPCLVEFSKLPEQEKSQNLQTAQDTLRTLLALGFHIGLTNDKAEARAKYTRLHTKYELLGGYRPAPIDFSKVFLSSADEEVVNLLAENDHNVWARERIKQGWTY--GVQQDVKAKQSPQLVPYSLLDERTKRTVREGVRDAVCTLLAFGY 1046          

HSP 9 Score: 70.4774 bits (171), Expect = 7.262e-11
Identity = 34/98 (34.69%), Postives = 60/98 (61.22%), Query Frame = 2
Query: 2990 SFLQSNG-YRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIE 3280
            SF+ ++G + PQP++  N+S+   LE +VN+ AE+TH  W++++   GW +G       K  P L PY  + +  K++ R    ET+K++LA+ ++IE
Sbjct: 2618 SFMDTDGHFDPQPVETSNMSVPERLEFVVNKYAEHTHEKWSLEKFANGWVHGEQLCEDTKVHPLLKPYRALVEKEKEAYRWAIKETIKSMLAFGWTIE 2715          

HSP 10 Score: 56.9954 bits (136), Expect = 9.450e-7
Identity = 24/90 (26.67%), Postives = 55/90 (61.11%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID 9349
            ++P P+D S + L ++ E +++  A++ H+ WA E +++G+ YG+ ++   K  P L+ + LL +  +    E V +A+  ++A+G++ +
Sbjct:  960 YRPAPIDFSKVFLSSADEEVVNLLAENDHNVWARERIKQGWTYGVQQDVKAKQSPQLVPYSLLDERTKRTVREGVRDAVCTLLAFGYSFE 1049          
BLAST of Ryanodine receptor related vs. Ensembl Medaka
Match: ENSORLT00000022995.2 (pep primary_assembly:ASM223467v1:19:17244861:17287092:-1 gene:ENSORLG00000018368.2 transcript:ENSORLT00000022995.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 496/1001 (49.55%), Postives = 668/1001 (66.73%), Query Frame = 2
Query:  173 SSVGHGSSDRFCLSANGFGSRTCFLENLSLENN-PPDLSLCVFILDQALSVRALQEVVA--KGYDTNAIGGQS----GHKTLLYGHAVLLKHTMSNMFLSCLSTS-SSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLF--HGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRID-SIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYG 3142
            S+  H    + CL+A GFG+R CFLE++S   N PPDLS+C F+L+Q+LSVRALQE++A  K      I G S    GH+TLLYGHAVLL+H+ S MFL CLSTS SS DKLAFDVGLQE    EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  N       V A+FQQTLW+  P+ SG+  + + G + GGDVLRL   H DECLTVP S  +   Q  +V YE GA+ +HARSLWRLE ++  WSG  I WG   RLRHVT+G+YLS++     +  + + +A   STAF  R SK+ K     + E D MG+ DIK+G++  ++QHV +  WL+Y+  + K   +G V+  +A++  EGHMDDG T+++ Q EES++A  IR    +F  FI+ LD  + ++ RSS   + +  V   L+DLI +F  P    +HE +Q +L AL+NRQ+LFQEEG+I+L+L  ID+    +     F   +G    E +  + N LY LLAA+IR NR NCAQF+    +DW+  RLE  +++ G+L+VLHCVL +S EALNII + H++ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI DNLLP RDLLLQTRLV+  SS+RPN+F+GV + SA Y+KWYYE+ +D ++  VT     LRVGW+N  G+ P+P G +GWG   VGDDLFS+GFDG +LW+G   + + +   Q +L   D++ C LDL VP I F IN +PV+G F +FN DG+F+P  S SA V VR + GG HG  ++ PP GY+   EA+LP+E+L+LE   S          G + T     F P PV+T++I LP ++E IR+KLAENIHE+W M KID GWTYG  RDD  + HPCL  F +LP  ER +++ ++ ETL+T++ALG  +         R+K+++L  ++  S+GY+P PLDL +I L+   E +V++LAEN HN+WA DRI+QGW+YG
Sbjct:   19 SATVHKEQQKLCLAAEGFGNRLCFLESISNSKNVPPDLSICTFVLEQSLSVRALQEMLANIKEKSDGVITGMSKTGGGHRTLLYGHAVLLRHSYSGMFLCCLSTSRSSTDKLAFDVGLQENTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGN---CSLHVDAAFQQTLWSAAPICSGS--EVAQGFLIGGDVLRLLLGHMDECLTVP-SGEQGDEQRRTVHYEGGAICTHARSLWRLETLRVMWSGSHIRWGQPFRLRHVTTGKYLSLTEE-KSLLLIDKEKADVKSTAFCFRSSKE-KSDPGVKKEVDGMGTPDIKYGDSVCYIQHVETCLWLTYQTVDAKSVRMGGVQR-KAIMHHEGHMDDGLTLSRSQHEESRTARVIRSTVFLFNLFIRGLD-MLRKQGRSSAFNLPIDSVSLSLQDLIGYFQPPGEHMDHEERQNRLRALKNRQNLFQEEGMISLVLDCIDRLH-VYNSTAHFADVVGHVAAEAWSSILNSLYQLLAALIRRNRKNCAQFS--GSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHVKSIISLLDKYGRNHKVLDVLCSLCVC-NGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSDGSAQYRKWYYEVIVDQALPFVTAEPTHLRVGWANTSGYAPYPSGGEGWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSP-NQHLLRSEDVVSCCLDLNVPSISFRINGQPVQGMFENFNSDGLFFPAASFSAGVRVRFLLGGRHGEFKFLPPAGYAPCCEAVLPREKLKLEA--SQDQTAARELLGPTVTLSQAAFTPTPVDTSQIVLPLHLERIREKLAENIHELWVMNKIDLGWTYGMVRDDNKRQHPCLVEFSKLPEQERSYNLQMSLETLKTLLALGCHVGLADEKAVGRVKSLELSPTYELSSGYKPAPLDLNHIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYG 1002          

HSP 2 Score: 103.605 bits (257), Expect = 4.432e-21
Identity = 53/150 (35.33%), Postives = 86/150 (57.33%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTID-ADLSRI-EMHGERRRPTI-INDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK 9520
            F P PVDTS I LP  LE + ++ A+++H+ W +  ++ G+ YGM R+D  + HP L+ F  L + ++   ++  +E LK ++A G  +  AD   +  +      PT  ++ GY P P DL  + +T     M +KLAENAHN+WA+ +
Sbjct:  845 FTPTPVDTSQIVLPLHLERIREKLAENIHELWVMNKIDLGWTYGMVRDDNKRQHPCLVEFSKLPEQERSYNLQMSLETLKTLLALGCHVGLADEKAVGRVKSLELSPTYELSSGYKPAPLDLNHIKLTPSQEAMVDKLAENAHNVWARDR 994          

HSP 3 Score: 79.7221 bits (195), Expect = 7.378e-14
Identity = 43/134 (32.09%), Postives = 67/134 (50.00%), Query Frame = 2
Query: 2861 HNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLA 3262
            H E +F     Y      V     +  E   + +  + +  P   L    + P P+D   I L  HLE +  +LAEN H +W M++I  GW+YG V ++  ++ P LV + K+ +  +  N Q S+ET+KTLLA
Sbjct:  795 HGEFKFLPPAGYAPCCEAVLPREKLKLEASQDQTAARELLGPTVTLSQAAFTPTPVDTSQIVLPLHLERIREKLAENIHELWVMNKIDLGWTYGMVRDDNKRQHPCLVEFSKLPEQERSYNLQMSLETLKTLLA 928          
BLAST of Ryanodine receptor related vs. Ensembl Medaka
Match: ENSORLT00000008002.2 (pep primary_assembly:ASM223467v1:14:13840000:13849533:1 gene:ENSORLG00000006365.2 transcript:ENSORLT00000008002.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 488/1026 (47.56%), Postives = 684/1026 (66.67%), Query Frame = 2
Query:  137 ISFLRTDDHVCLSSVGHGSSD--RFCLSANGFGSRTCFLENLS-LENNPPDLSLCVFILDQALSVRALQEVVAKG-YDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSS-ADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHG--DECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIEN-VTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSI--YAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLV 3184
            + FL+ DD V L        +  + CLS  GFG+R CFLE  S  +N PPDL++C FIL+Q+LSVRALQE+++    D ++ GG  GH+TLLYGHA+LLKHT S+M+LSCL+TS S  DKLAFDVGLQE++  EACWWT+HPA+KQRSEGEKVR+GDDLILVSVSSERYLHL+  +G+ +   V ASF QTLWT+ PV SG   + + G + GG VLRLFHG  DECL +P ++ +   Q   V YE GAV SHARSLWRLE ++  WSGG I WG   R+RH+T+GRYL +      +  V   +A    +AF  R SK+ K    ++ + + MG+ +IK+GE+  F+QHVS+  WL+Y A    K       +++A++  EGHMDD  TVA+ Q EES++A  I     +F +FI+ LD    + + ++   + +  V   L+DLI +F  P  + EHE KQ KL +L+NRQ+LFQEEG+I L+L  ID+    +     F +  GE+  E + ++ N LY LLA++IRGNRANCA F     +DW+  +L+  +++ G+L+VL+CVL +S E LNII + HI+ +I LLDK GR+ +VL VLCSLC+   G AVR NQ LI +NLLP RDLLLQT +++  +S+RPN+F+G  E S  Y+KWY+E+ +D IE  +T     LRVGW+  EG+ P+PGG +GWG   VGDDL S+ FDG +LW+G  P+ + +  Q   L   D++ C LDL+VP I F IN +PV+G F +FN+DG+F+P VS SA + +R + GG HG  ++ PP GY+  +EA+LP++RLR+EP   + +    I    G +++  +  F P PV+T +I LP ++E IR+KLAEN HE+WA+ +I+QGWT+G  RDD  K HPCL  F+ LP  E+ +++ ++ ETL+T++ALG  +          LK  KLP +++QSNGY+P PLDL ++ L+ +  TLV +LAEN HN+WA DR++QGW+Y      ++ + P+LV
Sbjct:   26 VLFLQ-DDQVVLQCTASILKEQIKVCLSCEGFGNRLCFLETTSNAQNVPPDLAICCFILEQSLSVRALQEMLSNSSVDESSQGG--GHRTLLYGHAILLKHTHSSMYLSCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYASGDLM---VDASFMQTLWTMTPVMSGC--ELAEGFLTGGYVLRLFHGHMDECLAIPGAD-QGDDQRRVVQYEGGAVCSHARSLWRLEPLRIAWSGGHIKWGQSFRIRHITTGRYLCLDEEKG-LLLVDPEKAVSKMSAFCFRISKE-KIEVTQKRDVEGMGTPEIKYGESMCFVQHVSTGLWLTYAA-VDAKSARLGPLKRKAILHKEGHMDDALTVARSQTEESQAARMIYSTTGLFNQFIKGLDALSGKNKSANAPSLPMDAVALSLQDLIFYFRPPEEELEHEDKQFKLRSLKNRQNLFQEEGMITLVLDCIDRLN-VYNTAAHFSEYAGEEAAESWKEIVNLLYELLASLIRGNRANCALFC--DNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVC-NGVAVRSNQNLITENLLPGRDLLLQTSIINYVTSMRPNIFLGTCEGSTQYKKWYFEVMVDHIEPFLTAQPYHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLHSYSFDGLHLWSGRVPRLVASHSQH-TLAADDVVSCCLDLSVPSISFRINGQPVQGMFENFNLDGLFFPVVSFSAGIKLRFLLGGRHGDFKFLPPPGYAPCYEAVLPRDRLRIEPIKEYKHDFNGIRNLLGPTQSLSHTAFTPCPVDTIQIVLPPHLERIREKLAENSHELWAVTRIEQGWTFGPFRDDNKKLHPCLVDFQSLPEPEKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKRTKLPKTYMQSNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTY------SIGQVPYLV 1028          

HSP 2 Score: 94.3597 bits (233), Expect = 2.855e-18
Identity = 50/150 (33.33%), Postives = 83/150 (55.33%), Query Frame = 2
Query: 9080 FKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERR---RPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGK 9520
            F P PVDT  I LP  LE + ++ A++ H+ WA+  +E+G+ +G  R+D  K HP L+ F  L + ++   +    E LK ++A G  +     + E + +R    +  + ++GY P P DL  V +T     + E+LAEN HN+WA+ +
Sbjct:  863 FTPCPVDTIQIVLPPHLERIREKLAENSHELWAVTRIEQGWTFGPFRDDNKKLHPCLVDFQSLPEPEKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKRTKLPKTYMQSNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDR 1012          

HSP 3 Score: 77.7962 bits (190), Expect = 2.876e-13
Identity = 45/128 (35.16%), Postives = 67/128 (52.34%), Query Frame = 2
Query: 2924 GYTINYE--MPSEGSRLKTIKL-------------PNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLA 3262
            GY   YE  +P +  R++ IK              P   L    + P P+D + I L  HLE +  +LAEN+H +WA+ RI+QGW++G   ++  K  P LV ++ + +  K  N   S ET+KTLLA
Sbjct:  819 GYAPCYEAVLPRDRLRIEPIKEYKHDFNGIRNLLGPTQSLSHTAFTPCPVDTIQIVLPPHLERIREKLAENSHELWAVTRIEQGWTFGPFRDDNKKLHPCLVDFQSLPEPEKNYNLAMSGETLKTLLA 946          
BLAST of Ryanodine receptor related vs. Planmine SMEST
Match: SMESG000000646.1 (SMESG000000646.1)

HSP 1 Score: 8270.61 bits (21459), Expect = 0.000e+0
Identity = 4070/4076 (99.85%), Postives = 4074/4076 (99.95%), Query Frame = 2
Query:  113 MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS 12340
            MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYEVKKRGVGKVEEKQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNIITDLHIRILIRLLDKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVGIITPGGIGSTSGLSGTGSSSAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKV+DHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDS+AGNHHEQLI+GQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEF+IPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRLSINSTSSSLSKSL GTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQAEKKSGSEAAAEMEEELNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDHESSEISHSSSEEAAVEIV QGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS
Sbjct:    1 MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYEVKKRGVGKVEEKQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNIITDLHIRILIRLLDKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVGIITPGGIGSTSGLSGTGSSSAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVIDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSTAGNHHEQLIIGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFSIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRLSINSTSSSLSKSLVGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQAEKKSGSEAAAEMEEELNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDHESSEISHSSSEEAAVEIVSQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS 4076          

HSP 2 Score: 96.2857 bits (238), Expect = 9.764e-19
Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = 3
Query: 12387 QNLYKNKRWKNCKFWPNKTVYLIEVQQKWYCWKYVAAGVL 12506
            QNLYKNKRWKNCKFW NKTVYLIEVQQKWYCWKYVAAGVL
Sbjct: 4092 QNLYKNKRWKNCKFWLNKTVYLIEVQQKWYCWKYVAAGVL 4131          
BLAST of Ryanodine receptor related vs. Planmine SMEST
Match: SMESG000000646.1 (SMESG000000646.1)

HSP 1 Score: 8263.67 bits (21441), Expect = 0.000e+0
Identity = 4068/4076 (99.80%), Postives = 4072/4076 (99.90%), Query Frame = 2
Query:  113 MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS 12340
            MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYEVKKRGVGKVEEKQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNIITDLHIRILIRLLDKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVGIITPGGIGSTSGLSGTGSSSAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKV+DHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDS+AGNHHEQLI+GQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEF+IPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRLSINSTSSSLSKSL GTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQAEKKSGSEAAAEMEEELNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDHESSEISHSSSEEAAVEI   GKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS
Sbjct:    1 MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYEVKKRGVGKVEEKQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNIITDLHIRILIRLLDKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVGIITPGGIGSTSGLSGTGSSSAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVIDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSTAGNHHEQLIIGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFSIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRLSINSTSSSLSKSLVGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQAEKKSGSEAAAEMEEELNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDHESSEISHSSSEEAAVEI---GKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS 4073          

HSP 2 Score: 96.2857 bits (238), Expect = 9.763e-19
Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = 3
Query: 12387 QNLYKNKRWKNCKFWPNKTVYLIEVQQKWYCWKYVAAGVL 12506
            QNLYKNKRWKNCKFW NKTVYLIEVQQKWYCWKYVAAGVL
Sbjct: 4089 QNLYKNKRWKNCKFWLNKTVYLIEVQQKWYCWKYVAAGVL 4128          
BLAST of Ryanodine receptor related vs. Planmine SMEST
Match: SMESG000000646.1 (SMESG000000646.1)

HSP 1 Score: 8221.3 bits (21331), Expect = 0.000e+0
Identity = 4052/4076 (99.41%), Postives = 4056/4076 (99.51%), Query Frame = 2
Query:  113 MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYXXXXXXXXXXXXXQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNXXXXXXXXXXXXXXXKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVXXXXXXXXXXXXXXXXXXXXXAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVVDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSSAGNHHEQLIVGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFNIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRXXXXXXXXXXXXXXAGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQXXXXXXXXXXXXXXXXLNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIEDANLISRDTAHWMEVVIQKENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDXXXXXXXXXXXXXXXXXXXPQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS 12340
            MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYEVKKRGVGKVEEKQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNIITDLHIRILIRLLDKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVGIITPGGIGSTSGLSGTGSSSAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKV+DHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDS+AGNHHEQLI+GQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEF+IPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRLSINSTSSSLSKSL GTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQAEKKSGSEAAAEMEEELNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIE                  KENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDHESSEISHSSSEEAAVEIV QGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS
Sbjct:    1 MKHPDEEEISFLRTDDHVCLSSVGHGSSDRFCLSANGFGSRTCFLENLSLENNPPDLSLCVFILDQALSVRALQEVVAKGYDTNAIGGQSGHKTLLYGHAVLLKHTMSNMFLSCLSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADNGETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDECLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELIKTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGESSTAFYVRQSKDDKKSRWEEHEEDSMGSADIKFGETTVFLQHVSSNRWLSYEAYEVKKRGVGKVEEKQAVVLVEGHMDDGFTVAKGQDEESKSAAAIRRCASVFTRFIQVLDEWVMEEQRSSLSKMNLHEVIRCLEDLIDFFVRPNMDEEHEIKQAKLTALRNRQDLFQEEGIINLMLATIDKFTGAFKERRDFIQAMGEDKKEWFDQLSNYLYLLLAAMIRGNRANCAQFAQVSRMDWMFHRLESPQSAEGVLDVLHCVLTDSDEALNIITDLHIRILIRLLDKKGRDPRVLQVLCSLCMGRQGGAVRLNQCLIYDNLLPDRDLLLQTRLVDLCSSVRPNLFIGVEERSATYQKWYYEIRIDSIENVTNNKALLRVGWSNNEGFCPFPGGRQGWGSCAVGDDLFSFGFDGENLWTGGKPKRIRNVVQQPILNHGDIIGCMLDLTVPVIQFAINNEPVKGYFRDFNIDGMFYPCVSASAKVSVRMIFGGPHGRLRYGPPEGYSAMFEALLPKERLRLEPCFSFGNLEKSIYAGNSETKENVVFIPRPVETNEIQLPNYVENIRDKLAENIHEMWAMQKIDQGWTYGQNRDDLNKTHPCLTTFERLPHNERQFDVTLAYETLRTIVALGYTINYEMPSEGSRLKTIKLPNSFLQSNGYRPQPLDLLNISLSSHLETLVNQLAENTHNIWAMDRIKQGWSYGCVENNALKRSPHLVPYEKVDDSIKKSNRQTSMETVKTLLAYNYSIETPPTDVSEMAVSNSFNILKRKGSSAIRTFRAQSTWKVTSGKWYYEVELLTCGFMRFGWVMVDFESGCEIGSNSQSYAFDTESATKWNLESGPYGKICQPGDVIGCMLDLQDQTITFSLNGELMMDPMGQEIAFKNMSCDMGYVPGFSFGPGQYAKLNFGNDVHTLKYFTCCGLQEGYSPFCVNMSRPVPLWYSREDPCLFVDIDKENSKVEVQLHTGSVPTLKLISKIFGVQKSEMEFLRLGLPIKCKDHFTTKSLQERHASIELMRRQLDPIQVPTTQDLILEQMPSYPGTLNRNLTKNLQNMSSSTLDINKKGKKMRLGKNPFKKNRSRDASPDIVAGTTTKSKKHHVGIITPGGIGSTSGLSGTGSSSAVLGDLGQTSITKSTVDDNDYLLPEMQLRENSLVELMDQYYFSVVVLPGQDTKQIFIGWVTSSFKLSRSILMKCSDNQSFDTRVHKGKSTLDHKTKGDSKESNDWDVPHVTICQLENDLSLKSSVVDSCMYLINVADVLNNFGNQDDMGKKMSQGVTIGCFLDYATGNLTFELNSRELPISFQVAPMTSLYPAMFVKPTAREFASFELGRTRNTLPVIAGMLRRPRRATPILHSRLKLQMLQKSHWSRVVNAQSKIHILKLNEVRGWSLLNEESVQMMAVHIPEEDRCLDILELDEHPQLLRFHCETLELYKTICCYGNHNVAQSLTTHMDENQFFYIIQNHYLHGELRTKFFDLLIAMHLESHSRLKLETQNEIVVPLQCSLQSCRVTEKSYQKYHNHQKNSDFASSMEEIDFDFHKIPSQTESCSIYPNLISDDVTLKMLGENGEDIFPKLDMCPEINYERLKNISLKELANAVNKGAQIVEPIGGSPENIFVPLLKVIDHLLIMGMMLSNDINVILSVLDCATFKSKPALRMPRVTRSILDMPLQESVKLQLCHLLHGLCDIQLRHRIECIVQISNDFVSNIQNDQLRRYVEIKQSDLPSSVTAKMTKEFRCPPEDQMAGILNFHYTSLTCHEEKDDISCCAEELKRKINIFHRKLMDNCGIEPPEGLDINELLNQCFKTKRSRSLHLLPMGIGHPEEGESIPQFLQNILNLFERRPIEESKLCIETAKIDENKNLSQVIKGTLIAWAKSAFIENIDLIREMFSLLFRQYNALGEIQNSLKKTYVISYQSKDDVTQLLRSLGRVRCLLGVQVGEAEEMLLKNCLWDIMNNKVFFQHPNLTRRLAVHETVMQLMVHTLTRSKIGNTDNRSSIQVGFDSTAGNHHEQLIIGQSVTLANQNSMPALPEETTEVQKKKTDGPAEMVVQCCRFLCYFCRTSSQNQKTMFEHLSYMLENSSMLLARPSLRGTCPLDVAYSSLMDNNELALAIREKQLEKVAVYLSRSGVQSNVELLSKGYPDIGWDPVEGERFLDFLRFTVWVNGECMEENANLVVRLLIRRPECLGPALRGSSTAITRADPGTTAKESTVIFSATHATEGTTENIGTSHTSEFSIPKSHPAIATTKPNNVSGGGGLLKAMKEGIVMSAQIKLHKLAQEVEYGVSADENPQQKTLPMIFADYEDANLFAELPYNFHNLPPEDDPDYVDLGAAILTFYSVLVDLLGRCAPEHDTSKSSSLRVRAILQSLVSMEDLEGVLSLRFILPAPQMELTVNEDGEEEWKDKAGMPPGLLPEHKASVVLFLERVYGIQDCETFLRLLENAFLTDMRAATVLDMGSSGDSDFALALNRYLGNSVLPLLTKHSHYLGEWERTASILETTLHTAYRLSRCRSLTKGQREEVSDFLVALTQQLQPPMITKLLRKLIIDVPSLTPESVVPLRLLTAFYQRCGCYYSSTGMPGQGIANEEEKQLTGQLFSGIFDNLAKLPYDPELFSKALPCLTAIGCALSPDYSFQPSLGSIKISSIRSHSAQSPTGQSLAPGGPGVIEFEEQLDVEAAMASSSTDDDFKPQPVDTSHIRLPNSLESLLDQFAQHLHDSWALEMVEKGYVYGMTRNDLNKTHPNLISFDLLSQDDQMKYIEPVIEALKAMIAWGWTIDADLSRIEMHGERRRPTIINDGYNPNPKDLRGVNVTKEMLDMAEKLAENAHNIWAQGKKADMDSIGGGVHQMLVPFEILTDKEKSRYRKLTNELLKYLQYNGYRLSINSTSSSLSKSLVGTARHGLDRPSDSIDRSNWQRQKSQPTANGEYSKTSSETTRFAYVLLSKLLRYVEQAIVTVQQMRPSSRYSRNLPFSQETEDIKFFGKVVLPLVERYFGAHKNYFVGPQSMAFNEEKKMAATLFCKLFSLLRQKLTALGHDINISVRCLQGLVQAIDIRAIVKISSTSEDFVRVRLLPFFINCADDLTLLLQNLTMERFSHLKGTVERGAVSLNYMHMVLLPVLKSMFDHVSKTNTGGDLLVGDVQVACYKILNALYQLGTKSSQYTDREDIAEEFNRHRPLLGECVAAIAHTFPVAFLESHLNKNNKYSILYNCTGEYSLEAREILGELEKNLPNLDAIVEEIVDLAESGGKYTEAPHVIEVTLPMLCSYLPIWWSRGPENMHENATEEEISKPVTTVTAKLINNVLGNVLKLIRNNIDSPHAPWMTRIAMRTQPIVGNATINMLGEHFLPVAEKLKTHALRADKEEELYQAEKKSGSEAAAEMEEELNKQVEILVRNMFAFYPLLIKYVDLHRTAWIKQPTKDTDALFTVVAEIFMIWSKSVHFKREEQNFVCQNEIDHLSLIMPDQGSNNKSEASRSANNDSIGKKFLARKAKLSSYTSLNVACIKRLLPIGLSMFGGREQELIQKAKQRLIE------------------KENDGDIEEYLKNAIDLEEEDDDKTQIWQKVLYKKIGKAKFVDSSESVSKEIMIKRVLLLAKVLHGLYLVDHPPSLLKGSWKKLISSQRKRAVMACFRMLPLHSLPRHRGVNLFLTAYRSMWLSREEPITVRLIEEVTESTKDHESSEISHSSSEEAAVEIVSQGKEPRENSEGDSETSLELLPFTTTPDPLSQLITALKRTAMEQASDDSLYLSYAGIMSKSCS 4058          

HSP 2 Score: 96.2857 bits (238), Expect = 9.759e-19
Identity = 39/40 (97.50%), Postives = 39/40 (97.50%), Query Frame = 3
Query: 12387 QNLYKNKRWKNCKFWPNKTVYLIEVQQKWYCWKYVAAGVL 12506
            QNLYKNKRWKNCKFW NKTVYLIEVQQKWYCWKYVAAGVL
Sbjct: 4074 QNLYKNKRWKNCKFWLNKTVYLIEVQQKWYCWKYVAAGVL 4113          
BLAST of Ryanodine receptor related vs. Planmine SMEST
Match: SMESG000000645.1 (SMESG000000645.1)

HSP 1 Score: 1886.31 bits (4885), Expect = 0.000e+0
Identity = 958/960 (99.79%), Postives = 960/960 (100.00%), Query Frame = 2
Query: 13118 MQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDIVVGVFRXXXXXXXXXXXXXXXXXCFGGRFFLALVSGPKTSGDRLEYQESLQKRKAWLLPPEEQLILERLDPAEIALLDEYQEEGMYQPVTIHNVPDNTYYFNKIDDQDNISITEIDKQEINARLRSSTIVGPQRCQLDITDNKPSSDNTKQPDSSERQDFNIYQDNDKQXXXXXXXXXINPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEELKV 15997
            MQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDIVVGVFRLKLYLFTLLMLLLWNILCFGGRFFLALVSGPKTSGDRLEYQESLQKRKAWLLPPEEQLILERLDPAEIALLDEYQEEGMYQPVTIHNVPDNTYYFNKIDDQDNISITEIDKQEINARLRSSTIVGPQRCQLDITDNKPSSDNTKQPDSSERQDFNIYQDNDKQE++EEEEEEINPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEELKV
Sbjct:    1 MQDKLSKDPDQLELLREFMKLQKEMMIMLLSMLEGNVVNGPIGKQMVDTLVESSANVEMILKFFDIFLRMKDITSSEAFLAFDINKDGWISHKEFRTAMEQQKMYAPEEIEYIMMCVDSNNDGKVDFNEFTDRFHDPAKDIGFNVAVLLTNLYEHMPNDARLERLVSKAKRMIETFEPYLGRIEITGRSGRIERVYFEIRQSHIDQWEKPQIKDSKRSFLHSVVNEGGDKEKLESFVNFCEDTIYEMQHSQRISGEGEGLRLIQVSAIQDIIGTSKLLLMTKAFAKITSITSLLNWTNVKHSWKFLRSVSVKDIVVGVFRLKLYLFTLLMLLLWNILCFGGRFFLALVSGPKTSGDRLEYQESLQKRKAWLLPPEEQLILERLDPAEIALLDEYQEEGMYQPVTIHNVPDNTYYFNKIDDQDNISITEIDKQEINARLRSSTIVGPQRCQLDITDNKPSSDNTKQPDSSERQDFNIYQDNDKQEMKEEEEEEINPFEMKKIDTGTYIISLFAKNLYNFKIYALVLAFFINFMLLFYEVEQKPSSDPEKMNSTDPDDMEEFIILNDSVAYMGLLFKILAGLHSSFALSMLIAYYCLKVPLVLFKREKEISRMLEFEGMWITEQPTDDNLKAHWDKLVLSTPSFPQNYWDKFVKKKVRNKYSEQYDFNDICNLLGMNQPSEASGSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYIKDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPDGDPYENYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFPVGDCFRKQYEEELKV 960          
BLAST of Ryanodine receptor related vs. Planmine SMEST
Match: SMESG000061586.1 (SMESG000061586.1)

HSP 1 Score: 124.02 bits (310), Expect = 3.325e-27
Identity = 91/279 (32.62%), Postives = 145/279 (51.97%), Query Frame = 2
Query: 15161 GSRGWLRKKMIAWDIQYLIWKWGVIFTDNAFLYLGLYFVTSLIGNFNYFFFACHLLDVAISFKTLRTILQSVTHNGKQLVLTVMLTSVIIYLYTVIAFNFFRKFYI--------------KDNDGVKDMKCHNMLTCFVFHLHTGLRAGGGIGDEIESPD-GDPYENYRXXXXXXXXXXXXXXXXXXXQGLIIDAFGELRDQLEQVKEDMESKCFICGIGKEYFDKIPHGFEQHVEKEHNFANYMYFLMHIINKPDTEYTGQETYVWELYQQRCWDFFP 15952
            G+RG  +K     + ++LI    +I        LGL          +  F++  LLD+    +TL  +++SVT N + LVLT +L  ++ Y +T+    FF+  +                D D  K+  C  +  C    L+ GLR GGGIGD +  P   + +  +R+L D++F+F V VI+L +I G+IID F  LR   ++  E + + CFIC + +  FD     FE+H  +EHN  +Y+YF++ I  K  TE+TG E+YV E+ + +  D+FP
Sbjct: 2316 GNRGIAKKSWSDINSEFLIHSSSMICN-----VLGLLV--------HPLFYSVTLLDLIRREETLLNVIRSVTQNYRSLVLTTILGVILSYFFTIFGHLFFQDDFQMEPEFLDIISGKIGSDGDPEKERYCDTLGMCLTTTLYQGLRNGGGIGDILRKPSHKEKFFGFRVLHDLSFYFIVNVIILNLIFGVIIDTFASLRQNKQEKDEILRNTCFICALNRSAFDNKTVTFEEHFRREHNMWHYLYFIVLIKVKDPTEFTGPESYVSEMIKAKNLDWFP 2581          

HSP 2 Score: 63.1586 bits (152), Expect = 8.742e-9
Identity = 59/236 (25.00%), Postives = 104/236 (44.07%), Query Frame = 2
Query:  386 HKTLL-----YGHAVLLKHTMSNMFLSC-LSTSSSADKLAFDVGLQEEANSEACWWTVHPATKQRSEGEKVRIGDDLILVSVSSERYLHLTADN-------GETIQQSVIASFQQTLWTVIPVSSGAIRQKSIGMVFGGDVLRLFHGDE--CLTVPHSNGEHSPQHESVMYEIGAVSSHARSLWRLELI-KTKWSGGFITWGSKCRLRHVTSGRYLSVSGSGNEVTTVHRSQAGES 1045
            HK L+     YG  + L H  SN  L+      +  +K A  V L    N E  W+ V P  K  + G+ V +GD + L  V++ + LH+++ +        E    S   S+Q  L+          ++    ++ GGDV+RLFH ++   LT      +      +        ++ +++LW +E++ K    GG   W S  R +H+ +G+YL+     +    + RS+  +S
Sbjct:   79 HKKLVGTVVQYGTVIQLLHIKSNKLLTVNKRLPALLEKNAMRVSLDSNGN-EGSWFCVQPFYKHCAMGDNVVVGDKVTLNPVNAGQPLHVSSYDLLDHVGCKEINAVSCNTSWQINLFL-------EYKENMDDVLKGGDVVRLFHAEQEKFLTCDEYKKDQYVFLRTTGRTTATSATSSKALWEVEVVNKDACRGGAGKWSSLFRFKHLATGQYLAAEIDKDPTPDLMRSKLRKS 306          
The following BLAST results are available for this feature:
BLAST of Ryanodine receptor related vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5