WD repeat-containing protein

Overview
NameWD repeat-containing protein
Smed IDSMED30013227
Uniprot Best hitWD repeat-containing protein 63 OS=Homo sapiens OX=9606 GN=WDR63 PE=2 SV=1 (E=0)
Length (bp)3008
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein (SMED30013227) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein (SMED30013227) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein (SMED30013227) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein (SMED30013227) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013227

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013227SMESG000042025.1 SmedASXL_007719SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013227SMESG000042025.1 dd_Smed_v4_9187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013227SMESG000042025.1 dd_Smed_v4_9187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013227SMESG000042025.1 dd_Smed_v4_9187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013227SMESG000042025.1 dd_Smed_v4_9187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30013227SMESG000042025.1 dd_Smed_v4_9187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013227SMESG000042025.1 dd_Smed_v6_9187_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013227SMESG000042025.1 dd_Smed_v4_9187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013227SMESG000042025.1 dd_Smed_v4_9187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30013227SMESG000042025.1 dd_Smed_v4_9187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein vs. Ensembl Human
Match: WDR63 (WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:30711])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 339/847 (40.02%), Postives = 490/847 (57.85%), Query Frame = 1
Query:  421 PIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVL--TPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSS--KD-YVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKG---KMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVT--APADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKE------VQGDRXXXXXXXXXXXXXXQIITKPG-AQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P+ L+T T +IF  ++DE+++ +QP K I K++I  D+ +RAAVSDF  +K  ++ Y G E+++VYD +FK+G NF +   E  KE  L    V +++       PE          +Y+PP  K W+ LGS+KEI E  V  +   I  ++ R R EFG    FS++ +S  KD Y+E ++Y D +F+LK LE D  +   P I   ST T W YP+N+ TQY PR   EEE E    S+ ++     A   +  ++Q NEI N FIDD+  LA  +  F +KTD  LKE+Q+F DL    EK +TC+ WHPTI G+IA S+A + SF+ R+    K++L  S I+ WSF DPI PQ++LE+P D++CFKF P+DP+I+AGGCI+GQ+++WD+  H + ++N+K    + K   + P+F  E ++  +   +RH A+S  E+ H   I D+ WL D +EIN +G   EN +    Q+ T + D  I FWDIRP K +T      K  + I  P  VP TF +LD+ WKP  +V L K     DH PTK SL E       Q         E+ E+++     + G A   + +    T  +VGTE+GE++Y DW  +KD ++G+L + KP  +  +HDG V  + R PF   IIL VGGW  ++WKEGV +GP+LQSC +PK  T G WS TR  VF I R DG ++IWD+++KTHEP   QNI  T            K+Q +A  D  G LH+ EIP    + S +E+     YF++EV+  ++V +R  +REQEK E E+E  KK     Q   + E+M+  +K +YE YL+ E+  L  LGL
Sbjct:   41 PLVLTTKTQEIFNCRIDEDVTDEQPYKLINKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIATEEGKENYLNPPEVPEEQEEYKEHIPEDVY-------IYKPPVSKPWVSLGSEKEIEEESVTESTKQITYMISRKRSEFGAPIKFSDQNASSVKDAYIECTAYPDKNFTLKQLEKDVGMQVIPQIKDISTQTKWTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASISVEIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYGLIAVSVAVRLSFEDRVHFSGKLLLQPSLILFWSFSDPIHPQLMLESPDDIFCFKFCPSDPNIIAGGCINGQIVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLVTCSADCTICFWDIRPQKPLTPQTTEKKKEESIEIPFDVPSTFLHLDLSWKPLTKVRLSKGETSLDHCPTKISLNEDHLLCKTQDKMLAQSKTEKAEEMNPYHNLESGMANLLKPIDDFCTKFFVGTEEGEVIYTDWKMEKDPETGRLMSKKPVSHHTIHDGTVHTIQRSPFYNDIILTVGGWNVAIWKEGVMTGPLLQSCCAPKRYTSGHWSLTRPGVFYIGREDGYIDIWDLLEKTHEPAQSQNICITMITYIKPWIFSSKQQFIATADYYGTLHILEIPWTLSRPSTNEMASVNHYFEREVKHLEYVEQRKKIREQEKKEMELEMAKKKVKTYQK--SKEQMQAELKMDYESYLELEKTVLINLGL 878          
BLAST of WD repeat-containing protein vs. Ensembl Human
Match: WDR63 (WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:30711])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 325/847 (38.37%), Postives = 471/847 (55.61%), Query Frame = 1
Query:  421 PIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVL--TPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSS--KD-YVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKG---KMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVT--APADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKE------VQGDRXXXXXXXXXXXXXXQIITKPG-AQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P+ L+T T +IF  ++DE+++ +QP K I K++I  D+ +RAAVSDF  +K  ++ Y G E+++VYD +FK+G NF +   E  KE  L    V +++       PE          +Y+PP  K W+ LGS+KEI E  V  +   I  ++ R R EFG    FS++ +S  KD Y+E ++Y D +F+LK LE D  +   P I   ST T                    +C                      ++Q NEI N FIDD+  LA  +  F +KTD  LKE+Q+F DL    EK +TC+ WHPTI G+IA S+A + SF+ R+    K++L  S I+ WSF DPI PQ++LE+P D++CFKF P+DP+I+AGGCI+GQ+++WD+  H + ++N+K    + K   + P+F  E ++  +   +RH A+S  E+ H   I D+ WL D +EIN +G   EN +    Q+ T + D  I FWDIRP K +T      K  + I  P  VP TF +LD+ WKP  +V L K     DH PTK SL E       Q         E+ E+++     + G A   + +    T  +VGTE+GE++Y DW  +KD ++G+L + KP  +  +HDG V  + R PF   IIL VGGW  ++WKEGV +GP+LQSC +PK  T G WS TR  VF I R DG ++IWD+++KTHEP   QNI  T            K+Q +A  D  G LH+ EIP    + S +E+     YF++EV+  ++V +R  +REQEK E E+E  KK     Q   + E+M+  +K +YE YL+ E+  L  LGL
Sbjct:   41 PLVLTTKTQEIFNCRIDEDVTDEQPYKLINKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIATEEGKENYLNPPEVPEEQEEYKEHIPEDVY-------IYKPPVSKPWVSLGSEKEIEEESVTESTKQITYMISRKRSEFGAPIKFSDQNASSVKDAYIECTAYPDKNFTLKQLEKDVGMQVIPQIKDISTQT--------------------KCVEI-------------------ALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYGLIAVSVAVRLSFEDRVHFSGKLLLQPSLILFWSFSDPIHPQLMLESPDDIFCFKFCPSDPNIIAGGCINGQIVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLVTCSADCTICFWDIRPQKPLTPQTTEKKKEESIEIPFDVPSTFLHLDLSWKPLTKVRLSKGETSLDHCPTKISLNEDHLLCKTQDKMLAQSKTEKAEEMNPYHNLESGMANLLKPIDDFCTKFFVGTEEGEVIYTDWKMEKDPETGRLMSKKPVSHHTIHDGTVHTIQRSPFYNDIILTVGGWNVAIWKEGVMTGPLLQSCCAPKRYTSGHWSLTRPGVFYIGREDGYIDIWDLLEKTHEPAQSQNICITMITYIKPWIFSSKQQFIATADYYGTLHILEIPWTLSRPSTNEMASVNHYFEREVKHLEYVEQRKKIREQEKKEMELEMAKKKVKTYQK--SKEQMQAELKMDYESYLELEKTVLINLGL 839          
BLAST of WD repeat-containing protein vs. Ensembl Human
Match: WDR63 (WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:30711])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 325/847 (38.37%), Postives = 471/847 (55.61%), Query Frame = 1
Query:  421 PIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVL--TPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSS--KD-YVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKG---KMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVT--APADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKE------VQGDRXXXXXXXXXXXXXXQIITKPG-AQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P+ L+T T +IF  ++DE+++ +QP K I K++I  D+ +RAAVSDF  +K  ++ Y G E+++VYD +FK+G NF +   E  KE  L    V +++       PE          +Y+PP  K W+ LGS+KEI E  V  +   I  ++ R R EFG    FS++ +S  KD Y+E ++Y D +F+LK LE D  +   P I   ST T                    +C                      ++Q NEI N FIDD+  LA  +  F +KTD  LKE+Q+F DL    EK +TC+ WHPTI G+IA S+A + SF+ R+    K++L  S I+ WSF DPI PQ++LE+P D++CFKF P+DP+I+AGGCI+GQ+++WD+  H + ++N+K    + K   + P+F  E ++  +   +RH A+S  E+ H   I D+ WL D +EIN +G   EN +    Q+ T + D  I FWDIRP K +T      K  + I  P  VP TF +LD+ WKP  +V L K     DH PTK SL E       Q         E+ E+++     + G A   + +    T  +VGTE+GE++Y DW  +KD ++G+L + KP  +  +HDG V  + R PF   IIL VGGW  ++WKEGV +GP+LQSC +PK  T G WS TR  VF I R DG ++IWD+++KTHEP   QNI  T            K+Q +A  D  G LH+ EIP    + S +E+     YF++EV+  ++V +R  +REQEK E E+E  KK     Q   + E+M+  +K +YE YL+ E+  L  LGL
Sbjct:   41 PLVLTTKTQEIFNCRIDEDVTDEQPYKLINKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIATEEGKENYLNPPEVPEEQEEYKEHIPEDVY-------IYKPPVSKPWVSLGSEKEIEEESVTESTKQITYMISRKRSEFGAPIKFSDQNASSVKDAYIECTAYPDKNFTLKQLEKDVGMQVIPQIKDISTQT--------------------KCVEI-------------------ALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYGLIAVSVAVRLSFEDRVHFSGKLLLQPSLILFWSFSDPIHPQLMLESPDDIFCFKFCPSDPNIIAGGCINGQIVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLVTCSADCTICFWDIRPQKPLTPQTTEKKKEESIEIPFDVPSTFLHLDLSWKPLTKVRLSKGETSLDHCPTKISLNEDHLLCKTQDKMLAQSKTEKAEEMNPYHNLESGMANLLKPIDDFCTKFFVGTEEGEVIYTDWKMEKDPETGRLMSKKPVSHHTIHDGTVHTIQRSPFYNDIILTVGGWNVAIWKEGVMTGPLLQSCCAPKRYTSGHWSLTRPGVFYIGREDGYIDIWDLLEKTHEPAQSQNICITMITYIKPWIFSSKQQFIATADYYGTLHILEIPWTLSRPSTNEMASVNHYFEREVKHLEYVEQRKKIREQEKKEMELEMAKKKVKTYQK--SKEQMQAELKMDYESYLELEKTVLINLGL 839          
BLAST of WD repeat-containing protein vs. Ensembl Human
Match: WDR63 (WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:30711])

HSP 1 Score: 221.09 bits (562), Expect = 1.954e-63
Identity = 127/317 (40.06%), Postives = 183/317 (57.73%), Query Frame = 1
Query:  421 PIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNV--LTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSS--KD-YVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKG 1356
            P+ L+T T +IF  ++DE+++ +QP K I K++I  D+ +RAAVSDF  +K  ++ Y G E+++VYD +FK+G NF +   E  KE  L    V +++       PE          +Y+PP  K W+ LGS+KEI E  V  +   I  ++ R R EFG    FS++ +S  KD Y+E ++Y D +F+LK LE D  +   P I   ST T W YP+N+ TQY PR   EEE E    S+ ++     A   +  ++Q NEI N FIDD+  LA  +  F +KTD  LKE+Q+F DL    EK +TC+ WHPTI G
Sbjct:   41 PLVLTTKTQEIFNCRIDEDVTDEQPYKLINKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIATEEGKENYLNPPEVPEEQEEYKEHIPEDVY-------IYKPPVSKPWVSLGSEKEIEEESVTESTKQITYMISRKRSEFGAPIKFSDQNASSVKDAYIECTAYPDKNFTLKQLEKDVGMQVIPQIKDISTQTKWTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASISVEIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYG 350          
BLAST of WD repeat-containing protein vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 106.686 bits (265), Expect = 4.165e-23
Identity = 106/468 (22.65%), Postives = 172/468 (36.75%), Query Frame = 1
Query: 1312 EKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEV 2715
            ++A T + WHP     +A + +    F +    +S    + SYI  W   +P +P++ L+  S L   +FNP D H++ GGC +GQ+  WD           KG +                        A +S  ESSH  P+    WL                +    +  +A+ D ++++WDIR    ++ P +     I     +      + ++++ TL              PTKF                                             VGTE G  + +    +  + + K+  T P H+     GP+ A+ R PF     L VG W   +W E      I+ +      LTD AWSP R +VF  TR DG ++IWD + +  +PTL   +   +        N     L+A G   G   + E+        ++E N     F++E 
Sbjct:  162 KRAATHLSWHPDGNRKLAVAYS-CLDFQRAPVGMS----SDSYI--WDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTR---------KGSLV-----------------------AELSTIESSHRDPVYGTIWLQ---------------SKTGTECFSASTDGQVMWWDIR---KMSEPTEVVILDITKKEQLENALGAISLEFESTL--------------PTKF--------------------------------------------MVGTEQG--IVISCNRKAKTSAEKIVCTFPGHH-----GPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDEALFCLRVQDNGC---LIACGSQLGTTTLLEVSPGLSTLQRNEKNVASSMFERET 504          
BLAST of WD repeat-containing protein vs. Ensembl Fly
Match: CG14838 (gene:FBgn0035799 transcript:FBtr0076801)

HSP 1 Score: 145.591 bits (366), Expect = 4.784e-35
Identity = 147/613 (23.98%), Postives = 254/613 (41.44%), Query Frame = 1
Query:  997 NVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKA--------------------LPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKT-----SFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKN----VKGKMKSRNVMPLF---SFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLG--YSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQ----ALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPIL---QSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKE 2712
            +V ++P  + +   T   +P N+++QY    I +E+ E      +   + KKA                    +  ++ +++ N+I +Y  DDYS ++S   V    T+  L+EF  FA++    ++ V   +W+P + G+IA S A  T         R+D + + +L  + ++LWSF D +  ++  EAP +     F P +  I+ GG  +GQV+LWD++   E L         + K R ++  F   + + ++   +P    A IS  + S    I    WL     ++  G  Y+  ++        T A D  I FWD+   K   +  DK   ++           +  M  KPT   +LY   P             + G      CL     V + I   P     +T+      +   + V T  G +  +DW                  +  VHDGPV  V + PF   +   +G  + ++WKE  +  PI    ++C     LT  AWS TR +V  +TR DG +E WDI+ +  +  L + +              +  +++  GD N  + + ++P  F     +EL+  +KY  KE
Sbjct:  271 SVQSAPPKIEREQQTNPTFPSNAWSQY-LYEIDDEDLELDETDVDEEEEKKKAQAKPGTYVEPEKKPPEMSAQIEMLLNTLEFNQIDSYR-DDYSLISSRQVV--QYTNPYLQEFLCFANISKSNKRFVAGYDWYPKLSGLIAVSYAFSTPATVNEATNRVDYVQRAVLEPNPVLLWSFSDNLNYKLEFEAPIETTALTFCPFNGDILLGGSKNGQVVLWDLQGRCEKLDEEEYLTAAQAKYRIMIGEFLNWTIDIEDNVIVP----ATISLLDCSPKGAITAFYWLGRSIYLSQFGKVYNDPDIRNHHKFFVTCAFDGTISFWDL-DGKGGKSAKDKMRNRMLPKELTQSESAFKSMVIKPTY--NLYFPEP-------------ITGIIADTSCLSCLTPVAKLIQANPSNYPIKTIAKDPPTMRQSMIVSTFYGHVSRIDWQGTYTEGEATEVINSSIPFAMVHDGPVVMVKKNPFYPELFASIGRTILAIWKEDYNYSPIFWRKRACD----LTAVAWSETRPAVLYLTRIDGILEAWDILARDDDACLTEILGGGIITAITEHRPSLPHKILGIGDYNSSIRMVKLPHSFDVPLPNELDQLIKYVLKE 855          
BLAST of WD repeat-containing protein vs. Ensembl Fly
Match: Dnai2 (gene:FBgn0036195 transcript:FBtr0332765)

HSP 1 Score: 79.7221 bits (195), Expect = 5.763e-15
Identity = 46/124 (37.10%), Postives = 60/124 (48.39%), Query Frame = 1
Query: 2164 THIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLV 2535
            T    GTE G L   +         GK  T K +     H GPV A+TR P      L VG W   +W E      I+ + +S   LTDGAWS T+ S F ITR DG ++ WD++ + +EP L 
Sbjct:  329 TRFMAGTEMGMLFSCN-------RKGKTPTEKIQIRMMCHLGPVYAITRNPAFVKNFLTVGDWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLT 445          
BLAST of WD repeat-containing protein vs. Ensembl Fly
Match: Dnai2 (gene:FBgn0036195 transcript:FBtr0301326)

HSP 1 Score: 79.7221 bits (195), Expect = 6.888e-15
Identity = 46/124 (37.10%), Postives = 60/124 (48.39%), Query Frame = 1
Query: 2164 THIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLV 2535
            T    GTE G L   +         GK  T K +     H GPV A+TR P      L VG W   +W E      I+ + +S   LTDGAWS T+ S F ITR DG ++ WD++ + +EP L 
Sbjct:  329 TRFMAGTEMGMLFSCN-------RKGKTPTEKIQIRMMCHLGPVYAITRNPAFVKNFLTVGDWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLT 445          
BLAST of WD repeat-containing protein vs. Ensembl Fly
Match: CG10859 (gene:FBgn0032520 transcript:FBtr0080522)

HSP 1 Score: 60.4622 bits (145), Expect = 6.315e-9
Identity = 53/204 (25.98%), Postives = 78/204 (38.24%), Query Frame = 1
Query: 2272 WNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGD--------INGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAE 2859
            + +  GP+  V R PF     LVVG W   +W E V + P       P  L  GAWS  R S+F I    G +E WD++     P L               Y +    LV   D         NG   +  +    +  +  E +  M  F++E++R   +         E  E+E++ KK+          +EE K R K E
Sbjct:  379 YQLFAGPIRCVMRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSGAWSTGRCSLFCIGDNMGNLEFWDLLMSHKRPILT------------IKYKYAVTHLVFKPDGTMLTVSLANGDCLMLRLEEGMRSATNKEKSLMMSMFEREIQRCKLL---------EAREEEIKLKKRL----TTIFLEEERKSREKLE 557          
BLAST of WD repeat-containing protein vs. Ensembl Fly
Match: CG10859 (gene:FBgn0032520 transcript:FBtr0342635)

HSP 1 Score: 60.4622 bits (145), Expect = 6.315e-9
Identity = 53/204 (25.98%), Postives = 78/204 (38.24%), Query Frame = 1
Query: 2272 WNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGD--------INGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAE 2859
            + +  GP+  V R PF     LVVG W   +W E V + P       P  L  GAWS  R S+F I    G +E WD++     P L               Y +    LV   D         NG   +  +    +  +  E +  M  F++E++R   +         E  E+E++ KK+          +EE K R K E
Sbjct:  379 YQLFAGPIRCVMRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSGAWSTGRCSLFCIGDNMGNLEFWDLLMSHKRPILT------------IKYKYAVTHLVFKPDGTMLTVSLANGDCLMLRLEEGMRSATNKEKSLMMSMFEREIQRCKLL---------EAREEEIKLKKRL----TTIFLEEERKSREKLE 557          
BLAST of WD repeat-containing protein vs. Ensembl Zebrafish
Match: WDR63 (WD repeat domain 63 [Source:NCBI gene;Acc:100333131])

HSP 1 Score: 424.861 bits (1091), Expect = 2.219e-133
Identity = 269/898 (29.96%), Postives = 448/898 (49.89%), Query Frame = 1
Query:  406 PTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHE----------------------------------------GHVINNRPLIRTILQRSRREFGGAATFSEKPS---SKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIR-PNKAVTAPADKSSQQ----IATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYE---------------IPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P    P+ L++ + ++F  + DE+++ + P K + K +I+ D+  RAAV DFS +K  + +Y   E+++V+D +F +G++F + L   AKE +LK      +  +    ++  Q+     + + P P+ W+ LGS++                                              VI  R L  ++    RR  G    FS++ +    ++ VE SSYED SFS+  +E D +           T T WK P+N ++QYEPR    EE +    SEN+              +Q N IA+ F DD++ L   D     KT+  LKE+Q+F DL F KEK ++ ++WHP+I G+I  SM E+ S ++RID+ +K++L  S+I+ WSF DPI PQ+ LE P D+ CF+F+P+D +I+AGGC++GQV+LWD+  H++ L++ +   K  N++      +      P +R+ A+S  E+ H +PI D++WLP+ +E+N LG  +EN +  S+Q+ T A D  +LFWD+R P   V +  D   +Q    +  P GVP TF +L++ WKP +RV L K+   G+++P +FS++E   D           +  E    +       +    NT +++          +++P     SG     KP   + + D  +  V+R PF R IIL VG + +S+W+EG+  GP+L S  S    + G WS +R +V  + R DG VE+WD++  + +P+  QN        + +  + ++ Q  +     G  H Y                +P    Q    E     KYF+KE  R  +  +R +  +++K E E E +KK          +EE+      EY+ +L  E++ L+++ +
Sbjct:   18 PEYIFPLVLTSVSQELFGCRADEDVTAENPHKLLKKQDIIQDLRHRAAVCDFSPVKQAVLDYPEDELLLVFDRDFIYGQSFYLVLTVQAKESILK---PPAEGADEQMEDEEQQEEEEEMMTKTPEPQPWVSLGSEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLVYTPSAVLSSVICVRQLRYSVCPLGRRS-GTRVRFSDRNALDWKEELVECSSYEDKSFSITRMERDSSTQTCRDNTHTCTQTLWKKPKNMWSQYEPREFSSEEKQHQLQSENLKNFITSVARRFEIYLQQNLIADVFCDDWTALCEDDASLMGKTETQLKEYQSFMDLHFSKEKTISHVQWHPSISGVIVVSMMERLSLEERIDSSTKLLLNPSHILFWSFSDPINPQLQLECPDDVLCFQFSPSDHNIIAGGCMNGQVVLWDISAHVDRLQDTRSGGK--NILNKLGKSD----ATPVVRYCAVSGIENGHKAPITDIQWLPETFEVNKLGTPVENQSRTSVQLVTCAPDCCVLFWDLRAPRVMVHSLTDIKQKQEEKPLENPHGVPNTFTHLNLTWKPFIRVSLPKISSSGEYSPLRFSMRENTVD-------YNTGESSESFTDRFHLNSLYSADVFNTFLHITVH-------NFVP-----SG----AKPLDVFLLQDTLLHTVSRSPFFRDIILTVGRFSFSIWREGLTCGPLLMSVYSKSMFSAGHWSRSRPAVLFMGREDGDVEVWDLLQNSRQPSHTQN-------ISTAAISCIRTQTSS-----GNTHPYTETLHTHTHTQITESLLPTASLQRQNVE-----KYFEKEEERLQYFEKRQSDHQKKKKETEAEQQKKKTELVTPPKQEEEVNAETLKEYQQFLTLEKLILKDMNI 865          
BLAST of WD repeat-containing protein vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 101.679 bits (252), Expect = 1.083e-21
Identity = 92/408 (22.55%), Postives = 151/408 (37.01%), Query Frame = 1
Query: 1312 EKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLV 2535
            ++  T + WHP     +A + +    F +  ++++      SYI  W   +P +P++ L+    L C ++NP D HI+ GG  +GQ+  WD           KG                ++P         +S  E SH  P+    WL                +     I +A+ D ++L+WDIR    ++ P ++          +  +   + ++++ T+              PTKF                                             VGTE G +V  +          K    K    ++ H GPV A+ R PF     L VG W   +W E +    I+ +      L DG WSP R SVF   + DG +++WDI+ K ++PTL 
Sbjct:  164 KRTATSLSWHPDGNHKLAVAYS-SLEFQRAPNDMN----FDSYI--WDIENPNKPEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTR---------KG----------------SQP-------VEMSPIEFSHRDPVYKAIWLQ---------------SKTGTDIFSASTDGQVLWWDIR---KMSEPTERLVMDPTKKGNIDNSLGAISLEFETTM--------------PTKF--------------------------------------------MVGTEQGLVVSCN-------RKAKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIKESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDPTLC 449          
BLAST of WD repeat-containing protein vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 101.293 bits (251), Expect = 1.505e-21
Identity = 92/408 (22.55%), Postives = 151/408 (37.01%), Query Frame = 1
Query: 1312 EKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLV 2535
            ++  T + WHP     +A + +    F +  ++++      SYI  W   +P +P++ L+    L C ++NP D HI+ GG  +GQ+  WD           KG                ++P         +S  E SH  P+    WL                +     I +A+ D ++L+WDIR    ++ P ++          +  +   + ++++ T+              PTKF                                             VGTE G +V  +          K    K    ++ H GPV A+ R PF     L VG W   +W E +    I+ +      L DG WSP R SVF   + DG +++WDI+ K ++PTL 
Sbjct:  164 KRTATSLSWHPDGNHKLAVAYS-SLEFQRAPNDMN----FDSYI--WDIENPNKPEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTR---------KG----------------SQP-------VEMSPIEFSHRDPVYKAIWLQ---------------SKTGTDIFSASTDGQVLWWDIR---KMSEPTERLVMDPTKKGNIDNSLGAISLEFETTM--------------PTKF--------------------------------------------MVGTEQGLVVSCN-------RKAKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIKESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDPTLC 449          
BLAST of WD repeat-containing protein vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 96.2857 bits (238), Expect = 1.603e-20
Identity = 92/408 (22.55%), Postives = 151/408 (37.01%), Query Frame = 1
Query: 1312 EKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLV 2535
            ++  T + WHP     +A + +    F +  ++++      SYI  W   +P +P++ L+    L C ++NP D HI+ GG  +GQ+  WD           KG                ++P         +S  E SH  P+    WL                +     I +A+ D ++L+WDIR    ++ P ++          +  +   + ++++ T+              PTKF                                             VGTE G +V  +          K    K    ++ H GPV A+ R PF     L VG W   +W E +    I+ +      L DG WSP R SVF   + DG +++WDI+ K ++PTL 
Sbjct:   22 KRTATSLSWHPDGNHKLAVAYSS-LEFQRAPNDMN----FDSYI--WDIENPNKPEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTR---------KG----------------SQP-------VEMSPIEFSHRDPVYKAIWLQ---------------SKTGTDIFSASTDGQVLWWDIR---KMSEPTERLVMDPTKKGNIDNSLGAISLEFETTM--------------PTKF--------------------------------------------MVGTEQGLVVSCN-------RKAKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIKESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDPTLC 307          
BLAST of WD repeat-containing protein vs. Ensembl Zebrafish
Match: dnai2a (dynein, axonemal, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-070410-46])

HSP 1 Score: 73.559 bits (179), Expect = 6.737e-13
Identity = 49/152 (32.24%), Postives = 69/152 (45.39%), Query Frame = 1
Query: 2110 QIITKPGAQK-------ARTLQALNT--HIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPE--HYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            Q+I  P   K       A +++  NT     VGTE G +V  +          KL+TT       ++ H GPV AV R PF     L V  W   +W E +    I+ +      L DG WSP R +VF   + DG +++WDI+ K  +P L
Sbjct:  297 QLILDPAKSKNLNNAFGAFSMEFDNTMPKFLVGTEQGLVVLCN---------RKLETTDEPIVCTYSGHLGPVYAVQRNPFFPKYFLTVADWTARIWSEDIRLSSIMSTKYHTSHLMDGCWSPVRPAVFFTVKMDGTLDVWDILLKQKDPVL 439          
BLAST of WD repeat-containing protein vs. Ensembl Xenopus
Match: fer1l4 (fer-1-like family member 4, pseudogene (functional) [Source:Xenbase;Acc:XB-GENE-940776])

HSP 1 Score: 177.948 bits (450), Expect = 7.663e-46
Identity = 106/316 (33.54%), Postives = 169/316 (53.48%), Query Frame = 1
Query:  406 PTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSS--KD-YVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHP 1344
            P   +P+ L++ T +IF+ ++DE+I+ + P K I KD+I+ D+  RAAVSDF   K  +  Y G E+++V+D +FK+G+NF + + E AKE +L            LT E+  +       Y+PPSPK W+ LGS+KEI +  V  +   I+ ++ R +R+FG    F +  +S  KD Y+E +SY+D  FS+K+ E D  +   PF    ST T W YPRN+ TQY PR   EEE +A  +S++        + + I   Q + +A   +   +   +G      K    L  +   + ++ G +  +T I W P
Sbjct:   46 PDYIIPLVLTSKTQEIFQCRIDEDITQENPFKLIRKDDIINDLKGRAAVSDFHPFKALVTEYPGDELLLVFDRDFKYGQNFYLVITEEAKESIL-------HPPEALTEEEDKEDDEQEYSYKPPSPKPWVSLGSEKEIEDEMVKQSHTKIKFMISRIQRKFGAKVNFGDHNASDVKDGYMECTSYQDKRFSIKINERDTGIQVVPFTQENSTQTKWGYPRNACTQYTPREFTEEERKACLSSKDFKDFVNSVVLWDISKYQESLMAKAGVSKNTAPKTGLEPSVPKGPQ-LVRYCAVSSIEHGHKNVITDIHWLP 353          

HSP 2 Score: 122.479 bits (306), Expect = 5.861e-28
Identity = 63/162 (38.89%), Postives = 94/162 (58.02%), Query Frame = 1
Query: 1570 VILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTM-RHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKE 2052
            V+LWD+  + E L    G   S+N  P    E  + PK P + R+ A+S  E  H + I D+ WLP+++E++N G   EN +   +Q+ T + D  I+FWDIRP K +TA   K+ +    P GVP+TFKY+D+ W+P +R  L K    G+++P K SL E
Sbjct:  291 VVLWDISKYQESLMAKAGV--SKNTAPKTGLE-PSVPKGPQLVRYCAVSSIEHGHKNVITDIHWLPNNFELSNAGNPYENKSGYCLQLVTCSPDCSIMFWDIRPQKTLTAAEKKNVEDKQMPHGVPDTFKYIDLTWRPFIRAILPKSDMSGEYSPMKISLSE 449          

HSP 3 Score: 108.997 bits (271), Expect = 1.064e-23
Identity = 70/182 (38.46%), Postives = 100/182 (54.95%), Query Frame = 1
Query: 2368 KEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEV-EAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            KEG+H GPI  SC S K LT   WS +R+ VF I + DG V++WD+++KTHEP+  QNI++             K+  +A GD  G LH+ EIP   +  S +E      YF++EV+  ++  +R  LR   K + E+ +   K   +P V  T E+ ++    EYELYLQ E   L  LGL
Sbjct:  501 KEGLH-GPIFHSCCSQKRLTAAHWSLSRTGVFFIGKEDGNVDVWDLLEKTHEPSQTQNIAAAPIAYIRPWIASSKQHFLAVGDDQGTLHILEIPWNLRHPSANENASVQHYFEREVKHVEYSNQREGLRATAKKQLELKDLSAKTETSPPVK-TKEQTEVEQSKEYELYLQFEGSILSGLGL 680          
BLAST of WD repeat-containing protein vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 112.079 bits (279), Expect = 7.090e-25
Identity = 127/573 (22.16%), Postives = 213/573 (37.17%), Query Frame = 1
Query:  865 ILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLE---LDKNVTNSPFIVSKSTNT-TWKYPRNSYTQYE---PRRIPEEECEAFYN------SENMIIDSKKALPYIIE-SVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHY---WNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            +  R R EFG    FS++P+    + V    D S +L  +E    D  +  S  +     NT  ++         E   P+ I  +E E           ++  I +   L  ++E  ++ N   N + + +      + + +  + N +  F+   ++K    +  T + WHP     +A + +    F +   ++S     +SYI  W    P +P++ L+  S L C ++NP D H++ GGC +GQ+  WD               K  N                 M    I H   SH  P+  + WL                +    +  +A+ D +IL+WDIR    ++ P +K    I+    +      + ++++PTL              PTKF                                             VGTE G +V  +          +   T PE     +  H GP+ ++ R PF     L VG W   +W E      I+ +      LTD  WSPTR +VFL T+ DG +++WD + K + P+L
Sbjct:   12 VYTRKRSEFGRQCNFSDRPAE---LHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIK----RTATHLSWHPDGSRKLAVAYS-CLDFQRAPKDMS----YESYI--WDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTR-------------KGGN----------------PMESTVIEH---SHRDPVYKVIWLQ---------------SKTGTECFSASTDGQILWWDIR---KLSEPTEKLILDISKKENLDNALGAVSLEFEPTL--------------PTKF--------------------------------------------MVGTEQGMIVSCN----------RKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSL 452          
BLAST of WD repeat-containing protein vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 112.079 bits (279), Expect = 7.467e-25
Identity = 127/573 (22.16%), Postives = 213/573 (37.17%), Query Frame = 1
Query:  865 ILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLE---LDKNVTNSPFIVSKSTNT-TWKYPRNSYTQYE---PRRIPEEECEAFYN------SENMIIDSKKALPYIIE-SVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHY---WNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            +  R R EFG    FS++P+    + V    D S +L  +E    D  +  S  +     NT  ++         E   P+ I  +E E           ++  I +   L  ++E  ++ N   N + + +      + + +  + N +  F+   ++K    +  T + WHP     +A + +    F +   ++S     +SYI  W    P +P++ L+  S L C ++NP D H++ GGC +GQ+  WD               K  N                 M    I H   SH  P+  + WL                +    +  +A+ D +IL+WDIR    ++ P +K    I+    +      + ++++PTL              PTKF                                             VGTE G +V  +          +   T PE     +  H GP+ ++ R PF     L VG W   +W E      I+ +      LTD  WSPTR +VFL T+ DG +++WD + K + P+L
Sbjct:    6 VYTRKRSEFGRQCNFSDRPAE---LHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIK----RTATHLSWHPDGSRKLAVAYS-CLDFQRAPKDMS----YESYI--WDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTR-------------KGGN----------------PMESTVIEH---SHRDPVYKVIWLQ---------------SKTGTECFSASTDGQILWWDIR---KLSEPTEKLILDISKKENLDNALGAVSLEFEPTL--------------PTKF--------------------------------------------MVGTEQGMIVSCN----------RKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSL 446          
BLAST of WD repeat-containing protein vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 112.079 bits (279), Expect = 8.973e-25
Identity = 127/573 (22.16%), Postives = 213/573 (37.17%), Query Frame = 1
Query:  865 ILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLE---LDKNVTNSPFIVSKSTNT-TWKYPRNSYTQYE---PRRIPEEECEAFYN------SENMIIDSKKALPYIIE-SVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHY---WNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            +  R R EFG    FS++P+    + V    D S +L  +E    D  +  S  +     NT  ++         E   P+ I  +E E           ++  I +   L  ++E  ++ N   N + + +      + + +  + N +  F+   ++K    +  T + WHP     +A + +    F +   ++S     +SYI  W    P +P++ L+  S L C ++NP D H++ GGC +GQ+  WD               K  N                 M    I H   SH  P+  + WL                +    +  +A+ D +IL+WDIR    ++ P +K    I+    +      + ++++PTL              PTKF                                             VGTE G +V  +          +   T PE     +  H GP+ ++ R PF     L VG W   +W E      I+ +      LTD  WSPTR +VFL T+ DG +++WD + K + P+L
Sbjct:    6 VYTRKRSEFGRQCNFSDRPAE---LHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIK----RTATHLSWHPDGSRKLAVAYS-CLDFQRAPKDMS----YESYI--WDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTR-------------KGGN----------------PMESTVIEH---SHRDPVYKVIWLQ---------------SKTGTECFSASTDGQILWWDIR---KLSEPTEKLILDISKKENLDNALGAVSLEFEPTL--------------PTKF--------------------------------------------MVGTEQGMIVSCN----------RKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSL 446          
BLAST of WD repeat-containing protein vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 111.694 bits (278), Expect = 1.012e-24
Identity = 127/573 (22.16%), Postives = 213/573 (37.17%), Query Frame = 1
Query:  865 ILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLE---LDKNVTNSPFIVSKSTNT-TWKYPRNSYTQYE---PRRIPEEECEAFYN------SENMIIDSKKALPYIIE-SVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHY---WNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            +  R R EFG    FS++P+    + V    D S +L  +E    D  +  S  +     NT  ++         E   P+ I  +E E           ++  I +   L  ++E  ++ N   N + + +      + + +  + N +  F+   ++K    +  T + WHP     +A + +    F +   ++S     +SYI  W    P +P++ L+  S L C ++NP D H++ GGC +GQ+  WD               K  N                 M    I H   SH  P+  + WL                +    +  +A+ D +IL+WDIR    ++ P +K    I+    +      + ++++PTL              PTKF                                             VGTE G +V  +          +   T PE     +  H GP+ ++ R PF     L VG W   +W E      I+ +      LTD  WSPTR +VFL T+ DG +++WD + K + P+L
Sbjct:    6 VYTRKRSEFGRQCNFSDRPAE---LHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIK----RTATHLSWHPDGSRKLAVAYS-CLDFQRAPKDMS----YESYI--WDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTR-------------KGGN----------------PMESTVIEH---SHRDPVYKVIWLQ---------------SKTGTECFSASTDGQILWWDIR---KLSEPTEKLILDISKKENLDNALGAVSLEFEPTL--------------PTKF--------------------------------------------MVGTEQGMIVSCN----------RKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSL 446          
BLAST of WD repeat-containing protein vs. Ensembl Mouse
Match: Wdr63 (WD repeat domain 63 [Source:MGI Symbol;Acc:MGI:3045269])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 336/875 (38.40%), Postives = 501/875 (57.26%), Query Frame = 1
Query:  421 PIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSS--KD-YVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKG---KMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVT--------------------APADKSSQQ-IATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKE------VQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQA-----------LNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVE-AKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P+ L+T T +IF  +VDE+++ +Q  K I K++I+ D+ +RAAVSDF  +K  ++ Y G+E+++VYD +FK+G NF +   E  KE  LK     +       P++ +Q+ +   VY PP  K W+ LGS+KEI E  V  +   +  ++ R R EFG   TFS++ +S  KD Y+E +SY + +++L  +E D  +     +   ST T W +P+N+ TQY PR   EEE      S++++         +  ++Q NEI N FIDD+  LA  ++ F +KTD  LKE+Q+F DL    EK +TC+ WHPTI G+I  S+A + S+++R+ N  +++L  S ++ WSF DPI PQ++LE+P D++CF+F P+DP+I+AGGCI+GQ++LWD+  H + ++N+K    + K  ++ P+F  E D+  +   +RH A+S  E+ H   I D+ WLPD +EIN +G   EN +  + Q+ T + D  I FWDIRP K                       +P +K  ++ I  P  VP TF +LD+ WKP  R+ L K     DH PTK SL E      +QG   +   L +K     +++        + L+A             T  +VGTE+GE++Y DW  ++DSD+G+L   KP   + VHDG V  + R PF   I+L VGGW  ++WKE V +GP+LQ+C  PK  T G WS TR  VF I R DG V+IWD+++KTHEP   QNI  T            K+Q +A  D  G LH+ EIP      S +E++    YF++EVR  ++V++R  +REQEKI+  +E  KKKA I  +   T E+M+  +K EYE YL  E+  L  LGL
Sbjct:   44 PLVLTTKTQEIFNCRVDEDMTDEQTYKLIKKEDILADLQNRAAVSDFHPVKKIVREYPGEELLLVYDKDFKYGLNFYLIGTEDGKENFLK---PPEVPEEQEEPKEHVQEDVY--VYNPPVSKPWVSLGSEKEIEEESVQESGKRVTYMISRKRSEFGAPVTFSDQNASSVKDAYIECTSYPEKNYTLSQVEKDVGLQVIAEVKDTSTQTKWAFPKNATTQYYPREFSEEEKSLIGKSKSLVDFFNNVSTSVEVALQQNEIMNTFIDDWKNLAEEESTFGDKTDTHLKEYQSFTDLHNTMEKMITCVSWHPTIFGLIVVSVAVRLSYEERVQNSGRLLLQPSLLLFWSFSDPIHPQLMLESPDDIFCFEFCPSDPNIIAGGCINGQIVLWDITAHADRIENIKTGGHRSKKTSLKPMFLLEPDSNKESMYIRHCAVSSIENGHRKVITDIHWLPDSFEINRMGSVFENRSGINCQLVTCSADCTICFWDIRPQKPAVTAAAAASAATTATNNANSQQSPVEKKKEENIDIPFDVPSTFLHLDLSWKPLSRLKLSKGDTSLDHCPTKLSLGEDPFLCKIQGTSSIHIILRDKMLSQIKMVKTSEINPYQNLEAGIANILKPIEDFCTKFFVGTEEGEVIYTDWKMERDSDTGRLMAKKPVSLYTVHDGAVHTIQRSPFFNDIVLTVGGWNVAIWKEEVMTGPLLQTCCGPKRYTAGHWSLTRPGVFYIGREDGNVDIWDLLEKTHEPAQSQNICITMITYIKPWTFSSKQQFIAVADYYGTLHILEIPWTLSHPSLNEVSSVNYYFEREVRHLEYVQQRKEIREQEKIDMALELVKKKAKIYQK---TKEQMEAELKLEYESYLDLEKSVLFALGL 910          
BLAST of WD repeat-containing protein vs. Ensembl Mouse
Match: Dnaic2 (dynein, axonemal, intermediate chain 2 [Source:MGI Symbol;Acc:MGI:2685574])

HSP 1 Score: 101.293 bits (251), Expect = 1.472e-21
Identity = 92/411 (22.38%), Postives = 148/411 (36.01%), Query Frame = 1
Query: 1312 EKAVTCIEWHPTIKGIIATSMA----EKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            ++  T + WHP     +A + +    ++       D         SYI  W   +P +P+I L+  S L   ++NP D H++ GGC +GQ+  WD           KG +                        A +S  E SH  P+    WL                +    +  +A+ D ++++WDIR    ++ P +     I+    +      + ++++ TL              PTKF                                             VGTE G ++  +          K Q  K    +  H GP+ A+ R PF     L VG W   +W E      I+ +      L+DGAWSP R +VF  T+ DG ++IWD++ K  +P L
Sbjct:  162 KRTATHLSWHPDGNRKLAVAYSCLKFQRAPMSMNYD---------SYI--WDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTR---------KGSLV-----------------------AELSTIEFSHRDPVYGTIWLQ---------------SKTGTECFSASTDGQVMWWDIR---KISEPIEVVIMDISRKEQLENALGAISLEFESTL--------------PTKF--------------------------------------------MVGTEQGIVISCN-------RKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPAL 446          
BLAST of WD repeat-containing protein vs. Ensembl Mouse
Match: Dnaic2 (dynein, axonemal, intermediate chain 2 [Source:MGI Symbol;Acc:MGI:2685574])

HSP 1 Score: 100.908 bits (250), Expect = 2.166e-21
Identity = 86/366 (23.50%), Postives = 134/366 (36.61%), Query Frame = 1
Query: 1435 SYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            SYI  W   +P +P+I L+  S L   ++NP D H++ GGC +GQ+  WD           KG +                        A +S  E SH  P+    WL                +    +  +A+ D ++++WDIR    ++ P +     I+    +      + ++++ TL              PTKF                                             VGTE G ++  +          K Q  K    +  H GP+ A+ R PF     L VG W   +W E      I+ +      L+DGAWSP R +VF  T+ DG ++IWD++ K  +P L
Sbjct:  198 SYI--WDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTR---------KGSLV-----------------------AELSTIEFSHRDPVYGTIWLQ---------------SKTGTECFSASTDGQVMWWDIR---KISEPIEVVIMDISRKEQLENALGAISLEFESTL--------------PTKF--------------------------------------------MVGTEQGIVISCN-------RKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPAL 446          
BLAST of WD repeat-containing protein vs. Ensembl Mouse
Match: Dnaic2 (dynein, axonemal, intermediate chain 2 [Source:MGI Symbol;Acc:MGI:2685574])

HSP 1 Score: 100.908 bits (250), Expect = 2.166e-21
Identity = 86/366 (23.50%), Postives = 134/366 (36.61%), Query Frame = 1
Query: 1435 SYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            SYI  W   +P +P+I L+  S L   ++NP D H++ GGC +GQ+  WD           KG +                        A +S  E SH  P+    WL                +    +  +A+ D ++++WDIR    ++ P +     I+    +      + ++++ TL              PTKF                                             VGTE G ++  +          K Q  K    +  H GP+ A+ R PF     L VG W   +W E      I+ +      L+DGAWSP R +VF  T+ DG ++IWD++ K  +P L
Sbjct:  198 SYI--WDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTR---------KGSLV-----------------------AELSTIEFSHRDPVYGTIWLQ---------------SKTGTECFSASTDGQVMWWDIR---KISEPIEVVIMDISRKEQLENALGAISLEFESTL--------------PTKF--------------------------------------------MVGTEQGIVISCN-------RKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPAL 446          
BLAST of WD repeat-containing protein vs. Ensembl Mouse
Match: Wdr34 (WD repeat domain 34 [Source:MGI Symbol;Acc:MGI:1919070])

HSP 1 Score: 70.0922 bits (170), Expect = 8.311e-12
Identity = 51/194 (26.29%), Postives = 83/194 (42.78%), Query Frame = 1
Query: 1297 LKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSF----LDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFW 1866
            L  G+   VT I W+ T   ++A +         R+D+     L KSY+  W+     L+P QP +++E PS + C  F+PT P  +AGG  SG+V++WDM                            + P+ P +    ++  + +H  P+  + WLP            E   +   Q+ +AA D K+L W
Sbjct:  157 LAQGQGLHVTGISWNST-GSVLACAYG-------RLDDGDWSTL-KSYVCTWNLDRQGLNPQQPSVVVEVPSAVMCLAFHPTQPSHIAGGLYSGEVLVWDM----------------------------SRPEDPLLWRTGLT--DDTHTDPVYQVLWLP------------EPRHSHRFQVLSAATDGKVLLW 299          

HSP 2 Score: 55.0694 bits (131), Expect = 3.860e-7
Identity = 36/136 (26.47%), Postives = 61/136 (44.85%), Query Frame = 1
Query: 2281 HDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELND 2688
            H GPV +V+  PF R + L  G          + + P+     S K L    WSP R  VF     +G V+++D+   + +PT+    +   +      +N  + QL+A GD  G + V+++   F +    E+ D
Sbjct:  392 HGGPVYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAQPLTSLQLSHKYLFAVRWSPVRPLVFAAASGEGDVQLFDLQKSSQKPTVSITQTQDGSPVYCLEFNSQQTQLLAAGDAKGMVKVWQLSTAFTEQGPREVED 527          
BLAST of WD repeat-containing protein vs. UniProt
Match: sp|Q8IWG1|WDR63_HUMAN (WD repeat-containing protein 63 OS=Homo sapiens OX=9606 GN=WDR63 PE=2 SV=1)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 339/847 (40.02%), Postives = 490/847 (57.85%), Query Frame = 1
Query:  421 PIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVL--TPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSS--KD-YVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKG---KMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVT--APADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKE------VQGDRXXXXXXXXXXXXXXQIITKPG-AQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P+ L+T T +IF  ++DE+++ +QP K I K++I  D+ +RAAVSDF  +K  ++ Y G E+++VYD +FK+G NF +   E  KE  L    V +++       PE          +Y+PP  K W+ LGS+KEI E  V  +   I  ++ R R EFG    FS++ +S  KD Y+E ++Y D +F+LK LE D  +   P I   ST T W YP+N+ TQY PR   EEE E    S+ ++     A   +  ++Q NEI N FIDD+  LA  +  F +KTD  LKE+Q+F DL    EK +TC+ WHPTI G+IA S+A + SF+ R+    K++L  S I+ WSF DPI PQ++LE+P D++CFKF P+DP+I+AGGCI+GQ+++WD+  H + ++N+K    + K   + P+F  E ++  +   +RH A+S  E+ H   I D+ WL D +EIN +G   EN +    Q+ T + D  I FWDIRP K +T      K  + I  P  VP TF +LD+ WKP  +V L K     DH PTK SL E       Q         E+ E+++     + G A   + +    T  +VGTE+GE++Y DW  +KD ++G+L + KP  +  +HDG V  + R PF   IIL VGGW  ++WKEGV +GP+LQSC +PK  T G WS TR  VF I R DG ++IWD+++KTHEP   QNI  T            K+Q +A  D  G LH+ EIP    + S +E+     YF++EV+  ++V +R  +REQEK E E+E  KK     Q   + E+M+  +K +YE YL+ E+  L  LGL
Sbjct:   41 PLVLTTKTQEIFNCRIDEDVTDEQPYKLINKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIATEEGKENYLNPPEVPEEQEEYKEHIPEDVY-------IYKPPVSKPWVSLGSEKEIEEESVTESTKQITYMISRKRSEFGAPIKFSDQNASSVKDAYIECTAYPDKNFTLKQLEKDVGMQVIPQIKDISTQTKWTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASISVEIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYGLIAVSVAVRLSFEDRVHFSGKLLLQPSLILFWSFSDPIHPQLMLESPDDIFCFKFCPSDPNIIAGGCINGQIVMWDITAHADRIENIKAGGSRSKRATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLVTCSADCTICFWDIRPQKPLTPQTTEKKKEESIEIPFDVPSTFLHLDLSWKPLTKVRLSKGETSLDHCPTKISLNEDHLLCKTQDKMLAQSKTEKAEEMNPYHNLESGMANLLKPIDDFCTKFFVGTEEGEVIYTDWKMEKDPETGRLMSKKPVSHHTIHDGTVHTIQRSPFYNDIILTVGGWNVAIWKEGVMTGPLLQSCCAPKRYTSGHWSLTRPGVFYIGREDGYIDIWDLLEKTHEPAQSQNICITMITYIKPWIFSSKQQFIATADYYGTLHILEIPWTLSRPSTNEMASVNHYFEREVKHLEYVEQRKKIREQEKKEMELEMAKKKVKTYQK--SKEQMQAELKMDYESYLELEKTVLINLGL 878          
BLAST of WD repeat-containing protein vs. UniProt
Match: sp|Q95JP0|WDR63_MACFA (WD repeat-containing protein 63 OS=Macaca fascicularis OX=9541 GN=WDR63 PE=2 SV=1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 331/848 (39.03%), Postives = 485/848 (57.19%), Query Frame = 1
Query:  421 PIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDD--EGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSS--KD-YVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKG---KMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVT--APADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKE------VQGDRXXXXXXXXXXXXXXQIITKPG-AQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXX-XXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P+ L+T T +IF  ++DE+I+ +QP K I K++I  D+ +RAAVSDF  +K  ++ Y G E+++VYD +FK+G NF +   E  +E  L    V ++  E     PE          +Y+PP  K W+ LGS+KEI E  V  +   I  ++ R R EFG    FS++ +S  KD Y+E ++Y D +F+LK LE D  +   P I   ST T W YP+N+ TQY PR   EEE E    S+ ++     A   +  ++Q NEI N FIDD+  LA  +  F +KTD  LKE+Q+F DL    EK +TC+ WHPTI G+IA S+A + SF+ R+    K++L  S I+ WSF DPI PQ++LE+P D++CFKF P+DP+I+AGGCI+GQ+++WD+  H + ++N+KG   + K   + P+F  E ++  +   +RH A+S  E+ H   I D+ WL D +EIN +G   EN +    Q+ T + D  I FWDIRP K +T      K  + I  P  VP TF +LD+ WKP  ++ L K     DH PTK SL E       Q          + E+++     + G A   + +    T  +VGTE+GE++Y DW  ++D ++G+    KP +   +HDG V  + R PF   IIL VGGW  ++WKE V +GP+LQSC +PK  T G WS TR  VF I R DG ++IWD+++KTHEP   QNI  T            K+Q +A  D  G LH+ EIP      S +E+     YF++EV+  ++V +R     +++K  ++  AKKK  I  +   + E+M+  +K +YE YL+ E+  L  LGL
Sbjct:   41 PLVLTTKTQEIFNCRIDEDITDEQPYKLINKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIGTEEGEENYLNPPEVSEEQEEYKEYIPEDVY-------IYKPPVSKPWVSLGSEKEIEEESVTESTKQITYMISRKRSEFGAPIKFSDQNASSVKDAYIECTAYPDKNFTLKQLEKDVGMQVIPQIKDISTQTKWTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASISVEIALQQNEITNTFIDDWKHLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYGLIAVSVAVRLSFEDRVHFSGKLLLQPSLILFWSFSDPIHPQLMLESPDDIFCFKFCPSDPNIIAGGCINGQIVMWDITAHADRIENIKGGGSRSKKATLKPMFLLEPESNKEAMYIRHCAVSSIENGHKRVITDIHWLSDTFEINRMGSVFENRSGICCQLVTCSADCTICFWDIRPQKPLTPQTTEKKKEESIEIPFDVPSTFLHLDLSWKPLTKLKLSKGETSLDHCPTKISLNEDHLLCKTQDKMLAQSKTAKAEEMNPYHNLESGVANLLKPIDDFCTKFFVGTEEGEVIYTDWKMERDPETGRFMPKKPVNLHTIHDGIVHTIQRSPFYDDIILTVGGWNVAIWKESVMTGPLLQSCCAPKRYTSGHWSLTRPGVFYIGREDGYIDIWDLLEKTHEPAQSQNICITMITCIKPWIFSPKQQFIAIADYYGTLHILEIPWTLSHPSANEMASINHYFEREVKHLEYVEQRKKIREQEKKEMEQEMAKKKVKIYQK---SKEQMEAELKMDYESYLELEKTVLINLGL 878          
BLAST of WD repeat-containing protein vs. UniProt
Match: sp|Q9GZS0|DNAI2_HUMAN (Dynein intermediate chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAI2 PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 2.000e-22
Identity = 106/468 (22.65%), Postives = 172/468 (36.75%), Query Frame = 1
Query: 1312 EKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEV 2715
            ++A T + WHP     +A + +    F +    +S    + SYI  W   +P +P++ L+  S L   +FNP D H++ GGC +GQ+  WD           KG +                        A +S  ESSH  P+    WL                +    +  +A+ D ++++WDIR    ++ P +     I     +      + ++++ TL              PTKF                                             VGTE G  + +    +  + + K+  T P H+     GP+ A+ R PF     L VG W   +W E      I+ +      LTD AWSP R +VF  TR DG ++IWD + +  +PTL   +   +        N     L+A G   G   + E+        ++E N     F++E 
Sbjct:  162 KRAATHLSWHPDGNRKLAVAYS-CLDFQRAPVGMS----SDSYI--WDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTR---------KGSLV-----------------------AELSTIESSHRDPVYGTIWLQ---------------SKTGTECFSASTDGQVMWWDIR---KMSEPTEVVILDITKKEQLENALGAISLEFESTL--------------PTKF--------------------------------------------MVGTEQG--IVISCNRKAKTSAEKIVCTFPGHH-----GPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDEALFCLRVQDNGC---LIACGSQLGTTTLLEVSPGLSTLQRNEKNVASSMFERET 504          
BLAST of WD repeat-containing protein vs. UniProt
Match: sp|Q16960|DYI3_HELCR (Dynein intermediate chain 3, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 2.510e-22
Identity = 130/578 (22.49%), Postives = 208/578 (35.99%), Query Frame = 1
Query:  865 ILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLE---LDKNVTNSPFIVSKSTNT----TWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYI---IESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMA----EKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRP-----NKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHY---WNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            +  + R EFG    FS++P+    + V    D S     +E   +D+ +     +     NT    T     N      P+ I  +E E        +   +  +  I     S++H    N  ID Y    +   + + +     K    F D    K  A T + W+P     +A + +    +KTS +  +D         SYI  W   +P +P+ +L+  S L C ++NP D H++ GGC +GQV  WD           KG                        +   +S  E SH  P+    WL                +    +  +A+ D ++L+WD+R       K +  P+ K   + A   GV      + ++++PT+              PTKF                                             VGTE G ++  +          +   T PE     +  H GPV ++ R PF     L VG W   +W E +    I+ +      LTDG WSP R +VF  T+ DG +++WD + K  +PTL
Sbjct:    6 VYTKKRSEFGRQCNFSDRPAE---LHVDILPDESLLSNFIEKNPVDRGIQCVQEMSEHEINTERFETDSRGINHMEGGWPKDINPQEVEQVLRFRKKVEKDESYVTTIQNLASSMEHTIKQNNAIDIYEDYFADLEIEEVEETPSAKTINVFRDPNEIKRPA-THLSWYPDGPKKLAVAYSSLEFQKTSAETSMD---------SYI--WDIENPNKPEFVLKPVSPLVCLEYNPKDVHVLIGGCYNGQVAFWDTR---------KGS-----------------------QAVEMSPVEHSHHDPVYKTIWLQ---------------SKTGTECFSASTDGQVLWWDMRKLGEPTEKLIMDPSKKGKMENA--QGV------ISLEYEPTI--------------PTKF--------------------------------------------MVGTEQGTIISCN----------RKAKTPPEKIVAIYKEHIGPVYSLQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHMSYLTDGCWSPVRPAVFFTTKMDGSLDVWDYLFKQKDPTL 445          
BLAST of WD repeat-containing protein vs. UniProt
Match: sp|A2AC93|DNAI2_MOUSE (Dynein intermediate chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnai2 PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 1.515e-20
Identity = 86/366 (23.50%), Postives = 134/366 (36.61%), Query Frame = 1
Query: 1435 SYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            SYI  W   +P +P+I L+  S L   ++NP D H++ GGC +GQ+  WD           KG +                        A +S  E SH  P+    WL                +    +  +A+ D ++++WDIR    ++ P +     I+    +      + ++++ TL              PTKF                                             VGTE G ++  +          K Q  K    +  H GP+ A+ R PF     L VG W   +W E      I+ +      L+DGAWSP R +VF  T+ DG ++IWD++ K  +P L
Sbjct:  198 SYI--WDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTR---------KGSLV-----------------------AELSTIEFSHRDPVYGTIWLQ---------------SKTGTECFSASTDGQVMWWDIR---KISEPIEVVIMDISRKEQLENALGAISLEFESTL--------------PTKF--------------------------------------------MVGTEQGIVISCN-------RKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPAL 446          
BLAST of WD repeat-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20398111 (tr|A0A419QC02|A0A419QC02_CLOSI WD repeat-containing protein 63 OS=Clonorchis sinensis OX=79923 GN=WDR63 PE=4 SV=1)

HSP 1 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 424/855 (49.59%), Postives = 586/855 (68.54%), Query Frame = 1
Query:  367 KDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQ----ALQQSMLS-GVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYVE--VSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            K  + ++ A + L  GC+P+FLS  T  +F +  DEN++  +P   I K +I+ DI  RA+VSDFSV K  I +Y+G EI+++YD + KFGENF++  NE AK  +L     I+D+ + L+ ++     L+++  S   +RP   + WI LGSDKE+ E  +I  RP + TI QR RREFG   TFS++ ++       V++  + +  + ++E+DK+V+N+     + TNT WKYPRN++TQY PR +  EE +  Y     + D  K  P + + +  N + ++   D+  LA+GD  +D + DN  KEF +F DLKF K+KAVT I+WHPTIKGI+  S+ E+  +D R D  S+++LT ++IILWSF DPIQPQ+LLEAP D+ CF+FNPTDP+IVAGGC +G V+LWD+E HMEDL+ VK +MK++N  PLFSF++ +  ++P   + AIS+ E+SH SPI+DLKW+PDH EIN LGY LEN++ K +Q+ T+  +N++LFWDIRP+++  A  DK+   I  P  VP TF  LDMKWKP LRVHLYK   GGDHAPTKF ++E QGDR++L    E          K    K + LQ  +T +YVGTEDG+LVYVDWMPQKD D+GK+QT KPE Y   HDGP++ + R PF+ +++LVVGGW WS+WKEGV+SGP+L+S  + KPLT G+WSPTR SVF I RADG +E+WD++DKTHEP +VQ+  S +ALT IS+ NF K+Q+VA GD  G L ++ +P R +    SEL +   Y ++EVRRR+FV  RWN+REQEKIEQE E K++AGIAP V LT+EE   +   EYE YL++EQ FLR+LGL
Sbjct:   57 KPDILDLFAKDELMEGCIPLFLSKATQQVFNIVADENVTKLKPSALIPKSDILKDIQLRASVSDFSVHKTIINDYNGLEILVIYDADMKFGENFVLVTNEEAKNHILN---PIEDQMDQLSGDEDSDAELEEASDSVTFFRPNIRRPWISLGSDKEVMESSIIETRPKVYTIFQRPRREFGAPVTFSDRDATDKGASSLVTTIPEKANEIPIMEVDKSVSNAQLTSERGTNTDWKYPRNAFTQYTPRVLTAEELQTMYAPGGPLQDIGKHFPTLKQGLLQNMMYDFLASDFENLAAGDETYDTRADNTFKEFLSFTDLKFSKDKAVTDIQWHPTIKGIVGMSVGERIDYDHRADQSSRILLTSTHIILWSFADPIQPQLLLEAPEDILCFQFNPTDPNIVAGGCFNGMVVLWDIEKHMEDLRKVKARMKAKNKAPLFSFDDTDPNRVPVSPYCAISNIEASHTSPILDLKWVPDHVEINRLGYCLENVSLKCVQLITSGLNNELLFWDIRPDRSPLA-VDKTRDSILPPRNVPTTFMALDMKWKPLLRVHLYKSEAGGDHAPTKFCIREAQGDRRILSANAEDRTNPTM---KSSTLKNKPLQGASTMLYVGTEDGDLVYVDWMPQKDPDTGKMQTPKPEFYATQHDGPISYLARSPFEPSVLLVVGGWTWSIWKEGVNSGPLLESGHAQKPLTGGSWSPTRPSVFFICRADGSLEVWDLLDKTHEPAMVQS-VSANALTAISLCNFSKRQIVAIGDTQGALQLFVVPRRLRSILASELANFNAYIEREVRRREFVLMRWNIREQEKIEQEAERKRQAGIAPAVVLTEEETLQKEALEYEEYLKNEQSFLRQLGL 903          
BLAST of WD repeat-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20424784 (tr|H2KPD8|H2KPD8_CLOSI WD repeat-containing protein 63 OS=Clonorchis sinensis OX=79923 GN=CLF_101811 PE=4 SV=1)

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 419/855 (49.01%), Postives = 582/855 (68.07%), Query Frame = 1
Query:  367 KDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQ----ALQQSMLS-GVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYVE--VSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            K  + ++ A + L  GC+P+FLS  T  +F +  DEN++  +P   I K +I+ DI  RA+VSDFSV K  I +Y+G EI+++YD + KFGENF++  NE AK  +L     I+D+ + L+ ++     L+++  S   +RP   + WI LGSDKE+ E  +I  RP + TI QR RREFG   TFS++ ++       V++  + +  + ++E+DK+V+N+     + TNT WKYPRN++TQY PR +  EE +  Y     + D  K  P + + +  N + ++   D+  LA+GD  +D + DN  KEF +F DLKF K+KAVT I+WHPTIKGI+  S+ E+  +D R D  S+++LT ++IILWSF DPIQPQ+LLEAP D+ CF+FNPTDP+IVAGGC +G V+LWD+E HMEDL+ VK +MK++N  PLFSF++ +  ++P   + AIS+ E+SH SPI+DLKW+PDH EIN LGY LEN++ K +Q+ T+  +N++LFWDIRP+++  A  DK+   I  P  VP TF  LDMKWKP LRVHLYK   GGDHAPTKF ++E QGDR++L    E          K    K + LQ  +T +YVGTEDG+LVYVDWMPQKD D+GK+QT KPE Y   HDGP++ + R PF+ +++LVVGGW WS+WKEGV+SGP+L+S  + KPLT G+WSPTR SVF I RADG +E+WD++DKTHEP +VQ++S+ +        NF K+Q+VA GD  G L ++ +P R +    SEL +   Y ++EVRRR+FV  RWN+REQEKIEQE E K++AGIAP V LT+EE   +   EYE YL++EQ FLR+LGL
Sbjct:   47 KPDILDLFAKDELMEGCIPLFLSKATQQVFNIVADENVTKLKPSALIPKSDILKDIQLRASVSDFSVHKTIINDYNGLEILVIYDADMKFGENFVLVTNEEAKNHILN---PIEDQMDQLSGDEDSDAELEEASDSVTFFRPNIRRPWISLGSDKEVMESSIIETRPKVYTIFQRPRREFGAPVTFSDRDATDKGASSLVTTIPEKANEIPIMEVDKSVSNAQLTSERGTNTDWKYPRNAFTQYTPRVLTAEELQTMYAPGGPLQDIGKHFPTLKQGLLQNMMYDFLASDFENLAAGDETYDTRADNTFKEFLSFTDLKFSKDKAVTDIQWHPTIKGIVGMSVGERIDYDHRADQSSRILLTSTHIILWSFADPIQPQLLLEAPEDILCFQFNPTDPNIVAGGCFNGMVVLWDIEKHMEDLRKVKARMKAKNKAPLFSFDDTDPNRVPVSPYCAISNIEASHTSPILDLKWVPDHVEINRLGYCLENVSLKCVQLITSGLNNELLFWDIRPDRSPLA-VDKTRDSILPPRNVPTTFMALDMKWKPLLRVHLYKSEAGGDHAPTKFCIREAQGDRRILSANAEDRTNPTM---KSSTLKNKPLQGASTMLYVGTEDGDLVYVDWMPQKDPDTGKMQTPKPEFYATQHDGPISYLARSPFEPSVLLVVGGWTWSIWKEGVNSGPLLESGHAQKPLTGGSWSPTRPSVFFICRADGSLEVWDLLDKTHEPAMVQSVSANALTAISLC-NFSKRQIVAIGDTQGALQLFVVPRRLRSILASELANFNAYIEREVRRREFVLMRWNIREQEKIEQEAERKRQAGIAPAVVLTEEETLQKEALEYEEYLKNEQSFLRQLGL 893          
BLAST of WD repeat-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|22931507 (tr|A0A4S2LZW2|A0A4S2LZW2_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003740 PE=4 SV=1)

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 418/852 (49.06%), Postives = 577/852 (67.72%), Query Frame = 1
Query:  367 KDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIF-VIDDEGNVLTPEQALQQSMLSGVYRPPSPKE-WICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYVE--VSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            K  + ++ A + L  GC+P+FLS  T  +F +  DEN++  +P   I K EI+ DI  RA+VSDFSV K  I +Y+G EI+++YD + KFGENF++  NE  K  +L  I   +D +      +  L+++  S  +  P+ +  WI LGSDKE+ E  +I  RP + TI QR RREFG   TFS++ ++       V++  + +  + ++E+DK+V+N+     + TNT WKYPRN++TQY PR    EE +  Y     + D  K  P + + +  N + ++   D+  LA+GD  +D + DN  KEF +F DLKF K+KAVT I+WHPTIKGI+  S+ E+  +D R D  S+++LT ++IILWSF DPIQPQ+LLEAP D+ CF+FNPTDP+IVAGGC +G V+LWD+E HMEDL+ VK +MK++N  PLFSF++ +  K+P   + AIS+ E+SH SPI+DLKW+PDH EIN LGY LEN++ K +Q+ T+  +N++LFWDIRP+++  A  DK+   I  P  VP TF  LDMKWKP LRVHLYK   GGDHAPTKF ++E QGDR++L    E          K  A K + LQ  +T +YVGTEDG+LVYVDWMPQKD D+GK+QT KPE Y   HDGP+  + R PF+ +++LVVGGW WS+WKEGV+SGP+L+S  + KPLT G+WSPTR SVF I RADG +E+WD++DKTHEP +VQ++S+ +        NF+K+Q+VA GD  G L ++ +P R +    SEL +   Y ++EVRRR+FV  RWN+REQEKIEQE + K++AGIAP V LT+EE   +   EYE YL++EQ FLR+LGL
Sbjct:   57 KPDILDLFAKDELMEGCIPLFLSKATQQVFNIVADENVTKLKPSALIPKSEILRDIQLRASVSDFSVHKTIINDYNGLEILVIYDTDMKFGENFVLVTNEEVKNHILNPIEDQMDQQSGDEDSDAELEEASDSVTFFCPNIRRPWISLGSDKEVMESSIIETRPKVYTIFQRPRREFGAPVTFSDRDATDKGASSLVTTIPEKANEIPIMEVDKSVSNAQLTSERGTNTDWKYPRNAFTQYTPRVFTVEELQTIYAPGGPLQDIGKHFPTLKQGLLQNMMYDFLASDFENLAAGDETYDTRADNTFKEFLSFTDLKFSKDKAVTDIQWHPTIKGIVGMSVGERIDYDHRADQCSRILLTPTHIILWSFADPIQPQLLLEAPEDILCFQFNPTDPNIVAGGCFNGMVVLWDIEKHMEDLRKVKARMKAKNKAPLFSFDDTDPNKVPVSPYCAISNIEASHTSPILDLKWVPDHVEINRLGYCLENVSLKCVQLITSGLNNELLFWDIRPDRSPLA-VDKTRDSIVPPRNVPTTFMALDMKWKPLLRVHLYKSEAGGDHAPTKFCIREAQGDRRILNANVEDRTNPTM---KSSALKTKPLQGASTMLYVGTEDGDLVYVDWMPQKDPDTGKMQTPKPEFYATQHDGPICYLARSPFEPSVLLVVGGWTWSIWKEGVNSGPLLESGHAQKPLTGGSWSPTRPSVFFICRADGSLEVWDLLDKTHEPAMVQSVSANALTAISLC-NFLKRQIVAIGDTQGALQLFVVPRRLRSILASELANFNAYIEREVRRREFVLMRWNIREQEKIEQEADRKRQAGIAPAVVLTEEETLQKEALEYEEYLKNEQSFLRQLGL 903          
BLAST of WD repeat-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16302872 (tr|A0A183AH36|A0A183AH36_9TREM Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS6271 PE=4 SV=1)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 422/862 (48.96%), Postives = 581/862 (67.40%), Query Frame = 1
Query:  367 KDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQAL--------QQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYVE------VSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            +  + N+ A ++L  GC+PIFLS PT  IF +  DE+++  +P   IAK++I+ DI  RAAVSDFSV K  I  Y G +I+++YD + KFGENFI+ L+E  K    K+I    DE  +   E+          + S     + P + + WI LGSDKEI E    + RP I TI QR RREFG    FS++    D VE      V+S E+ S  + ++ELD+ V+N+     + TNT WKYPRN++TQY+PR +  E+ + +      + +  K      + +  N + ++  +DY  LA+GD  +D++ DN  KEF +F DLKF K+KA+T I+WHPTIKGI+A S+ E+ ++DQR++  S+++LT ++IILWSF DPIQPQ+LL+AP D+ CF+FNPTDP+IVAGGC +GQV+LWD+E HMEDL+ VK +MK++  +PLFSF++ +  K+P   + A+S+ E+SH +PI+ ++W+PDH E+N LGY +EN+  + +Q+ T   ++++LFWD R +++  A  DK+   I     VP TF  LD KWKP LRVHL+K  PGGDHAPTKF ++EVQGDR++L    E            G  K+R LQ  +TH YVGTEDG+LVYVDWMPQKD D+GK+QT KPE Y   HDGP++ V R PF+ T++LVVGGW WSLWKEGVH+GPIL+S  S KPLT G WS TR SVF I RADG +E+WD++DKTHEP +VQ+  S +ALT IS+++F ++QL+A GD  G L ++ +P R      SEL + + Y  +EV+RR+FV  RW++REQEKIEQE E KKKAG+AP V LT+EE   + +AEYE YLQDE  FLR LGL
Sbjct:   64 RPDILNIFAKDDLLPGCIPIFLSQPTQVIFNLVADEDVTKAKPSTLIAKNDILKDIQLRAAVSDFSVQKTAINEYPGSDILVIYDADVKFGENFILVLSEETK----KIILNPSDESPLPATEEDKTYGGDELDEASDAVAEFHPRTRRPWINLGSDKEIMEASTTDTRPRIYTIYQRPRREFGAPVFFSDR----DAVEKSMGSMVNSSEEKSTDIPIVELDRAVSNAQLTCERGTNTDWKYPRNAFTQYQPRLLSPEDLQLYLAPNGPLQNISKHFKIFEQGLLQNMMYDFLANDYENLAAGDETYDSRADNTFKEFLSFTDLKFSKDKAITDIQWHPTIKGIVAMSVGERLTYDQRVEQSSRILLTSTHIILWSFADPIQPQLLLDAPEDIMCFQFNPTDPNIVAGGCYNGQVVLWDIEKHMEDLRTVKQRMKAKGKVPLFSFDDHDPQKVPVSPYCAVSNIEASHTAPILAIQWVPDHMEVNRLGYCMENIGLRCVQLVTCGLNHELLFWDTRADRSPLA-VDKTRDSIVPAMNVPTTFAALDNKWKPLLRVHLFKTDPGGDHAPTKFCMREVQGDRRILNANAEDRNAVSA--KTGGPPKSRPLQGASTHFYVGTEDGDLVYVDWMPQKDQDTGKMQTPKPEFYAPQHDGPISYVARSPFEPTVLLVVGGWTWSLWKEGVHNGPILESGHSVKPLTGGHWSLTRPSVFFICRADGSLEVWDLLDKTHEPAMVQS-ISANALTAISLWSFSRRQLIAIGDTQGALQIFVVPRRLSSIMPSELANFIAYITREVKRREFVMTRWSIREQEKIEQEAENKKKAGVAPTVVLTEEEQLQKERAEYEQYLQDEHAFLRSLGL 913          
BLAST of WD repeat-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19083514 (tr|A0A4E0RWL6|A0A4E0RWL6_FASHE WD repeat-containing protein 63 OS=Fasciola hepatica OX=6192 GN=D915_001937 PE=4 SV=1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 417/858 (48.60%), Postives = 575/858 (67.02%), Query Frame = 1
Query:  367 KDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETA--------KEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYVE--VSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            K  + ++   ++L  GCVPIFLS PT  IF +  DEN++   P   I K +I+ DI  RA VSDFS  K  I  Y G +I+++YD + KFGENF+I L+E +         EE+L+     D+E    T ++  +       Y PP+ + WI LGSD+EI E  V   RP I TI QR RREFG    F ++ + +      V+S E+    + + E+D+ V+N+     + TNT WKYPRN++TQY+PR +  EE +        +    K    + +S+  N + ++  +DY  LA+GD  +D + DN  KEF +F DLK+ K+KA+T I+WHPTIKGI+A S+ E+ ++DQR+D +S+++LT+++IILWSF DPIQPQ+LL+AP D+ CF+FNPTDP+IVAGGC +GQV+LWD+E HMEDL+ VK +MK+++ +PLFSF++ +  K+P   + A+S+ E+SH +PI+ ++W+PDH E+N LGY +ENL+   +Q+ T   ++++LFWD R +K+  A  DK+   I     VP TF  LD KWKP LRVHL+K  PGGDHAPT F +KEVQGDR +L    +           PG QK+R LQ  +T+ YVGTEDG+LVYVDWMPQKD D+GK+QT KPE Y   HDGP++ V R PF+ +++LVVGGW WS+WKEGV++GPI++   S KPLT G WSPTR SVF I RADG +E+WD++DKTHEP +VQ+  S +ALT +S++NF ++QL+A GD  G L V+ +P R      SEL +   Y D+EVRRRDFV  RWN+REQEKIEQE E K+KAG+AP   LT+EE+  + + EYE YLQDE  FLR LGL
Sbjct:   56 KSDILDIFKRDDLLPGCVPIFLSQPTQQIFGLLTDENVTKANPSVLIPKADILKDIQLRAGVSDFSAQKTAINEYPGDDILLIYDADLKFGENFVIVLSEESMNLIQNPTDEEMLQ---TADNEKT--TDDELEEADDEVAEYHPPTRRPWINLGSDREILEASVTETRPRIYTIYQRPRREFGAPVVFVDREAVEKSTGSIVNSSEERPTEIPITEMDRGVSNAQLTRERGTNTDWKYPRNAFTQYQPRTLGAEELQQCLTPNGSLQTMGKHYKMLEQSLLQNMMYDFLANDYENLAAGDETYDTRADNTFKEFLSFTDLKYSKDKAITDIQWHPTIKGIVAMSVGERLTYDQRVDQMSRILLTQTHIILWSFADPIQPQLLLDAPEDILCFQFNPTDPNIVAGGCYNGQVVLWDIEKHMEDLRTVKQRMKAKSKVPLFSFDDSDTHKVPVSPYCAVSNIEASHTAPILAIQWVPDHMEVNRLGYCMENLSQHCVQLVTCGLNHELLFWDTRADKSPLA-VDKTRDAIVPAMNVPTTFSTLDNKWKPLLRVHLFKTDPGGDHAPTSFCMKEVQGDRHLLSANADDRNALTP--KTPGPQKSRPLQGASTYFYVGTEDGDLVYVDWMPQKDQDTGKMQTPKPEFYAQQHDGPISYVARSPFEASVLLVVGGWTWSVWKEGVNNGPIIEPGHSVKPLTGGHWSPTRPSVFFICRADGSLEVWDLLDKTHEPAMVQS-VSPNALTAVSLWNFSRRQLIAIGDTQGALQVFVVPRRLSVIMPSELANFNSYIDREVRRRDFVLTRWNIREQEKIEQEAENKRKAGVAPAAALTEEELLQKERTEYEQYLQDEHAFLRSLGL 904          
BLAST of WD repeat-containing protein vs. Ensembl Cavefish
Match: WDR63 (WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:30711])

HSP 1 Score: 543.117 bits (1398), Expect = 1.456e-178
Identity = 311/873 (35.62%), Postives = 488/873 (55.90%), Query Frame = 1
Query:  406 PTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIR-----TILQRS--------------------RREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQ-----IATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKP-GAQKARTLQALNTHIYVG------TEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTD-EEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P    P+ L++ T ++F  + DE+++   P + + K++I+ D+ +RAA+SDFS +K  I +Y   EI++V+D +F +G++F + L   AKE +L+    +D E       + L + M   V + P P+ W+ LGS++EI +  +++ RP +R     TI +R+                    RRE G    FS+   S + VE S Y+D+SFS + +E    V   P   S S+ T WK+ RN +TQY+PR + EEE E    S+N+          +  ++Q N I N F+DD+  LA    V   K +  LK++Q+F DL   K K ++ I WHP + G+IA ++ E+ S+++RID+ +K++L  + I+ WSF DPI PQ++LE P D++CF+F P+DP+I+AGGC++GQV+LWD+  HME L+  +  +  +N +   +   D     P +R+ A+S  E+ H +P+ D++WLPD +E++  G  LEN    S+QI T A D  ++FWD+R  + V+       Q+     +  P GVP TFK+L++ WKP +RV L KV   G+++P K SL+E                    +   P G    +    ++ HIY         +DGE+VY DW  +KD++SG+L + KP H + VHDG V  V R PF + IIL VG W +++WKEGV +GPILQS  S K  T G WS TR +VF I + DG +EIWD+++KTHEP+    I++            VK+QL+A  +  G LH+ E+P R    S  E  +   YF+KEV R  +  +R  +R +EK E + E +++      V++   +E +     E+E Y + E + L+ +GL
Sbjct:   27 PDHIFPLVLTSATQELFGCRADEDVTGDDPYRLLKKEDIIQDMKTRAAISDFSPIKQAILDYPEDEILLVFDRDFTYGQSFYLVLTVDAKESMLRSPAEVDGEEEEEGESEDLSEIM---VQKTPEPQAWVSLGSEREIEDESLMDTRPKVRYSHTYTIHKRNTHHIHNTQLFTQLCYKVSRLRRETGAPLHFSD--YSTECVECSPYQDSSFSTRRMERASGVQAVPVTSSSSSQTVWKHKRNMWTQYQPRVLDEEEKENILLSKNLKNFLNSVTLRVEVAIQQNIIMNMFVDDWRDLAEEVPVLGGKANTQLKKYQSFTDLNHSKNKTISYINWHPAVSGVIAVAVRERLSYEERIDSSTKLLLNPALILFWSFSDPINPQLMLECPDDVFCFEFCPSDPNIIAGGCMNGQVVLWDISAHMERLQGARAGVGGKNNLHGNTLVTDT----PVVRYCAVSGIENGHKAPVTDIQWLPDTFEVSRTGIPLENKNQTSVQIVTCAPDCCVMFWDLRAPRVVSQSQIDRKQKTEEKILDNPHGVPNTFKHLNLTWKPLIRVTLPKVDGRGEYSPMKLSLRE-------------------SLFNSPSGTVHVQYTVNISEHIYTDKNNVSICQDGEIVYTDWKLEKDNESGRLFSPKPTHCFRVHDGLVNTVLRSPFFKDIILSVGLWNFAIWKEGVTNGPILQSPYSQKNCTLGFWSLTRPAVFFIGKEDGNLEIWDLLEKTHEPSQTHTITTAPITCIKPWVISVKQQLLAVSEHLGTLHILEVPRRLLHPSSKEKLNVSMYFEKEVERLIYFEKRQEMRAKEKREMDAEEQRRKMEIGAVSMKSVKEAEQDELKEWEEYRKLENLLLKNMGL 871          
BLAST of WD repeat-containing protein vs. Ensembl Cavefish
Match: WDR63 (WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:30711])

HSP 1 Score: 357.836 bits (917), Expect = 1.322e-109
Identity = 193/534 (36.14%), Postives = 313/534 (58.61%), Query Frame = 1
Query:  406 PTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQ-----IATPAGVPETFKYLDMKWKPTLRV 1992
            P    P+ L++ T ++F  + DE+++   P + + K++I+ D+ +RAA+SDFS +K   ++Y   EI++V+D +F +G++F + L   AKE +L+    +D E       + L + M   V + P P+ W+ LGS++EI +  +++ RP +   + R RRE G    FS+   S + VE S Y+D+SFS + +E    V   P   S S+ T WK+ RN +TQY+PR + EEE E    S+N+          +  ++Q N I N F+DD+  LA    V   K +  LK++Q+F DL   K K ++ I WHP + G+IA ++ E+ S+++RID+ +K++L  + I+ WSF DPI PQ++LE P D++CF+F P+DP+I+AGGC++GQV+LWD+  HME L+  +          LF   ED     P +R+ A+S  E+ H +P+ D++WLPD +E+     SLE L + S+ + T      ++FWD+R  + V+       Q+     +  P GVP TFK+L++ WKP +RV
Sbjct:   17 PDHIFPLVLTSATQELFGCRADEDVTGDDPYRLLKKEDIIQDMKTRAAISDFSPIK---QDYPEDEILLVFDRDFTYGQSFYLVLTVDAKESMLRSPAEVDGEEEEEGESEDLSEIM---VQKTPEPQAWVSLGSEREIEDESLMDTRPKLCYKVSRLRRETGAPLHFSD--YSTECVECSPYQDSSFSTRRMERASGVQAVPVTSSSSSQTVWKHKRNMWTQYQPRVLDEEEKENILLSKNLKNFLNSVTLRVEVAIQQNIIMNMFVDDWRDLAEEVPVLGGKANTQLKKYQSFTDLNHSKNKTISYINWHPAVSGVIAVAVRERLSYEERIDSSTKLLLNPALILFWSFSDPINPQLMLECPDDVFCFEFCPSDPNIIAGGCMNGQVVLWDISAHMERLQGAR----------LF---EDEVTDTPVVRYCAVSGIENGHKAPVTDIQWLPDTFEV-----SLE-LISSSVPVKTVC----VMFWDLRAPRVVSQSQIDRKQKTEEKILDNPHGVPNTFKHLNLTWKPLIRV 519          

HSP 2 Score: 166.777 bits (421), Expect = 3.636e-42
Identity = 94/212 (44.34%), Postives = 131/212 (61.79%), Query Frame = 1
Query: 2188 DGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTL 2823
            DGE+VY DW  +KD++SG+L + KP H + VHDG V  V R PF + IIL VG W +++WKEGV +GPILQS  S K  T G WS TR +VF I + DG +EIWD+++KTHEP+    I++            VK+QL+A  +  G LH+ E+P R    S  ELN +M YF+KEV R  +  +R  +R +EK E + E +++  +    TL
Sbjct:  538 DGEIVYTDWKLEKDNESGRLFSPKPTHCFRVHDGLVNTVLRSPFFKDIILSVGLWNFAIWKEGVTNGPILQSPYSQKNCTLGFWSLTRPAVFFIGKEDGNLEIWDLLEKTHEPSQTHTITTAPITCIKPWVISVKQQLLAVSEHLGTLHILEVPRRLLHPSSKELNVSM-YFEKEVERLIYFEKRQEMRAKEKREMDAEEQRRKMVGDSFTL 748          
BLAST of WD repeat-containing protein vs. Ensembl Cavefish
Match: WDR63 (WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:30711])

HSP 1 Score: 183.726 bits (465), Expect = 8.727e-51
Identity = 110/321 (34.27%), Postives = 178/321 (55.45%), Query Frame = 1
Query:  406 PTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIAT 1368
            P    P+ L++ T ++F  + DE+++   P + + K++I+ D+ +RAA+SDFS +K   ++Y   EI++V+D +F +G++F + L   AKE +L+    +D E       + L + M   V + P P+ W+ LGS++EI +  +++ RP +   + R RRE G    FS+   S + VE S Y+D+SFS + +E    V   P   S S+ T WK+ RN +TQY+PR + EEE E    S+N+          +  ++Q N I N F+DD+  LA    V   K +  LK++Q+F DL   K K ++ I WHP    II T
Sbjct:   23 PDHIFPLVLTSATQELFGCRADEDVTGDDPYRLLKKEDIIQDMKTRAAISDFSPIK---QDYPEDEILLVFDRDFTYGQSFYLVLTVDAKESMLRSPAEVDGEEEEEGESEDLSEIM---VQKTPEPQAWVSLGSEREIEDESLMDTRPKLCYKVSRLRRETGAPLHFSD--YSTECVECSPYQDSSFSTRRMERASGVQAVPVTSSSSSQTVWKHKRNMWTQYQPRVLDEEEKENILLSKNLKNFLNSVTLRVEVAIQQNIIMNMFVDDWRDLAEEVPVLGGKANTQLKKYQSFTDLNHSKNKTISYINWHPASCKIIWT 335          
BLAST of WD repeat-containing protein vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 99.7525 bits (247), Expect = 3.892e-21
Identity = 92/409 (22.49%), Postives = 151/409 (36.92%), Query Frame = 1
Query: 1312 EKAVTCIEWHP--TIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            ++  T + WHP  + K  +A S  E          +SK +   SYI  W      +P++ L+  S L C ++NP D HI+ GG  +GQ+  WD           KG                ++P         +S  E SH  P+  + WL                +       +A+ D ++L+WDIR    ++ P ++     +    + +    + ++++ T+              PTKF                                             VGTE G +V  +          K    K    ++ H GP+ ++ R PF     L VG W   +W E +    I+ +      L+DG WSP R SVF   + DG +++WD + K ++PTL
Sbjct:  162 KRTATSLSWHPDGSQKLAVAYSSLE-------FQKVSKDMSYDSYI--WDIEVSNKPEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTR---------KG----------------SQP-------VEMSTIEHSHRDPVYKVIWLQ---------------SKTGTDFFSASTDGQVLWWDIR---KMSEPTERLVLDPSKKGKLDQALGAISLEFETTM--------------PTKF--------------------------------------------MVGTEQGMVVSCN-------RKAKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDIRESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFLFKQNDPTL 446          
BLAST of WD repeat-containing protein vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 95.9005 bits (237), Expect = 1.479e-20
Identity = 89/407 (21.87%), Postives = 149/407 (36.61%), Query Frame = 1
Query: 1312 EKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL 2532
            ++  T + WHP     +A + +           +SK +   SYI  W      +P++ L+  S L C ++NP D HI+ GG  +GQ+  WD           KG                ++P         +S  E SH  P+  + WL                +       +A+ D ++L+WDIR    ++ P ++     +    + +    + ++++ T+              PTKF                                             VGTE G +V  +          K    K    ++ H GP+ ++ R PF     L VG W   +W E +    I+ +      L+DG WSP R SVF   + DG +++WD + K ++PTL
Sbjct:   10 KRTATSLSWHPDGSQKLAVAYS-----SLEFQKVSKDMSYDSYI--WDIEVSNKPEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTR---------KG----------------SQP-------VEMSTIEHSHRDPVYKVIWLQ---------------SKTGTDFFSASTDGQVLWWDIR---KMSEPTERLVLDPSKKGKLDQALGAISLEFETTM--------------PTKF--------------------------------------------MVGTEQGMVVSCN-------RKAKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDIRESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFLFKQNDPTL 294          
BLAST of WD repeat-containing protein vs. Ensembl Sea Lamprey
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 73.9442 bits (180), Expect = 3.040e-14
Identity = 41/124 (33.06%), Postives = 59/124 (47.58%), Query Frame = 1
Query: 2164 THIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLV 2535
            T   VGTE G +V  +          K    K    ++ H GPV A+ R PF     L +G W   +W E +    I+ +      LTDG WSP R +VF  T+ DG +++WD++ K +  TL 
Sbjct:   92 TKFMVGTEQGMVVSCN-------RKAKTPAEKIVGTYSGHHGPVYALQRHPFFPKNFLTIGDWTARIWSEEIRDSSIMWTKYHMSYLTDGCWSPVRPAVFFTTKMDGSLDVWDLLFKQNNATLT 208          
BLAST of WD repeat-containing protein vs. Ensembl Sea Lamprey
Match: wdr34 (WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-070928-9])

HSP 1 Score: 50.447 bits (119), Expect = 1.630e-6
Identity = 42/171 (24.56%), Postives = 67/171 (39.18%), Query Frame = 1
Query: 1273 KEFQTFADLKFGKEK----AVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSF----LDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWL 1761
            +E     +L   + K    A T + W  T   +I  +       D  ++N        S I LW+     L P  P   L+ P  L C  F+PT P ++AGG  SG+V +WD                        S EED     P + H+ ++   ++H  P+  ++W+
Sbjct:  117 EEISCLHELSCAEAKTRGLAATAVGWSCT-GAMIGVAFGRLNDGDWTVEN--------SMICLWNVCRRGLIPDMPDRTLDVPGCLLCLSFHPTWPAVIAGGASSGEVFVWDT-----------------------SQEED-----PLLAHSGVN--ATTHQQPVTQVQWV 248          
BLAST of WD repeat-containing protein vs. Ensembl Nematostella
Match: EDO29743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2S2])

HSP 1 Score: 242.662 bits (618), Expect = 1.219e-69
Identity = 135/338 (39.94%), Postives = 198/338 (58.58%), Query Frame = 1
Query:  580 IKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYR--PPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATF---SEKPSSKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVIL 1578
             ++Y  +E++IVYD  FK+G+NF + L E AKE  L        E      E   ++ +  GV+R  P +P+ W  LGS+ E+ E  V+ NRP ++  + R RREFG   +F   S   +    ++  SY++ + S K +E +K +     +    + T W  P N+ TQY PR   E E E    S        K  P    ++Q NEI N F DDY ++A  +T F  K+DN LKE+Q+F DL + KEK +T IEWHP+IKGII  S  E+  FD+RID  S++++T S +++WSF DPI P +LL+AP +++ FKFNP+DP+I+AGGCI+GQ  +
Sbjct:    8 FQSYPAEELLIVYDPAFKYGQNFYLCLTEEAKERHLN----PPKEELGEGEEIEGEEEVEEGVFRRFPRTPQPWESLGSELEVEEEVVVENRPKVKFRISRLRREFGAPVSFTTHSATDAKGGLIDCPSYDEETPSFKKMEFEKAIQAVSVLEDVGSQTDWLKPCNAATQYVPREFEEYEKEKINKSLMFKNFVNKVTPRFELALQQNEIMNVFYDDYESMADDETTFGAKSDNYLKEYQSFTDLLYSKEKTITSIEWHPSIKGIIGVSCGERLLFDERIDQSSRILMTASLVLIWSFSDPIHPLVLLQAPDEIHSFKFNPSDPNIIAGGCINGQTTV 341          

HSP 2 Score: 169.474 bits (428), Expect = 2.201e-44
Identity = 70/138 (50.72%), Postives = 100/138 (72.46%), Query Frame = 1
Query: 2128 GAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQN 2541
            G  + + L+ ++T   VGTE+G+LVY+DW P+KD+DSGK+ T +PEH W  HDGP+  +   PF + IIL VGGW +++WKEGV+S P+L S +    LT G WSP+R  VF I +ADG V++WD++D++HEP+L QN
Sbjct:  390 GKDQGKPLENVSTKFLVGTEEGDLVYLDWRPEKDTDSGKIMTPRPEHVWAAHDGPINTLQVSPFFKDIILTVGGWTFAIWKEGVNSDPLLLSSSHIVKLTKGHWSPSRPGVFFIAKADGMVDVWDLLDRSHEPSLTQN 527          
BLAST of WD repeat-containing protein vs. Ensembl Nematostella
Match: EDO40075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B8])

HSP 1 Score: 76.2554 bits (186), Expect = 3.111e-14
Identity = 52/188 (27.66%), Postives = 86/188 (45.74%), Query Frame = 1
Query: 2155 ALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTL-VQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEV 2715
             + T   VGTE G ++  +   +  +D  K+  +   HY     GPV +V R PF     L +G W   +W E +    I+ +      LTDG WSP+R  VF  T+ DG +++WD + K + PTL +Q    +     +  +     +LVA G  +G + + E+        ++E       F++E 
Sbjct:  324 TMPTKFMVGTEQGSVLSCNRKAKTPAD--KIVASYAGHY-----GPVYSVQRNPFFPKNFLTIGDWQARIWSEDLRESSIMWTKCGMSYLTDGCWSPSRPGVFFTTKMDGTLDVWDCMFKQNCPTLSIQVCDMSLNSLRVQDHG----RLVACGSHDGTVTLLELSEGLHTMQRNEKASINATFERET 500          

HSP 2 Score: 61.6178 bits (148), Expect = 1.208e-9
Identity = 34/93 (36.56%), Postives = 51/93 (54.84%), Query Frame = 1
Query: 1312 EKAVTCIEWHP--TIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWD 1584
            ++  T I W+P  T K  +A S+ E   F +  D     I   SYI  W   +P +P ++L+  S L C ++NP DPH++ GGC +GQ+  WD
Sbjct:  161 KRTATSISWYPDGTQKLAVAYSVLE---FQKSTD-----ICMDSYI--WDIDNPTKPDMVLKPVSPLICLEYNPKDPHLLIGGCYNGQLGFWD 243          
BLAST of WD repeat-containing protein vs. Ensembl Medaka
Match: WDR63 (WD repeat domain 63 [Source:NCBI gene;Acc:101169101])

HSP 1 Score: 419.083 bits (1076), Expect = 2.063e-131
Identity = 271/855 (31.70%), Postives = 460/855 (53.80%), Query Frame = 1
Query:  406 PTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKL--IFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSE---KPSSKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFD--NKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTK-SYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVK--GKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQI-----ATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNF-VKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTL----TDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            P    P+ L++ T ++F+ + DE+++  +P K + K  I+ DI +RAAVSDFS ++  + +Y  +EI++V+D +  FG++F + L   AK  L KL    + +DE                 + + P PK      ++KEI E   +  R  +R    R + E G   + S+     S  +YVE  SY+DN   +KV++ D  +     + S +T T WK  +N +TQY P+   +EE EA   SE++   SK  +P ++ ++Q  EI + F+DD+  L +     D   +T + L   + F D    K++ ++C+ WHPTI G+IA ++  K   ++ ID  S V  ++ SYI+++SF  P   Q+LL +P D+ CF+F P++P+++AGGCI+GQV+LWD+  ++  L+  +  G   S N    F+F+E  +   PT+  +A+S  +++H + I D+ WL    ++++ G  +EN +  S+QI T   D  I+FWD+R       P   + Q++      T   VP+ FK+L   WKP     L+K+    +H P KFS+      R   + L E +    Q+   P A + R L+ +NT  Y GTEDGE++Y+DW   KD +SG+  + KP      H   V  V R PF + IIL  G   +++WKEGV  GP+++S  S   +T G WS +R +VF I +A+GC+E+W++++   +P  VQ   ++S +T +  +   ++K  +A  +  G L ++EI       S++EL+   KYF+ E     F + +  L  +EK  +  E  ++  + P  ++    T EE +++   +++++   E+  L+E+GL
Sbjct:   21 PHCIYPLALTSATQELFECRADEDVTRDRPYKLLRKHAIIQDIKTRAAVSDFSPVEQILLDYAEEEILLVFDNDSAFGQSFYLDLTPEAKHRLTKLHDSELFEDE-----------------MRKTPEPKNSTSFITEKEI-EQESVKEREKLRLKFSRLQVELGTPVSLSDYNVADSKHNYVEFPSYQDNRSFIKVMQRDCGIQAVSRLQSDATQTAWKPKKNDFTQYSPQEFSQEEKEAIIQSESLKNFSKSVIPRVLCALQQQEIGDVFVDDFEALGTAADAGDLPGQTSDLLVFHKGFTDKMHTKDRKISCVNWHPTIPGVIAVALTTKKG-EELID--SAVFGSRPSYIVVYSFSFPTNSQLLLRSPGDILCFEFCPSNPNVIAGGCINGQVVLWDISAYVTCLQGTQPSGTHSSDN-KDTFNFDE-KKAGTPTVDFSAMSDIKATHKARITDIHWLLPSVQVSSAGVPVENTSNISVQIVTCGLDGTIMFWDLRVPTVPEQPLAATKQEVDQRTTGTSWSVPQPFKHLRSTWKP-----LFKMDFSDEHVPVKFSMDLCTCHRNTAKELSENQPDYSQLRIPP-ANEMRVLEDVNTRFYAGTEDGEIIYIDWKVGKD-ESGQQFSPKPLVCVRAHLMMVNTVQRSPFFQDIILTSGPLHFAIWKEGVTEGPLVKSQWSGDEITMGCWSLSRPAVFFIGKANGCLEVWNLLENGVKPVHVQMHITSSRITCLKPWAMSLRKHFLAVTNDLGSLRIFEILRTLYHPSKNELSRMEKYFEMETDYLRFWQDKEKLWSKEK--KVAEKPEQKNVEPSRSIKSVSTAEEQELKKYNDFKMF---EESILKEMGL 840          
BLAST of WD repeat-containing protein vs. Ensembl Medaka
Match: dnai2 (dynein axonemal intermediate chain 2 [Source:NCBI gene;Acc:100500716])

HSP 1 Score: 99.3673 bits (246), Expect = 4.132e-21
Identity = 100/467 (21.41%), Postives = 166/467 (35.55%), Query Frame = 1
Query: 1312 EKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKE 2712
            ++ VT + W P     +A + +  +   Q+   LS    T SYI  W    P  P+++L+ PS L C ++NP   + + GGC +GQV  WD     + +                                A S  E SH  P+  + WL      +                 +A+ D ++L+WD+R    ++ P ++    ++    +      + ++++ T+              PTKF                                             VGTE+G ++  +          K    K    ++ H G V AV R PF     L VG W   +W E +    I+ +      L D  WSP R SVF   + +G ++IWDI+    +PTL   +      +     N    +LVA G   G   + EI        ++E +     F++E
Sbjct:  159 KRTVTSLSWSPDRGRKLAAAYS--SVVFQQTSQLS----TDSYI--WDVEKPSIPEMVLKPPSPLVCLEYNPRVSYTLMGGCYNGQVAYWDTRRGCQTV--------------------------------AYSSVEHSHKDPVYKVIWLQSKTGTDAF---------------SASTDGQVLWWDVR---KLSEPTERLILDLSKEGNLGRALGGISLEFEITM--------------PTKF--------------------------------------------MVGTEEGLIISCN-------RKAKTPAEKIVCTYDGHRGSVYAVQRNPFLPKNFLTVGDWCARIWSEDIKESSIINTKNGVSELMDACWSPVRPSVFFTVKMNGVLDIWDILFNQSDPTLSVKVCDGGLYSIRVEEN---GRLVACGSEKGEATLLEISSGLSVPQKNEKSLVAAMFERE 499          
BLAST of WD repeat-containing protein vs. Ensembl Medaka
Match: dnai2 (dynein axonemal intermediate chain 2 [Source:NCBI gene;Acc:100500716])

HSP 1 Score: 72.7886 bits (177), Expect = 8.671e-13
Identity = 51/183 (27.87%), Postives = 76/183 (41.53%), Query Frame = 1
Query: 2164 THIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKE 2712
            T   VGTE+G ++  +          K    K    ++ H G V AV R PF     L VG W   +W E +    I+ +      L D  WSP R SVF   + +G ++IWDI+    +PTL   +      +     N    +LVA G   G   + EI        ++E +     F++E
Sbjct:  300 TKFMVGTEEGLIISCN-------RKAKTPAEKIVCTYDGHRGSVYAVQRNPFLPKNFLTVGDWCARIWSEDIKESSIINTKNGVSELMDACWSPVRPSVFFTVKMNGVLDIWDILFNQSDPTLSVKVCDGGLYSIRVEEN---GRLVACGSEKGEATLLEISSGLSVPQKNEKSLVAAMFERE 472          
BLAST of WD repeat-containing protein vs. Ensembl Medaka
Match: dnai2b (dynein axonemal intermediate 2b [Source:NCBI gene;Acc:100500717])

HSP 1 Score: 63.5438 bits (153), Expect = 6.553e-10
Identity = 39/119 (32.77%), Postives = 55/119 (46.22%), Query Frame = 1
Query: 2158 LNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDK 2514
            +NT I +GT+ G ++  D        +GK    K    +  + GPV AV + PF     L  G     LW + +   PI+      + LT   WSP R SVF     DG ++IWDI+ K
Sbjct:  285 MNTKIMLGTQHGLVISCD-------KNGKTPAEKIVSIYKTNKGPVYAVQKNPFFPGNFLTAGDKHACLWSDIITRSPIMAFRNGMQNLTGACWSPFRPSVFFTLNMDGVLDIWDILFK 396          

HSP 2 Score: 51.9878 bits (123), Expect = 2.632e-6
Identity = 35/143 (24.48%), Postives = 56/143 (39.16%), Query Frame = 1
Query: 1447 LWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIR 1875
            +W       P ++L+  S L C ++NP DP  + GGC +G+++ WD                  +  P+ S  ED+                 SH  P+  + WL               L  K   I+T+  D ++L+WDIR
Sbjct:  158 VWDIEKSSSPLMVLKPSSSLLCLEYNPNDPACLVGGCYNGRIVYWDTR---------------ESCWPVGSSPEDH-----------------SHKDPVSKVSWL--------------QLKGKKEAISTST-DGQVLWWDIR 253          
BLAST of WD repeat-containing protein vs. Planmine SMEST
Match: SMESG000042025.1 (SMESG000042025.1)

HSP 1 Score: 1759.96 bits (4557), Expect = 0.000e+0
Identity = 942/945 (99.68%), Postives = 942/945 (99.68%), Query Frame = 1
Query:   76 GNDTELSXXXXXXXXXXXXXXXXXXXXXXXXKEDTILSENKDENSIEADIEISRINSNIEATASTNNNLIETQENQXXXXXXXXXXXXXXXXXIVNAKDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRXXXXXXXXXXXXXXQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVXXXXXXXXXXXXXEQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 2910
            GNDTELSDEDLTDNDEKDDEMNTDDNEN AEKEDTILSENKDENSIEADIEISRINSNIEA ASTNNNLIETQENQSARSSKSKYGRRSSRMSIVNAKDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHV NNRPLIRTILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRKVLECLEEKEKVDEQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNISSTSALTTISIYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVRRRDFVRRRWNLREQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL
Sbjct:   13 GNDTELSDEDLTDNDEKDDEMNTDDNENKAEKEDTILSENKDENSIEADIEISRINSNIEAIASTNNNLIETQENQSARSSKSKYGRRSSRMSIVNAKDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHEGHVTNNRPLIRTILQRSRREFGGAATFSEKPSSKDYVEVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRRIPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHAPTKFSLKEVQGDRKVLECLEEKEKVDEQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNISSTSALTTISIYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVRRRDFVRRRWNLREQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQVFLRELGL 957          
BLAST of WD repeat-containing protein vs. Planmine SMEST
Match: SMESG000023734.1 (SMESG000023734.1)

HSP 1 Score: 148.673 bits (374), Expect = 9.273e-41
Identity = 100/196 (51.02%), Postives = 122/196 (62.24%), Query Frame = 1
Query:  241 NSNIEATASTNNNLIETQENQXXXXXXXXXXXXXXXXXIVNAKDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLKQPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFGENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPKEWICLGSDKEIHE 828
            + ++ ATA TN NLIETQE +S RSSK KYG+++S   IV +K+ +YNVD IENL TGC PIFLS   LDIFK+KV+E+I++KQPIKYIAKDEI+ DIV              + + D KEI  VYDGN                     +  +   E NVLTP QAL QSMLSG YR  +PK+W  L  DKEIHE
Sbjct:   25 DQDLTATALTNKNLIETQEKESPRSSKPKYGQKTS---IVKSKEFLYNVDVIENLLTGCAPIFLSFLVLDIFKIKVEEDIAIKQPIKYIAKDEIIRDIV--------------LSSDDCKEIATVYDGN--------------------SVKVLSPHESNVLTPVQALDQSMLSGFYRTSTPKKWNFLRPDKEIHE 183          
BLAST of WD repeat-containing protein vs. Planmine SMEST
Match: SMESG000075110.1 (SMESG000075110.1)

HSP 1 Score: 85.8853 bits (211), Expect = 6.247e-17
Identity = 61/202 (30.20%), Postives = 88/202 (43.56%), Query Frame = 1
Query: 2131 AQKARTLQ---ALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNXXXXXXXXXXXXYNFVKKQ----LVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEV 2715
            AQ A  L+    + T    GTE G ++  +         GK    K    +  H GPV A+ R PF     L VG W   +W E +    I+ +      LTDG WSP R +VF  T+ DG +++WDI+ K  EPTL                N ++ Q    L+A G  +G   + E+   F   S++E N     F++E 
Sbjct:  316 AQGAYALEYESTIPTKFMAGTEQGSIMSCN-------RKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTL-------RIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERET 503          

HSP 2 Score: 61.2326 bits (147), Expect = 2.728e-9
Identity = 57/233 (24.46%), Postives = 89/233 (38.20%), Query Frame = 1
Query: 1177 VQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIR 1875
            ++H    N  +D Y     G  +  ++     K    F D+   K  A T I W P     +A +    T F     N S    T SYI  W  ++P +P ++L+  S L C ++NP D H + GGC +GQ+ LWD           KG                     PT     +S  E+SH  P   + W+                +    +  +A+ D ++ +WD+R
Sbjct:  117 MEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTA-THISWFPDGPTKLAVAYC-NTEFQSSPPNTS----TDSYI--WDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRR---------KGSQ-------------------PT----EVSPVENSHRDPAWKVIWI---------------QSKTGTECFSASTDGQVFWWDVR 294          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR630.000e+040.02WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR630.000e+038.37WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR630.000e+038.37WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR631.954e-6340.06WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:3... [more]
DNAI24.165e-2322.65dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
back to top
BLAST of WD repeat-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG148384.784e-3523.98gene:FBgn0035799 transcript:FBtr0076801[more]
Dnai25.763e-1537.10gene:FBgn0036195 transcript:FBtr0332765[more]
Dnai26.888e-1537.10gene:FBgn0036195 transcript:FBtr0301326[more]
CG108596.315e-925.98gene:FBgn0032520 transcript:FBtr0080522[more]
CG108596.315e-925.98gene:FBgn0032520 transcript:FBtr0342635[more]
back to top
BLAST of WD repeat-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR632.219e-13329.96WD repeat domain 63 [Source:NCBI gene;Acc:10033313... [more]
dnai2b1.083e-2122.55dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b1.505e-2122.55dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b1.603e-2022.55dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2a6.737e-1332.24dynein, axonemal, intermediate chain 2a [Source:ZF... [more]
back to top
BLAST of WD repeat-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fer1l47.663e-4633.54fer-1-like family member 4, pseudogene (functional... [more]
ogfod37.090e-2522.162-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod37.467e-2522.162-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod38.973e-2522.162-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod31.012e-2422.162-oxoglutarate and iron-dependent oxygenase domain... [more]
back to top
BLAST of WD repeat-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr630.000e+038.40WD repeat domain 63 [Source:MGI Symbol;Acc:MGI:304... [more]
Dnaic21.472e-2122.38dynein, axonemal, intermediate chain 2 [Source:MGI... [more]
Dnaic22.166e-2123.50dynein, axonemal, intermediate chain 2 [Source:MGI... [more]
Dnaic22.166e-2123.50dynein, axonemal, intermediate chain 2 [Source:MGI... [more]
Wdr348.311e-1226.29WD repeat domain 34 [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of WD repeat-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IWG1|WDR63_HUMAN0.000e+040.02WD repeat-containing protein 63 OS=Homo sapiens OX... [more]
sp|Q95JP0|WDR63_MACFA0.000e+039.03WD repeat-containing protein 63 OS=Macaca fascicul... [more]
sp|Q9GZS0|DNAI2_HUMAN2.000e-2222.65Dynein intermediate chain 2, axonemal OS=Homo sapi... [more]
sp|Q16960|DYI3_HELCR2.510e-2222.49Dynein intermediate chain 3, ciliary OS=Heliocidar... [more]
sp|A2AC93|DNAI2_MOUSE1.515e-2023.50Dynein intermediate chain 2, axonemal OS=Mus muscu... [more]
back to top
BLAST of WD repeat-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203981110.000e+049.59tr|A0A419QC02|A0A419QC02_CLOSI WD repeat-containin... [more]
gnl|BL_ORD_ID|204247840.000e+049.01tr|H2KPD8|H2KPD8_CLOSI WD repeat-containing protei... [more]
gnl|BL_ORD_ID|229315070.000e+049.06tr|A0A4S2LZW2|A0A4S2LZW2_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|163028720.000e+048.96tr|A0A183AH36|A0A183AH36_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|190835140.000e+048.60tr|A0A4E0RWL6|A0A4E0RWL6_FASHE WD repeat-containin... [more]
back to top
BLAST of WD repeat-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR631.456e-17835.62WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR631.322e-10936.14WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR638.727e-5134.27WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:3... [more]
dnai2b3.892e-2122.49dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b1.479e-2021.87dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
back to top
BLAST of WD repeat-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnai2b3.040e-1433.06dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
wdr341.630e-624.56WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
back to top
BLAST of WD repeat-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO297431.219e-6939.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400753.111e-1427.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
WDR632.063e-13131.70WD repeat domain 63 [Source:NCBI gene;Acc:10116910... [more]
dnai24.132e-2121.41dynein axonemal intermediate chain 2 [Source:NCBI ... [more]
dnai28.671e-1327.87dynein axonemal intermediate chain 2 [Source:NCBI ... [more]
dnai2b6.553e-1032.77dynein axonemal intermediate 2b [Source:NCBI gene;... [more]
back to top
BLAST of WD repeat-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042025.10.000e+099.68SMESG000042025.1[more]
SMESG000023734.19.273e-4151.02SMESG000023734.1[more]
SMESG000075110.16.247e-1730.20SMESG000075110.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013227 ID=SMED30013227|Name=WD repeat-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3008bp
GTTAAAATTAAATTTAAATTATTATAATAAAATAAAAATATGAATGAAAG
TGAAAATGAAATAGAAAAGGATGAAGGTAATGATACTGAATTATCTGACG
AGGATTTGACAGATAATGATGAAAAAGATGATGAAATGAATACGGATGAT
AATGAAAATAATGCAGAAAAAGAAGACACAATACTTTCTGAAAACAAAGA
TGAAAATTCTATAGAAGCTGATATTGAAATTTCACGGATAAATTCCAATA
TTGAAGCTACAGCATCGACTAACAATAACTTAATAGAAACTCAAGAAAAC
CAAAGTGCCAGATCATCAAAATCTAAATACGGTAGAAGATCGTCTAGAAT
GTCCATTGTTAATGCAAAAGATTCCGTATATAATGTTGATGCGATTGAAA
ATTTGCCTACAGGATGTGTTCCAATTTTCCTTTCAACTCCCACATTAGAC
ATATTTAAAGTCAAAGTTGATGAAAACATCAGCCTAAAACAACCAATCAA
ATATATTGCCAAAGATGAAATCGTCGGGGATATTGTAAGTCGAGCGGCTG
TCTCAGATTTTAGTGTGTTGAAAAATGAAATAAAAAATTACGATGGCAAA
GAAATTGTGATCGTTTATGATGGAAATTTCAAATTCGGTGAAAATTTCAT
TATCGCTCTCAATGAAACTGCCAAAGAAGAACTTTTAAAATTGATTTTTG
TCATCGACGATGAGGGCAATGTTCTCACTCCTGAGCAGGCATTGCAACAG
TCAATGCTTTCGGGAGTTTATCGTCCCCCGTCACCAAAGGAGTGGATATG
TCTTGGATCCGACAAAGAAATCCACGAAGGACATGTGATCAACAATCGAC
CTTTAATCAGAACAATCTTACAACGATCGAGACGAGAATTCGGAGGAGCT
GCAACATTCTCAGAAAAACCCTCATCAAAAGATTACGTCGAAGTGAGCAG
TTATGAAGACAATTCGTTTTCATTGAAGGTTTTGGAATTGGACAAGAATG
TCACAAACTCACCATTTATCGTATCGAAATCCACAAATACGACATGGAAA
TATCCAAGAAATTCCTACACTCAATACGAACCGAGACGAATTCCCGAAGA
GGAATGCGAAGCGTTTTATAATTCTGAAAACATGATTATTGACAGCAAAA
AAGCCCTTCCGTATATCATTGAATCTGTTCAACACAATGAAATCGCCAAC
TATTTCATTGACGACTATTCAACTCTCGCTTCCGGTGACACAGTGTTCGA
CAATAAAACCGACAACGATCTGAAGGAATTTCAAACTTTTGCCGACTTGA
AATTCGGCAAAGAGAAAGCCGTCACATGCATTGAGTGGCATCCGACTATC
AAAGGAATTATCGCCACGTCCATGGCGGAAAAAACTTCGTTCGATCAAAG
AATCGATAACCTGTCGAAGGTTATTCTCACAAAATCCTATATAATTCTTT
GGAGTTTTCTCGATCCGATTCAACCACAAATTCTATTGGAAGCCCCATCG
GATTTGTATTGTTTTAAATTCAATCCAACAGATCCCCACATTGTAGCAGG
CGGTTGCATTAGTGGACAAGTGATTTTATGGGATATGGAAACTCACATGG
AAGATCTAAAAAATGTCAAAGGAAAAATGAAATCTCGCAACGTTATGCCA
TTGTTTTCATTTGAAGAAGACAATGAACCCAAAATTCCCACCATGAGACA
CGCGGCAATTAGTCATTGTGAAAGCTCGCACGCGTCACCAATCATAGATC
TAAAATGGCTCCCAGATCATTATGAAATTAACAATCTTGGTTATTCATTG
GAAAATCTAACAGCAAAATCAATCCAAATCGCAACAGCTGCTGGAGATAA
TAAAATTCTATTTTGGGACATTAGACCAAACAAAGCTGTAACTGCTCCAG
CAGATAAAAGTTCACAACAAATTGCTACACCAGCAGGCGTGCCAGAAACT
TTCAAATATCTTGACATGAAATGGAAACCAACTCTCAGAGTCCACTTGTA
TAAAGTTGGCCCTGGTGGTGATCATGCTCCTACTAAATTTAGTTTAAAAG
AAGTTCAAGGTGATAGAAAAGTTCTAGAATGCCTCGAAGAGAAAGAAAAA
GTAGACGAACAAATAATAACGAAACCTGGAGCTCAGAAAGCTAGGACATT
GCAGGCATTAAATACTCACATTTATGTTGGAACTGAAGACGGAGAGTTGG
TTTATGTGGACTGGATGCCTCAAAAAGACTCAGATTCAGGAAAATTACAA
ACGACCAAGCCAGAACACTATTGGAATGTTCATGATGGACCAGTCACCGC
TGTAACAAGATGCCCATTTGATAGAACAATAATTCTAGTGGTAGGAGGAT
GGGTTTGGAGTTTATGGAAAGAAGGGGTTCATTCGGGGCCTATTTTGCAA
AGTTGCACTAGTCCAAAGCCTCTTACAGATGGTGCGTGGTCTCCAACAAG
GTCTTCAGTATTTCTTATTACCAGAGCAGATGGCTGTGTTGAGATTTGGG
ATATTATTGATAAAACTCATGAACCCACTTTGGTACAAAACATTTCTTCA
ACATCTGCCTTGACAACAATTAGTATCTATAATTTCGTAAAAAAGCAACT
TGTTGCTTTTGGTGATATAAATGGTGGACTACATGTTTATGAGATCCCTG
TAAGATTCAAACAGCATTCCCAGAGTGAGTTAAATGATACGATGAAGTAC
TTTGACAAAGAAGTAAGGCGTAGAGATTTTGTCAGAAGGCGTTGGAATCT
CAGAGAACAAGAAAAAATTGAGCAAGAAGTTGAAGCTAAAAAGAAGGCTG
GCATTGCACCTCAAGTAACTTTAACTGATGAAGAAATGAAGATTAGAATG
AAAGCGGAATATGAACTATACTTACAAGATGAACAAGTATTTCTCAGAGA
ATTGGGTTTAAAAGAAGAAGAAGAAACTTGAAATTCAACAGAAATCATTA
ATAAATTGCATTAATAGCGCGATATGCTTTTTTAAATAAAGACTGTTTGA
ATGTTCTA
back to top

protein sequence of SMED30013227-orf-1

>SMED30013227-orf-1 ID=SMED30013227-orf-1|Name=SMED30013227-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=964bp
MNESENEIEKDEGNDTELSDEDLTDNDEKDDEMNTDDNENNAEKEDTILS
ENKDENSIEADIEISRINSNIEATASTNNNLIETQENQSARSSKSKYGRR
SSRMSIVNAKDSVYNVDAIENLPTGCVPIFLSTPTLDIFKVKVDENISLK
QPIKYIAKDEIVGDIVSRAAVSDFSVLKNEIKNYDGKEIVIVYDGNFKFG
ENFIIALNETAKEELLKLIFVIDDEGNVLTPEQALQQSMLSGVYRPPSPK
EWICLGSDKEIHEGHVINNRPLIRTILQRSRREFGGAATFSEKPSSKDYV
EVSSYEDNSFSLKVLELDKNVTNSPFIVSKSTNTTWKYPRNSYTQYEPRR
IPEEECEAFYNSENMIIDSKKALPYIIESVQHNEIANYFIDDYSTLASGD
TVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTS
FDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPH
IVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIP
TMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATA
AGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLR
VHLYKVGPGGDHAPTKFSLKEVQGDRKVLECLEEKEKVDEQIITKPGAQK
ARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDG
PVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAW
SPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNISSTSALTTISIYNFV
KKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKEVRRRDFVRR
RWNLREQEKIEQEVEAKKKAGIAPQVTLTDEEMKIRMKAEYELYLQDEQV
FLRELGLKEEEET*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005742mitochondrial outer membrane translocase complex
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005814centriole
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005868cytoplasmic dynein complex
GO:0005930axoneme
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0006605protein targeting
GO:0006886intracellular protein transport
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..21
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 35..55
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..55
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 82..102
NoneNo IPR availablePANTHERPTHR12442:SF5WD REPEAT-CONTAINING PROTEIN 63coord: 127..920
NoneNo IPR availablePANTHERPTHR12442DYNEIN INTERMEDIATE CHAINcoord: 127..920
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 782..821
e-value: 2.7
score: 14.3
coord: 476..515
e-value: 0.32
score: 20.1
coord: 554..610
e-value: 3.2
score: 13.8
coord: 738..777
e-value: 17.0
score: 9.2
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 663..932
e-value: 3.0E-12
score: 48.3
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 597..611
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 422..868