Calcium-activated potassium channel slo-1, putative

Overview
NameCalcium-activated potassium channel slo-1, putative
Smed IDSMED30013222
Length (bp)3455
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-activated potassium channel slo-1, putative (SMED30013222) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-activated potassium channel slo-1, putative (SMED30013222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-activated potassium channel slo-1, putative (SMED30013222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-activated potassium channel slo-1, putative (SMED30013222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30013222 dd_Smed_v4_5509_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013222 dd_Smed_v4_5509_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013222 dd_Smed_v4_5509_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 542/1098 (49.36%), Postives = 736/1098 (67.03%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQVHVEIS-NCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSC-----AAHKQFQNTLHKLRKFETTKSR--HSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V       + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C     AA  ++     + +K ET  SR     +E ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   87 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLKVAARSRYSKDPFEFKK-ETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1149          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 542/1098 (49.36%), Postives = 736/1098 (67.03%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQVHVEIS-NCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSC-----AAHKQFQNTLHKLRKFETTKSR--HSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V       + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C     AA  ++     + +K ET  SR     +E ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   87 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLKVAARSRYSKDPFEFKK-ETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1149          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 542/1098 (49.36%), Postives = 736/1098 (67.03%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQVHVEIS-NCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSC-----AAHKQFQNTLHKLRKFETTKSR--HSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V       + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C     AA  ++     + +K ET  SR     +E ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   22 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLKVAARSRYSKDPFEFKK-ETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1084          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 542/1101 (49.23%), Postives = 736/1101 (66.85%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQVHVEIS-NCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSC--------AAHKQFQNTLHKLRKFETTKSR--HSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V       + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C        AA  ++     + +K ET  SR     +E ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   63 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLIYFKVAARSRYSKDPFEFKK-ETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1128          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 542/1101 (49.23%), Postives = 735/1101 (66.76%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQVHVEIS-NCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS---IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSC-----AAHKQFQNTLHKLRKFETTKSR--HSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V       + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS   E  S   I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C     AA  ++     + +K ET  SR     +E ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   22 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLKVAARSRYSKDPFEFKK-ETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1088          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 564/1098 (51.37%), Postives = 757/1098 (68.94%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNL-----SRWFRNP-----NVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQF-QNTLH----KLRKFETTKSRHSNLESKK-GDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRF-----DTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            KC +E K++ FL +S+      ++++  +RV+ +L      + F  P      V   +N +    S  D    + ++  +        ++ KDW+GE+ISGQ+LTG+ LV LV ILSIGS+ IY Y+ S  +   E C+ W  S +QQ+DL FNI FLVYFF+RF+A++DK+ F LE+YS++D +TIPPSFV +Y+ R W+G RF+RA+RLMT+ D+L +LN++K+SSSIRL  L T FV++ +T +G +HL+E+SG         +R  + D  YF++VT+STVGYGDI C T  G+L M+FFIL GLA+FA+ +PE+ ++IG+R +Y   ++ +  K+HI++CGHITYDSVS+FL DFLH+DR+DVDV++V L+   P+LEL+ + KR+F  VEF+ G+ M+S DLSR+++ +ADACLVLANKYS +PDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDWKRGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   + P WLN YL GAGMEMY+E  SP+F   +F EA  + F  L LLL+AIE K   N+E +IAINP   I I+P  QGFFIAQSADE KRAFF+C++CH + +    IK+C C     F +NT H    + R  +  +       +   G    +V+LR     RP+   R +++      RG+ F++   ++F     D+TGMFHWCP + +ED +L +  Q  M V + H+VVC+FA+ +S LIGL NF+MPLR+SNFHY EL ++V +G+LEYL++EWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N+ +D  L DKEAIL SLN++AM FD D+     FP       +S   S   M+K     K +K G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP+LE +LAEG G++G Y TP+TL NRDRCR+  I +  NP   +         YG +F  AL R+G LCIGLYRL + D           N +S KRYVITNPP  L+I  +D VY L+QF
Sbjct:   38 KCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSETDPFLKQQEEKHL-----GWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNT-EDTTLADKEAILASLNIKAMQFD-DTLGF--FPMRHQTGDRSPLGSPISMQK-----KGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVV----HNTTYGAMFTIALRRYGQLCIGLYRLHDQD-----------NPDSMKRYVITNPPAELRIKNTDYVYVLEQF 1105          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 565/1098 (51.46%), Postives = 758/1098 (69.03%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNL-----SRWFRNP-----NVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQF-QNTLH----KLRKFETTKSRHSNLESKK-GDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRF-----DTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            KC +E K++ FL +S+      ++++  +RV+ +L      + F  P      V   +N +    S  D    + ++  +        ++ KDW+GE+ISGQ+LTG+ LV LV ILSIGS+ IY Y+ S  +   E C+ W  S +QQ+DL FNI FLVYFF+RF+A++DK+ F LE+YS++D +TIPPSFV +Y+ R W+G RF+RA+RLMT+ D+L +LN++K+SSSIRL  L T FV++ +T +G +HL+E+SG         +R  + D  YF++VT+STVGYGDI C T  G+L M+FFIL GLA+FA+ +PE+ ++IG+R +Y   ++ +  K+HI++CGHITYDSVS+FL DFLH+DR+DVDV++V L+   P+LEL+ + KR+F  VEF+ G+ M+S DLSR+++ +ADACLVLANKYS +PDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDWKRGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK     P+WLN YL GAGMEMY++  S +F G TF EAV + F  L LLL+AIE K   N+E +IAINP   I I+P  QGFFIAQSADE KRAFF+C++CH + +    IK+C C     F +NT H    + R  +  +       +   G    +V+LR     RP+   R +++      RG+ F++   ++F     D+TGMFHWCP + +ED +L +  Q  M V + H+VVC+FA+ +S LIGL NF+MPLR+SNFHY EL ++V +G+LEYL++EWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N+ +D  L DKEAIL SLN++AM FD D+     FP       +S   S   M+K     K +K G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP+LE +LAEG G++G Y TP+TL NRDRCR+  I +  NP   +         YG +F  AL R+G LCIGLYRL + D           N +S KRYVITNPP  L+I  +D VY L+QF
Sbjct:   38 KCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSETDPFLKQQEEKHL-----GWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNT-EDTTLADKEAILASLNIKAMQFD-DTLGF--FPMRHQTGDRSPLGSPISMQK-----KGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVV----HNTTYGAMFTIALRRYGQLCIGLYRLHDQD-----------NPDSMKRYVITNPPAELRIKNTDYVYVLEQF 1105          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 1035.02 bits (2675), Expect = 0.000e+0
Identity = 565/1111 (50.86%), Postives = 758/1111 (68.23%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNL-----SRWFRNP-----NVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQF-QNTLHKLRK---------FETTKSRHSNL---------ESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRF-----DTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            KC +E K++ FL +S+      ++++  +RV+ +L      + F  P      V   +N +    S  D    + ++  +        ++ KDW+GE+ISGQ+LTG+ LV LV ILSIGS+ IY Y+ S  +   E C+ W  S +QQ+DL FNI FLVYFF+RF+A++DK+ F LE+YS++D +TIPPSFV +Y+ R W+G RF+RA+RLMT+ D+L +LN++K+SSSIRL  L T FV++ +T +G +HL+E+SG         +R  + D  YF++VT+STVGYGDI C T  G+L M+FFIL GLA+FA+ +PE+ ++IG+R +Y   ++ +  K+HI++CGHITYDSVS+FL DFLH+DR+DVDV++V L+   P+LEL+ + KR+F  VEF+ G+ M+S DLSR+++ +ADACLVLANKYS +PDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDWKRGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   + P WLN YL GAGMEMY+E  SP+F   +F EA  + F  L LLL+AIE K   N+E +IAINP   I I+P  QGFFIAQSADE KRAFF+C++CH + +    IK+C C     F +NT H             F    +R +++             G    +V+LR     RP+   R +++      RG+ F++   ++F     D+TGMFHWCP + +ED +L +  Q  M V + H+VVC+FA+ +S LIGL NF+MPLR+SNFHY EL ++V +G+LEYL++EWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N+ +D  L DKEAIL SLN++AM FD D+     FP       +S   S   M+K     K +K G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP+LE +LAEG G++G Y TP+TL NRDRCR+  I +  NP   +         YG +F  AL R+G LCIGLYRL + D           N +S KRYVITNPP  L+I  +D VY L+QF
Sbjct:   38 KCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSETDPFLKQQEEKHL-----GWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARDYSDFDALFYQNDARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNT-EDTTLADKEAILASLNIKAMQFD-DTLGF--FPMRHQTGDRSPLGSPISMQK-----KGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVV----HNTTYGAMFTIALRRYGQLCIGLYRLHDQD-----------NPDSMKRYVITNPPAELRIKNTDYVYVLEQF 1118          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 1034.63 bits (2674), Expect = 0.000e+0
Identity = 566/1118 (50.63%), Postives = 760/1118 (67.98%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNL-----SRWFRNP-----NVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQF-QNTLHKL--RKFETTKSRHSNLES-----------------------KKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRF-----DTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            KC +E K++ FL +S+      ++++  +RV+ +L      + F  P      V   +N +    S  D    + ++  +        ++ KDW+GE+ISGQ+LTG+ LV LV ILSIGS+ IY Y+ S  +   E C+ W  S +QQ+DL FNI FLVYFF+RF+A++DK+ F LE+YS++D +TIPPSFV +Y+ R W+G RF+RA+RLMT+ D+L +LN++K+SSSIRL  L T FV++ +T +G +HL+E+SG         +R  + D  YF++VT+STVGYGDI C T  G+L M+FFIL GLA+FA+ +PE+ ++IG+R +Y   ++ +  K+HI++CGHITYDSVS+FL DFLH+DR+DVDV++V L+   P+LEL+ + KR+F  VEF+ G+ M+S DLSR+++ +ADACLVLANKYS +PDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDWKRGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   + P WLN YL GAGMEMY+E  SP+F   +F EA  + F  L LLL+AIE K   N+E +IAINP   I I+P  QGFFIAQSADE KRAFF+C++CH + +    IK+C C     F +NT H    R+     S +S+ ++                         G    +V+LR     RP+   R +++      RG+ F++   ++F     D+TGMFHWCP + +ED +L +  Q  M V + H+VVC+FA+ +S LIGL NF+MPLR+SNFHY EL ++V +G+LEYL++EWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N+ +D  L DKEAIL SLN++AM FD D+     FP       +S   S   M+K     K +K G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP+LE +LAEG G++G Y TP+TL NRDRCR+  I +  NP   +         YG +F  AL R+G LCIGLYRL + D           N +S KRYVITNPP  L+I  +D VY L+QF
Sbjct:   38 KCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSETDPFLKQQEEKHL-----GWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAAREKNAKISDYSDFDALFYQNDARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNT-EDTTLADKEAILASLNIKAMQFD-DTLGF--FPMRHQTGDRSPLGSPISMQK-----KGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVV----HNTTYGAMFTIALRRYGQLCIGLYRLHDQD-----------NPDSMKRYVITNPPAELRIKNTDYVYVLEQF 1125          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 1034.25 bits (2673), Expect = 0.000e+0
Identity = 569/1121 (50.76%), Postives = 764/1121 (68.15%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNL-----SRWFRNP-----NVNSKLNLTDQGLSRPD-FIDTK-------LDDDQVHVEISNCFSD--LKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQF-QNTLHKLRK---------FETTKSRHSNL---------ESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRF-----DTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            KC +E K++ FL +S+      ++++  +RV+ +L      + F  P      V   +N +    S  D F+  +       + +D + +++     D   KDW+GE+ISGQ+LTG+ LV LV ILSIGS+ IY Y+ S  +   E C+ W  S +QQ+DL FNI FLVYFF+RF+A++DK+ F LE+YS++D +TIPPSFV +Y+ R W+G RF+RA+RLMT+ D+L +LN++K+SSSIRL  L T FV++ +T +G +HL+E+SG         +R  + D  YF++VT+STVGYGDI C T  G+L M+FFIL GLA+FA+ +PE+ ++IG+R +Y   ++ +  K+HI++CGHITYDSVS+FL DFLH+DR+DVDV++V L+   P+LEL+ + KR+F  VEF+ G+ M+S DLSR+++ +ADACLVLANKYS +PDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDWKRGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK     P+WLN YL GAGMEMY++  S +F G TF EAV + F  L LLL+AIE K   N+E +IAINP   I I+P  QGFFIAQSADE KRAFF+C++CH + +    IK+C C     F +NT H             F    +R +++             G    +V+LR     RP+   R +++      RG+ F++   ++F     D+TGMFHWCP + +ED +L +  Q  M V + H+VVC+FA+ +S LIGL NF+MPLR+SNFHY EL ++V +G+LEYL++EWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N+ +D  L DKEAIL SLN++AM FD D+     FP       +S   S   M+K     K +K G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP+LE +LAEG G++G Y TP+TL NRDRCR+  I +  NP   +         YG +F  AL R+G LCIGLYRL + D           N +S KRYVITNPP  L+I  +D VY L+QF
Sbjct:   38 KCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSETDPFLKQQEEKHLGWMTEDSLAMQLYRSIRDRRAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARDYSDFDALFYQNDARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNT-EDTTLADKEAILASLNIKAMQFD-DTLGF--FPMRHQTGDRSPLGSPISMQK-----KGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVV----HNTTYGAMFTIALRRYGQLCIGLYRLHDQD-----------NPDSMKRYVITNPPAELRIKNTDYVYVLEQF 1133          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100631)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 563/1135 (49.60%), Postives = 743/1135 (65.46%), Query Frame = 2
Query:   68 KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS-IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKL----RKFETTKSRH-SNLESKK------------------------------GDESSKVKLRRN--RNI-----------RPNERKRPHNIRNQKSFRGLRFN-----------EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD----IDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCN-YGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            K++ FL +S+   L G+L++  +R    +    + P         D G + P   + K   ++   E     ++ KDW+GE+ISGQ  TG+ LV LV ILSI S+ IY  + S  +   E C KW+ ++TQQ+DLAFNI F+VYFF+RF+A++DKL F LE+YSFVD +TIPPSFV +Y+ R WIGLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +TA+G IHL+E+SG P+  +N    ++    YF+IVT+STVGYGD+ C T  G+  ++FF+L GLA+FA+SIPE+IE++GS N+Y    +++  K+HI++CGHITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+QG+ MN  DL R+++  ADACLVLANKY  DPDAEDAANIMRVISIKN+   I+VI+QLMQYHNKAYLLNIPSWDWK+GDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   ++ +W N YL G GMEMY+E  SP F G  FA+A  + F  LKLLL+AIE K      +S I+INP+   KI+   QGFFIAQSADE KRA+F+C+ CH + +    IK+C C     F+  +  +    R  + T+ R  +NL ++                               G + +KVK   N  R +           RP  R      +NQ     L              E+   ++D+TGMFHW P K +ED +L D +Q  M V + H+VVC+FA+ +S LIGL N VMPLRASNFHY EL ++V +G+++Y++REWK L N P +S+L+GS LSR +LRAVNVN+  MC ILS+K   S DD  L DKEAIL SLN++AM FD    + S +   F  L       +     G          S  GA++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMST YFN+NALTLIR+LITGGATP+LE +LAEG G++G Y T ++L NRDRCRV  I +   PLA+      G C  YG LF+ AL+ +G+LCIGLYR  +  +  +          S KRYVITNPPD   +  +D V+ L QF
Sbjct:   48 KYWCFLLSSIFTFLAGLLVVLLWRAFAFVC-CRKEP---------DLGPNDPKQKEQKASRNKQEFE-GTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEE--VERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLATFRKGVRAVQMVGRASDITRDREDTNLLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV-PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRG----------SVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQF-----GECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCD---------ASSKRYVITNPPDDFSLLPTDQVFVLMQF 1142          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0084684)

HSP 1 Score: 1036.17 bits (2678), Expect = 0.000e+0
Identity = 562/1130 (49.73%), Postives = 738/1130 (65.31%), Query Frame = 2
Query:   68 KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS-IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCA-----AHKQFQNTLHKLRKFETTKSRHSNLESK-------------------------KGDESSKVKLRRN--RNI-----------RPNERKRPHNIRNQKSFRGLRFN-----------EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD----IDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCN-YGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            K++ FL +S+   L G+L++  +R    +    + P         D G + P   + K   ++   E     ++ KDW+GE+ISGQ  TG+ LV LV ILSI S+ IY  + S  +   E C KW+ ++TQQ+DLAFNI F+VYFF+RF+A++DKL F LE+YSFVD +TIPPSFV +Y+ R WIGLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +TA+G IHL+E+SG P+  +N    ++    YF+IVT+STVGYGD+ C T  G+  ++FF+L GLA+FA+SIPE+IE++GS N+Y    +++  K+HI++CGHITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+QG+ MN  DL R+++  ADACLVLANKY  DPDAEDAANIMRVISIKN+   I+VI+QLMQYHNKAYLLNIPSWDWK+GDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   ++ +W N YL G GMEMY+E  SP F G  FA+A  + F  LKLLL+AIE K      +S I+INP+   KI+   QGFFIAQSADE KRA+F+C+ CH + +    IK+C C         +F +     R  E T   + N+                             G + +KVK   N  R +           RP  R      +NQ     L              E+   ++D+TGMFHW P K +ED +L D +Q  M V + H+VVC+FA+ +S LIGL N VMPLRASNFHY EL ++V +G+++Y++REWK L N P +S+L+GS LSR +LRAVNVN+  MC ILS+K   S DD  L DKEAIL SLN++AM FD    + S +   F  L       +     G          S  GA++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMST YFN+NALTLIR+LITGGATP+LE +LAEG G++G Y T ++L NRDRCRV  I +   PLA+      G C  YG LF+ AL+ +G+LCIGLYR  +  +  +          S KRYVITNPPD   +  +D V+ L QF
Sbjct:   48 KYWCFLLSSIFTFLAGLLVVLLWRAFAFVC-CRKEP---------DLGPNDPKQKEQKASRNKQEFE-GTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEE--VERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLGDITRDREDTNLLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV-PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRG----------SVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQF-----GECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCD---------ASSKRYVITNPPDDFSLLPTDQVFVLMQF 1137          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100632)

HSP 1 Score: 1035.79 bits (2677), Expect = 0.000e+0
Identity = 562/1119 (50.22%), Postives = 740/1119 (66.13%), Query Frame = 2
Query:   68 KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS-IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCA-----AHKQFQNTL--HKLRK-----FETTKSRHSN-------LESKKGDESSKVKLRRN--RNI-----------RPNERKRPHNIRNQKSFRGLRFN-----------EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD----IDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCN-YGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            K++ FL +S+   L G+L++  +R    +    + P         D G + P   + K   ++   E     ++ KDW+GE+ISGQ  TG+ LV LV ILSI S+ IY  + S  +   E C KW+ ++TQQ+DLAFNI F+VYFF+RF+A++DKL F LE+YSFVD +TIPPSFV +Y+ R WIGLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +TA+G IHL+E+SG P+  +N    ++    YF+IVT+STVGYGD+ C T  G+  ++FF+L GLA+FA+SIPE+IE++GS N+Y    +++  K+HI++CGHITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+QG+ MN  DL R+++  ADACLVLANKY  DPDAEDAANIMRVISIKN+   I+VI+QLMQYHNKAYLLNIPSWDWK+GDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   ++ +W N YL G GMEMY+E  SP F G  FA+A  + F  LKLLL+AIE K      +S I+INP+   KI+   QGFFIAQSADE KRA+F+C+ CH + +    IK+C C         +F + +    +R+       T    H N         +  G + +KVK   N  R +           RP  R      +NQ     L              E+   ++D+TGMFHW P K +ED +L D +Q  M V + H+VVC+FA+ +S LIGL N VMPLRASNFHY EL ++V +G+++Y++REWK L N P +S+L+GS LSR +LRAVNVN+  MC ILS+K   S DD  L DKEAIL SLN++AM FD    + S +   F  L       +     G          S  GA++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMST YFN+NALTLIR+LITGGATP+LE +LAEG G++G Y T ++L NRDRCRV  I +   PLA+      G C  YG LF+ AL+ +G+LCIGLYR  +  +  +          S KRYVITNPPD   +  +D V+ L QF
Sbjct:   48 KYWCFLLSSIFTFLAGLLVVLLWRAFAFVC-CRKEP---------DLGPNDPKQKEQKASRNKQEFE-GTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEE--VERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLVLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV-PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRG----------SVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQF-----GECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCD---------ASSKRYVITNPPDDFSLLPTDQVFVLMQF 1126          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0330287)

HSP 1 Score: 1035.4 bits (2676), Expect = 0.000e+0
Identity = 562/1130 (49.73%), Postives = 738/1130 (65.31%), Query Frame = 2
Query:   68 KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS-IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCA-----AHKQFQNTLHKLRKFETTKSRHSNLESK-------------------------KGDESSKVKLRRN--RNI-----------RPNERKRPHNIRNQKSFRGLRFN-----------EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD----IDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCN-YGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            K++ FL +S+   L G+L++  +R    +    + P         D G + P   + K   ++   E     ++ KDW+GE+ISGQ  TG+ LV LV ILSI S+ IY  + S  +   E C KW+ ++TQQ+DLAFNI F+VYFF+RF+A++DKL F LE+YSFVD +TIPPSFV +Y+ R WIGLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +TA+G IHL+E+SG P+  +N    ++    YF+IVT+STVGYGD+ C T  G+  ++FF+L GLA+FA+SIPE+IE++GS N+Y    +++  K+HI++CGHITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+QG+ MN  DL R+++  ADACLVLANKY  DPDAEDAANIMRVISIKN+   I+VI+QLMQYHNKAYLLNIPSWDWK+GDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   ++ +W N YL G GMEMY+E  SP F G  FA+A  + F  LKLLL+AIE K      +S I+INP+   KI+   QGFFIAQSADE KRA+F+C+ CH + +    IK+C C         +F +     R  E T   + N+                             G + +KVK   N  R +           RP  R      +NQ     L              E+   ++D+TGMFHW P K +ED +L D +Q  M V + H+VVC+FA+ +S LIGL N VMPLRASNFHY EL ++V +G+++Y++REWK L N P +S+L+GS LSR +LRAVNVN+  MC ILS+K   S DD  L DKEAIL SLN++AM FD    + S +   F  L       +     G          S  GA++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMST YFN+NALTLIR+LITGGATP+LE +LAEG G++G Y T ++L NRDRCRV  I +   PLA+      G C  YG LF+ AL+ +G+LCIGLYR  +  +  +          S KRYVITNPPD   +  +D V+ L QF
Sbjct:   48 KYWCFLLSSIFTFLAGLLVVLLWRAFAFVC-CRKEP---------DLGPNDPKQKEQKASRNKQEFE-GTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEE--VERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLGDITRDREDTNLLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV-PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRG----------SVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQF-----GECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCD---------ASSKRYVITNPPDDFSLLPTDQVFVLMQF 1137          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0334294)

HSP 1 Score: 1033.48 bits (2671), Expect = 0.000e+0
Identity = 559/1107 (50.50%), Postives = 732/1107 (66.12%), Query Frame = 2
Query:   68 KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS-IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSN-------LESKKGDESSKVKLRRN--RNI-----------RPNERKRPHNIRNQKSFRGLRFN-----------EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD----IDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCN-YGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            K++ FL +S+   L G+L++  +R    +    + P         D G + P   + K   ++   E     ++ KDW+GE+ISGQ  TG+ LV LV ILSI S+ IY  + S  +   E C KW+ ++TQQ+DLAFNI F+VYFF+RF+A++DKL F LE+YSFVD +TIPPSFV +Y+ R WIGLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +TA+G IHL+E+SG P+  +N    ++    YF+IVT+STVGYGD+ C T  G+  ++FF+L GLA+FA+SIPE+IE++GS N+Y    +++  K+HI++CGHITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+QG+ MN  DL R+++  ADACLVLANKY  DPDAEDAANIMRVISIKN+   I+VI+QLMQYHNKAYLLNIPSWDWK+GDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   +   W N YL+G G EMY+E  SP+F G TF +A  + F  LKLLL+AIE K      +S I+INP+   KI+   QGFFIAQSADE KRA+F+C+ CH + +    IK+C C                 T    H N         +  G + +KVK   N  R +           RP  R      +NQ     L              E+   ++D+TGMFHW P K +ED +L D +Q  M V + H+VVC+FA+ +S LIGL N VMPLRASNFHY EL ++V +G+++Y++REWK L N P +S+L+GS LSR +LRAVNVN+  MC ILS+K   S DD  L DKEAIL SLN++AM FD    + S +   F  L       +     G          S  GA++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMST YFN+NALTLIR+LITGGATP+LE +LAEG G++G Y T ++L NRDRCRV  I +   PLA+      G C  YG LF+ AL+ +G+LCIGLYR  +  +  +          S KRYVITNPPD   +  +D V+ L QF
Sbjct:   31 KYWCFLLSSIFTFLAGLLVVLLWRAFAFVC-CRKEP---------DLGPNDPKQKEQKASRNKQEFE-GTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEE--VERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIKGAEEGADSKISINPRG-AKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKV-PSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRG----------SVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQF-----GECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCD---------ASSKRYVITNPPDDFSLLPTDQVFVLMQF 1097          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 993.03 bits (2566), Expect = 0.000e+0
Identity = 537/1091 (49.22%), Postives = 725/1091 (66.45%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFID----TKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    + N K N   Q ++ P  I     TK  +++     S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q  ++ +  Y ++VT+STVGYGD+  RT  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELK GFIAQSCLA G ST+LANLF+MRS+        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+SI INP N +K++ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C                         +E +     S  K +RN  +R +    P  +R+      +  NEQ+       +R+D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SAL+GL N VMPLRASNFHY EL  IVF+G+L+YL+REW++L NFP + IL G+ LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G++I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   40 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCNIK-NKEAQKVNNPITIQADGTTKTGNEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSS---DPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSE-QRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGC-----------------------KRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLL--IPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEA-SMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCLMQF 1074          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 991.104 bits (2561), Expect = 0.000e+0
Identity = 537/1094 (49.09%), Postives = 724/1094 (66.18%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFID----TKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS---IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    + N K N   Q ++ P  I     TK  +++     S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q  ++ +  Y ++VT+STVGYGD+  RT  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELK GFIAQSCLA G ST+LANLF+MRS+        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS   E  S   I INP N +K++ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C                         +E +     S  K +RN  +R +    P  +R+      +  NEQ+       +R+D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SAL+GL N VMPLRASNFHY EL  IVF+G+L+YL+REW++L NFP + IL G+ LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G++I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   57 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCNIK-NKEAQKVNNPITIQADGTTKTGNEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSS---DPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGC-----------------------KRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLL--IPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEA-SMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCLMQF 1095          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 989.564 bits (2557), Expect = 0.000e+0
Identity = 542/1118 (48.48%), Postives = 726/1118 (64.94%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFID----TKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD-----------------IDSFKMENFP-------------------ELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    + N K N   Q ++ P  I     TK  +++     S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q  ++ +  Y ++VT+STVGYGD+  RT  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELK GFIAQSCLA G ST+LANLF+MRS+        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+SI INP N +K++ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C                         +E +     S  K +RN  +R +    P  +R+      +  NEQ+       +R+D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SAL+GL N VMPLRASNFHY EL  IVF+G+L+YL+REW++L NFP + IL G+ LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD                 +D    +N P                     L +  K +   SF  EK+        SG +I+MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   57 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCNIK-NKEAQKVNNPITIQADGTTKTGNEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSS---DPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSE-QRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGC-----------------------KRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLL--IPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEA-SMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELAKPGKLLPLVSFSQEKN--------SGTNIQMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCLMQF 1119          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: CABZ01092907.1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1b [Source:NCBI gene;Acc:798583])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 262/462 (56.71%), Postives = 355/462 (76.84%), Query Frame = 2
Query:  284 SDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTF 1660
            + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  ++++ T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRS+        W   YLEG   EMY+EY S AF G +F
Sbjct:    2 TSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---DPIESCEHFDKNFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDP--WENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSF 457          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnt2 (potassium channel, subfamily T, member 2 [Source:ZFIN;Acc:ZDB-GENE-130530-783])

HSP 1 Score: 129.028 bits (323), Expect = 1.061e-29
Identity = 161/689 (23.37%), Postives = 292/689 (42.38%), Query Frame = 2
Query:  617 WIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQK--DKQHIILC-GHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELE--LKNVLK--RYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLF-TMRSFKNDANLPNWLNTYLEGAGMEMYS-----EYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRP-----HNIRNQKSFRGLRFNEQVSRRF-----DTTGMF-HWCPEKP----------------------IEDVL---LNDSDQLKMCVFS---NHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKRE--WKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLV 2521
            W+  R + +    T++D+   ++  +S+   ++  L +T V L+ T   FI  VE      +   G      D  YF IVT STVG+GD+V      KL+++F IL  L +      E+  +   R +    + +Q+   ++H++LC   I  D + +FL +F    + +    I++    P EL+  +++VL+   +   V + QGS +   DL R +L  A+AC +L  +   D +A D   I+R  ++K+F P   + VQ+++  NK ++        K  D  VC  E K   +A +C+ P  ST +  L  T +  +   +  +W   Y + +G E+YS       F   + G  FA A   ++    + LI +  + T     SI +NP     +      F+I+ + +E+                 Y+KQ  C  + + Q  +        T+     ++ ++    S ++   +     +ER++P       + +  SF+  +     S+          G F  + P  P                      +E  L    N  D     V+S     ++V V    NS    L NF++PLRAS    +EL  IV +  LE++  E   ++++ FP +  L GS  S  +L    V+ +   V++  +S  +  + ++ 
Sbjct:  147 WLAKRALES----TVNDLHRAIHRTQSAMFNQVLMLISTIVCLIFT---FICGVEH-----LQRAGTKLTVFDSFYFCIVTFSTVGFGDVVPDIWPSKLLVVFMILVTLMVLPIQFEELAYLWMERQKSGGYYSRQRAETEKHVVLCVSSIKIDLLMDFLNEFYAHPKLEEHYVIILC---PTELDAAVRSVLRIPMWSHRVIYLQGSALKDQDLVRAKLDYAEACFILTCRCVADRNAADYQTILRAWAVKDFAPGCTLFVQILKPENKFHV--------KFADHIVCEEEFKFAMLAMNCICPATSTFITLLVHTSQGLEGQHSPEDWHRIYGKCSGNEVYSIVLNKSIFFSEYEGNNFAYASFNAYNKYGICLIGVCPEDT----KSILLNPGAQYTMNAMDTCFYISLTKEEN----------------SYVKQRECGNNSKTQPPMGS----AITRPGTMAIDIQEISIPSSLEPSLSTGANTSERRQPIIIPVLELPDSPSFQASKLLSGQSKSHINGDESNDGYFIGYPPNLPYIGSSTILCHLRKKKMPTCCMHLEKFLSKTCNHKDDEDAKVYSLKSKLVIVSVETAGNS----LYNFILPLRASYRPQNELWPIVLL--LEHVPDEEFLETISWFPMIYYLLGSIDSLDDLLRCGVSFAASMVVVDKESTMTAKEDYMA 782          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 1011.91 bits (2615), Expect = 0.000e+0
Identity = 537/1095 (49.04%), Postives = 735/1095 (67.12%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWF-------RNPNVNSKLNLTDQGLSRPDF--IDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS-------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDK----ISK-----SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R  + L  W        +N +    +N     ++  D+   D K +     V      + +KDW+G +IS Q LTG+ LV  V  LSIG++ IY  + S      E C  + +  T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P    +N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS    E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C+C    QF  +       +  K  +   E ++    S  K +RN  +R +    P+ +R+      +  N+Q+        +R+D+TGMFHWCP K ++ VLL  S+   M V S H+VVC+F +  SALIG+ N VMPLRASNFHY EL +IVF+G+L+YLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GME+   D+     +++     +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG L+ +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   79 WWAFLASSMVTFFGGLFIILVWRTFKYL--WTVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEETAAPGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSS---NPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSE-KGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRRSQFHKS-----PLQNKKKGNGPFEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLL--MTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEA-AMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGLLQ--------ANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLYCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1136          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 1000.73 bits (2586), Expect = 0.000e+0
Identity = 535/1095 (48.86%), Postives = 730/1095 (66.67%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWF-------RNPNVNSKLNLTDQGLSRPDF--IDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS-------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDK----ISK-----SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R  + L  W        +N +    +N     ++  D+   D K +     V      + +KDW+G +IS Q LTG+ LV  V  LSIG++ IY  + S      E C  + +  T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P    +N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS    E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C+C                         LE ++    S  K +RN  +R +    P+ +R+      +  N+Q+        +R+D+TGMFHWCP K ++ VLL  S+   M V S H+VVC+F +  SALIG+ N VMPLRASNFHY EL +IVF+G+L+YLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GME+   D+     +++     +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG L+ +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   33 WWAFLASSMVTFFGGLFIILVWRTFKYL--WTVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEETAAPGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSS---NPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSE-KGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCAC-----------------------KRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLL--MTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEA-AMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGLLQ--------ANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLYCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1072          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 994.956 bits (2571), Expect = 0.000e+0
Identity = 533/1095 (48.68%), Postives = 727/1095 (66.39%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWF-------RNPNVNSKLNLTDQGLSRPDF--IDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS-------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDK----ISK-----SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R  + L  W        +N +    +N     ++  D+   D K +     V      + +KDW+G +IS Q LTG+ LV  V  LSIG++ IY  + S      E C  + +  T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P    +N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA  +PE+  +I +R +Y   F   + ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS    E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C+C                         LE ++    S  K +RN  +R +    P+ +R+      +  N+Q+        +R+D+TGMFHWCP K ++ VLL  S+   M V S H+VVC+F +  SALIG+ N VMPLRASNFHY EL +IVF+G+L+YLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GME+   D+     +++     +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG L+ +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   79 WWAFLASSMVTFFGGLFIILVWRTFKYL--WTVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEETAAPGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSS---NPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTFNATRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSE-KGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCAC-----------------------KRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLL--MTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEA-AMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGLLQ--------ANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLYCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1118          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 543/1130 (48.05%), Postives = 741/1130 (65.58%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWF-------RNPNVNSKLNLTDQGLSRPDF--IDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKF--------------ETTKSRHSNLE---------------SKKGDES------SKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS-------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDK----ISK-----SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R  + L  W        +N +    +N     ++  D+   D K +     V      + +KDW+G +IS Q LTG+ LV  V  LSIG++ IY  + S      E C  + +  T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P    +N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS    E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C+C   K   +T  +L +                T +S    LE               S +G E       S  K +RN  +R +    P+ +R+      +  N+Q+        +R+D+TGMFHWCP K ++ VLL  S+   M V S H+VVC+F +  SALIG+ N VMPLRASNFHY EL +IVF+G+L+YLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GME+   D+     +++     +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG L+ +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   79 WWAFLASSMVTFFGGLFIILVWRTFKYL--WTVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEETAAPGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSS---NPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSE-KGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRPK--MSTRKRLIQACCMGCSEIDCSCMSGTLRSNMGTLEQAFPISPVSVNDFSTSLRGFEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLL--MTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEA-AMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGLLQ--------ANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLYCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1174          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 535/1118 (47.85%), Postives = 729/1118 (65.21%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWF-------RNPNVNSKLNLTDQGLSRPDF--IDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS-----------------------IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS-------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDK----ISK-----SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R  + L  W        +N +    +N     ++  D+   D K +     V      + +KDW+G +IS Q LTG+ LV  V  LSIG++ IY  + S      E C  + +  T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P    +N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS   E                          I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C+C                         LE ++    S  K +RN  +R +    P+ +R+      +  N+Q+        +R+D+TGMFHWCP K ++ VLL  S+   M V S H+VVC+F +  SALIG+ N VMPLRASNFHY EL +IVF+G+L+YLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GME+   D+     +++     +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG L+ +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   16 WWAFLASSMVTFFGGLFIILVWRTFKYL--WTVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEETAAPGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSS---NPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRGSKLEAVDILARFCVITFRVFFTRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCAC-----------------------KRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLL--MTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEA-AMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGLLQ--------ANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLYCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1079          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 543/1098 (49.45%), Postives = 737/1098 (67.12%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQ--VHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHK-QFQNTLHK---LRKFETTKSRH--SNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V  E+    + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C   K + +   HK   + K  T  S H    +E ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   22 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEVVAAEVG-WMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLKVEARARYHKDPFMHKNATPNSPHVPKPVEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1084          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 543/1098 (49.45%), Postives = 737/1098 (67.12%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQ--VHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHK-QFQNTLHK---LRKFETTKSRH--SNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V  E+    + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C   K + +   HK   + K  T  S H    +E ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   22 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEVVAAEVG-WMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLKVEARARYHKDPFMHKNATPNSPHVPKPVEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1084          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 543/1101 (49.32%), Postives = 736/1101 (66.85%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQ--VHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS---IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHK-QFQNTLHK---LRKFETTKSRH--SNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V  E+    + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS   E  S   I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C   K + +   HK   + K  T  S H    +E ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   22 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEVVAAEVG-WMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLKVEARARYHKDPFMHKNATPNSPHVPKPVEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1088          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 996.497 bits (2575), Expect = 0.000e+0
Identity = 537/1092 (49.18%), Postives = 727/1092 (66.58%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQ--VHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V  E+    + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C                         LE ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   87 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEVVAAEVG-WMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGC-----------------------RRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1120          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 996.112 bits (2574), Expect = 0.000e+0
Identity = 537/1092 (49.18%), Postives = 727/1092 (66.58%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQ--VHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V  E+    + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C                         LE ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   22 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKEEVVAAEVG-WMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGC-----------------------RRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1055          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q95V25|SLO1_CAEEL (Calcium-activated potassium channel slo-1 OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=2)

HSP 1 Score: 1030.01 bits (2662), Expect = 0.000e+0
Identity = 567/1120 (50.62%), Postives = 761/1120 (67.95%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNL-----SRWFRNP-----NVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQF-QNTLHK----------LRKFET-------------TKSRHSNLESKKGDESSKVKLRRN----RNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRF-----DTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            KC +E K++ FL +S+      ++++  +RV+ +L      + F  P      V   +N +    S  D    + ++  +        ++ KDW+GE+ISGQ+LTG+ LV LV ILSIGS+ IY Y+ S  +   E C+ W  S +QQ+DL FNI FLVYFF+RF+A++DK+ F LE+YS++D +TIPPSFV +Y+ R W+G RF+RA+RLMT+ D+L +LN++K+SSSIRL  L T FV++ +T +G +HL+E+SG         +R  + D  YF++VT+STVGYGDI C T  G+L M+FFIL GLA+FA+ +PE+ ++IG+R +Y   ++ +  K+HI++CGHITYDSVS+FL DFLH+DR+DVDV++V L+   P+LEL+ + KR+F  VEF+ G+ M+S DLSR+++ +ADACLVLANKYS +PDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDWKRGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK     P+WLN YL GAGMEMY++  S +F G TF EAV + F  L LLL+AIE K   N+E +IAINP   I I+P  QGFFIAQSADE KRAFF+C++CH + +    IK+C C     F +NT H           L++F+               + R  N +S   D     K  R     + + P+   R +++      RG+ F++   ++F     D+TGMFHWCP + +ED +L +  Q  M V + H+VVC+FA+ +S LIGL NF+MPLR+SNFHY EL ++V +G+LEYL++EWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N+ +D  L DKEAIL SLN++AM FD D+     FP       +S   S   M+K     K +K G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP+LE +LAEG G++G Y TP+TL NRDRCR+  I +  NP   +         YG +F  AL R+G LCIGLYRL + D           N +S KRYVITNPP  L+I  +D VY L+QF
Sbjct:   38 KCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSETDPFLKQQEEKHL-----GWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQSSTSDTHLNTKSLRFAYEIKKLMPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNT-EDTTLADKEAILASLNIKAMQFD-DTLGF--FPMRHQTGDRSPLGSPISMQK-----KGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVV----HNTTYGAMFTIALRRYGQLCIGLYRLHDQD-----------NPDSMKRYVITNPPAELRIKNTDYVYVLEQF 1127          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q8AYS8|KCMA1_CHICK (Calcium-activated potassium channel subunit alpha-1 OS=Gallus gallus OX=9031 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 540/1095 (49.32%), Postives = 726/1095 (66.30%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWF----------RNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W               +N   +    G  +P    T   ++ V  E+    + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q   + +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLAPG ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS    E+SI INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C                         LE ++    S  K +RN  +R +    P  +R+      +  NEQ+       +++D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SALIGL N VMPLRASNFHY EL +IVF+G+LEYL+REW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   45 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGVKNKEAQKINGGGDTQADGACKP----TDEKEENVAAEVG-WMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNNQQLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELVFAKLKLLMIAIEYKSE-KRESSILINPGNHVKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGC-----------------------KRLEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLL--IPGNEQIDNMDANVKKYDSTGMFHWCPAKDIEKVILTRSEA-AMTVLSGHVVVCIFGDVKSALIGLRNLVMPLRASNFHYHELKHIVFVGSLEYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGLLRQPSITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1079          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q90ZC7|KCMA1_XENLA (Calcium-activated potassium channel subunit alpha-1 OS=Xenopus laevis OX=8355 GN=kcnma1 PE=2 SV=1)

HSP 1 Score: 1001.12 bits (2587), Expect = 0.000e+0
Identity = 534/1093 (48.86%), Postives = 732/1093 (66.97%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWF-------RNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS-------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDK----ISK-----SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R  + L  W        +N      +N+    ++  D+  T  D ++V V      + +KDW+G +IS Q LTG+ LV  V  LSIG++ IY  + S      E C  + +  T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P    +N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + K++F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS    E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C+C                         LE ++    S  K +RN  +R +    P+ +R+      +  N+Q+        +R+D+TGMFHWCP K ++ VLL  S+   M V S H+VVC+F +  SALIG+ N VMPLRASNFHY EL +IVF+G+L+Y+KREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GME+   D+     +++     +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG L+ +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   53 WWAFLASSMVTFFGGLFIILVWRTFKYL--WTVCCHCGGKNKEAQKVVNVASSQVTDGDYKPTD-DKEEVGVAEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSS---NPIESCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECMYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKKHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKDGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEYKSE-KGESRILINPGNHMKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCAC-----------------------KRLEDEQPSALSPKKKQRNGGMRHSPNTSPNMMRHDPLL--MTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEA-AMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYIKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGLLQ--------ANSQGFTPPGMERSSPDNSPLHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALVAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLYCKALKTYNMLCFGIYRL--------RDAHISTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1089          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|O18866|KCMA1_PIG (Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=KCNMA1 PE=2 SV=2)

HSP 1 Score: 999.194 bits (2582), Expect = 0.000e+0
Identity = 537/1092 (49.18%), Postives = 727/1092 (66.58%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQ--VHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V  E+    + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C                         LE ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   61 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKTKEAQKINNGASQADGTLKPVDEKEEVVAAEVG-WMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGC-----------------------KRLEDEQPSTLSPKKKQRNGGMRNSPSSSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1094          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q9BG98|KCMA1_RABIT (Calcium-activated potassium channel subunit alpha-1 OS=Oryctolagus cuniculus OX=9986 GN=KCNMA1 PE=2 SV=1)

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 536/1091 (49.13%), Postives = 725/1091 (66.45%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQ---GLSRPDFIDTKLDDDQVHVEIS-NCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +   K     +   G S+ D     +D+ +  V       + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  + +  T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + F  LKLL+IAIE KS  N E+ I INP N +KI+ G  GFFIA  A E KRAFF+C+ CH +    K IK+C C                         LE ++    S  K +RN  +R +    P  +R+      +  N+Q+       +++D+TGMFHWC  K IE V+L  S+   M V S H+VVC+F + +SALIGL N VMPLRASNFHY EL +IVF+G++EYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DD  L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D+             +G +I +ITEL  D+NVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE ++AE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   88 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCGGKAKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---NPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDP--WENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSA-NRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGC-----------------------KRLEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLL--IPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEA-AMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1121          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A267GH63 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031175g2 PE=4 SV=1)

HSP 1 Score: 1115.14 bits (2883), Expect = 0.000e+0
Identity = 569/1080 (52.69%), Postives = 756/1080 (70.00%), Query Frame = 2
Query:   44 TKFKCQDEKWYIFLATSVACQLCGILIIGFYRVIQNL----SRWFRNPNVNSKL-NLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNF----LDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNE-ENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQ-------FQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRP--NERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPP 3223
            T     + +WY++L++S      G+ ++  YR+ + L      + R+  V S   N ++   + P   +   +D+   +  +   ++ KDW+GE+ISGQ  TG+ LV LV ++SI S+ +Y+ + +V    TE CV W  +++ Q+DLAFNI+FL+YFF+RF+A++DKL FW ELYS VD++TIPPSFV +YM R WIGLRF RA+R+++L DVL +LNV+++S+SIRL  L T F SLV+TA+GFIHL E+SG P    N +NRNF        YF+IVTI+TVGYGD+ C T TG++     I+GGLA+FANSIPE+ +I+ SRN+Y   F K+  KQHI+LCGHITY+SVSNFL DFLH+DREDVDV+IVIL+   P+LEL+ +LKR+F  V+F+QGS MN+ DL R+ L  ADACLVLAN+Y PDPDAEDAANIMRVISIKNFC  IKVI+QLMQYHNK YLLNIPSWDWK+GDDAVC+AELKLGFIAQSCLA GFSTLLANLFTMRS++    +P WLN YLEGAG EMY+E+ SPAF G TF  A  + F  L+LLLIA+E ++  N  E+ IAINPK ++ ++ G QGFF+AQSA+E K+A+F+C++CH +    K I++C C +  +       F+N  H   KF  T  + ++  +     +    +     +R     RK+   +  Q++    +  +QV R+FD+TGMFHWCP+   E+ LL D +Q+ + VFSNHIVVC+FA+++S LIGL +FVMPLRASNFHY EL +++F+GN +Y++REWK+L NFP LS+  GS L+R+NLRAVN+N+++MCV+LSSK N+  DDA LVDKEAILCSLN++AM FD                               T  +  +   +++++TELA+D NVQFLDQDD+D P+T L+MTQPFACG +FAVSVLDSLMSTAYFNENALTLIRTL+TGGATP+LEQ+LAEG GI+G + +P+TL NRDR RVT + +  + L E+      G  Y  LFL AL R GILCIGLYR +  ++   D+          KRYVITNPP
Sbjct:   10 TALCVANRRWYVYLSSSGIALASGVTLVLLYRLAEYLFVRYDSYQRSRRVKSDTENSSNANANAPG--EQTSEDEGPKLSWT---TEAKDWAGELISGQTATGRILVVLVFLVSIASLVVYIAD-TVRMVETEECVSWPENVSHQVDLAFNIVFLLYFFIRFIAAHDKLWFWFELYSLVDIFTIPPSFVAIYMNRTWIGLRFTRALRILSLPDVLQYLNVLRTSTSIRLFQLITFFASLVLTAAGFIHLAENSGDPPSFTN-RNRNFDMNYFTCIYFVIVTIATVGYGDVFCTTTTGRIFSALVIMGGLAVFANSIPEIADILSSRNKYGGHFHKEAGKQHIVLCGHITYESVSNFLGDFLHEDREDVDVQIVILDKHVPDLELQGLLKRHFTQVDFFQGSVMNARDLGRVDLPTADACLVLANRYCPDPDAEDAANIMRVISIKNFCDHIKVIIQLMQYHNKTYLLNIPSWDWKQGDDAVCVAELKLGFIAQSCLAFGFSTLLANLFTMRSYREGKEMPVWLNNYLEGAGAEMYTEFLSPAFEGLTFPAAAELCFSKLRLLLIAVEARNDANSSESCIAINPKENVVVQKGTQGFFVAQSAEEVKKAYFYCKRCHGDVDDAKLIRKCRCRSVAEKPPSKMIFRNR-HANAKFPKTVEQQNSARNGSAGVADGTPVGEATELRQLRGGRKQSMIVSAQEA----KLLDQVERKFDSTGMFHWCPDVSFEEALL-DREQMSLTVFSNHIVVCLFADASSPLIGLRSFVMPLRASNFHYGELRHVIFVGNTDYMRREWKTLMNFPKLSVFPGSPLNRSNLRAVNINLAQMCVVLSSKQNSGGDDATLVDKEAILCSLNIKAMTFD-------------------------------TPPESRRRANNVRVLTELAVDGNVQFLDQDDDDDPDTALYMTQPFACGTSFAVSVLDSLMSTAYFNENALTLIRTLVTGGATPELEQILAEGAGIRGGFSSPETLRNRDRTRVTQLPLADDRLREL---SQPGSTYSDLFLGALRRHGILCIGLYRFLAAEHEATDSEQQATPPAPYKRYVITNPP 1042          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A4E9EW23 (Calcium-activated potassium channel slo-1, putative OS=Brugia malayi OX=6279 GN=Bma-slo-1 PE=4 SV=1)

HSP 1 Score: 1074.69 bits (2778), Expect = 0.000e+0
Identity = 570/1098 (51.91%), Postives = 769/1098 (70.04%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQG---LSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFN---EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSY--SSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSVYLNVDFRKDSL 3313
            KC DE K++ FL +S+      +L++  +R+I ++    R       +   D+G   L + D     +  ++V +      ++ KDW+GE+ISGQ++TG+ LV LV +LSIGS+ IY Y+ S  +   E CV W+ S +QQ+DL FNI FL+YFF+RF+A++DK+ F LE+YSF+D +TIPPSFV +Y+ R W+GLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +T +GF+H++E+SG P       +R  + D  YF++VT+STVGYGDI C T  G+L M+FFILGGLA+FA+ IPE+ ++IGSR +Y   ++ +  K+HI++CG+ITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+ G+ M+S DLSR+++  ADACLVLANKYS DPDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDW+RGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   N P+WLN YL GAGMEMY++  S  F G TF EA  + F  L LLL+AIE K    +E +IAINP     I+P  QGFFIAQSADE KRAF++C++CH +      IK+C C     F+    ++ +     +R + + +   D  + V+LRR    R   +K   ++  +   R + F+   EQ   ++D+TGMFHWCP + +E+ +L D  Q  M V + H+VVC+FA+ NS LIGL NFVMPLRASNFHY EL ++V +G++EYLKREWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N  +D  L DKEAIL SLN++AM FD D+     +P  L Q   +VS   S   ++K     K ++ G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP++E +LAEG G++G Y TP+TL NRDRCR++ + +   P   I      G +YG +F  AL++ G LCIGLYRL       +D A +    +S KRYVITNPP  L++  SD VY L+QF   L  + RK+ L
Sbjct:   41 KCLDERKYWCFLLSSIVTFCVSMLLVVIWRIIAHIFCQRREREETDAVFDQDEGKHELLKGDLDGIAIKQEEVQI---GWMTEAKDWAGELISGQSMTGRILVVLVFVLSIGSLIIYFYDASHPNFQVETCVSWSDSPSQQIDLGFNIFFLIYFFIRFIAASDKVWFLLEVYSFIDYFTIPPSFVAIYLERNWLGLRFLRALRLMTVPDILQYLNVLKTSSSIRLTQLLSIFISVCLTGAGFVHVLENSGDPFKNFANTHRITYWDCVYFLLVTMSTVGYGDIYCTTFLGRLFMVFFILGGLAMFASYIPEIADLIGSRQKYGGEYKGEHGKKHIVVCGYITYESVSHFLQDFLHEDREDVDVEVVFLHRVPPDLELEGLFKRHFTKVEFFSGTVMDSIDLSRVKVDEADACLVLANKYSSDPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWRRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSRNTPDWLNLYLCGAGMEMYTDTLSHGFVGMTFPEAADLLFTRLGLLLLAIELKDDEKKECNIAINPAPTTTIQPQTQGFFIAQSADEVKRAFYWCKQCHEDIMDISLIKKCKCRNLALFRKGAKQV-QLSKRIARATPVSNASND--TAVQLRRLDERRSFGQKNSLSLPPEN--RTIDFSKEFEQQDMKYDSTGMFHWCPARTLEECVL-DRHQAAMTVLNGHVVVCLFADRNSPLIGLRNFVMPLRASNFHYHELKHVVIVGDVEYLKREWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIVSARIPNPNEDPTLADKEAILASLNIKAMQFD-DTLGF--YP--LRQTGGTVSPLGSPLSLQK-----KGARFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPEMELILAEGAGLRGGYSTPETLNNRDRCRISQLALQDRPFEGI----TTGSSYGQMFSTALKKHGQLCIGLYRL-------HDQAAV----DSNKRYVITNPPAELRLLLSDYVYVLEQFDPGLEYEPRKNFL 1104          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A0J9Y9H3 (BMA-SLO-1, isoform a; BMA-SLO-1, isoform d OS=Brugia malayi OX=6279 GN=bma-slo-1 PE=4 SV=1)

HSP 1 Score: 1074.69 bits (2778), Expect = 0.000e+0
Identity = 570/1098 (51.91%), Postives = 769/1098 (70.04%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQG---LSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFN---EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSY--SSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSVYLNVDFRKDSL 3313
            KC DE K++ FL +S+      +L++  +R+I ++    R       +   D+G   L + D     +  ++V +      ++ KDW+GE+ISGQ++TG+ LV LV +LSIGS+ IY Y+ S  +   E CV W+ S +QQ+DL FNI FL+YFF+RF+A++DK+ F LE+YSF+D +TIPPSFV +Y+ R W+GLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +T +GF+H++E+SG P       +R  + D  YF++VT+STVGYGDI C T  G+L M+FFILGGLA+FA+ IPE+ ++IGSR +Y   ++ +  K+HI++CG+ITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+ G+ M+S DLSR+++  ADACLVLANKYS DPDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDW+RGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   N P+WLN YL GAGMEMY++  S  F G TF EA  + F  L LLL+AIE K    +E +IAINP     I+P  QGFFIAQSADE KRAF++C++CH +      IK+C C     F+    ++ +     +R + + +   D  + V+LRR    R   +K   ++  +   R + F+   EQ   ++D+TGMFHWCP + +E+ +L D  Q  M V + H+VVC+FA+ NS LIGL NFVMPLRASNFHY EL ++V +G++EYLKREWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N  +D  L DKEAIL SLN++AM FD D+     +P  L Q   +VS   S   ++K     K ++ G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP++E +LAEG G++G Y TP+TL NRDRCR++ + +   P   I      G +YG +F  AL++ G LCIGLYRL       +D A +    +S KRYVITNPP  L++  SD VY L+QF   L  + RK+ L
Sbjct:   41 KCLDERKYWCFLLSSIVTFCVSMLLVVIWRIIAHIFCQRREREETDAVFDQDEGKHELLKGDLDGIAIKQEEVQI---GWMTEAKDWAGELISGQSMTGRILVVLVFVLSIGSLIIYFYDASHPNFQVETCVSWSDSPSQQIDLGFNIFFLIYFFIRFIAASDKVWFLLEVYSFIDYFTIPPSFVAIYLERNWLGLRFLRALRLMTVPDILQYLNVLKTSSSIRLTQLLSIFISVCLTGAGFVHVLENSGDPFKNFANTHRITYWDCVYFLLVTMSTVGYGDIYCTTFLGRLFMVFFILGGLAMFASYIPEIADLIGSRQKYGGEYKGEHGKKHIVVCGYITYESVSHFLQDFLHEDREDVDVEVVFLHRVPPDLELEGLFKRHFTKVEFFSGTVMDSIDLSRVKVDEADACLVLANKYSSDPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWRRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSRNTPDWLNLYLCGAGMEMYTDTLSHGFVGMTFPEAADLLFTRLGLLLLAIELKDDEKKECNIAINPAPTTTIQPQTQGFFIAQSADEVKRAFYWCKQCHEDIMDISLIKKCKCRNLALFRKGAKQV-QLSKRIARATPVSNASND--TAVQLRRLDERRSFGQKNSLSLPPEN--RTIDFSKEFEQQDMKYDSTGMFHWCPARTLEECVL-DRHQAAMTVLNGHVVVCLFADRNSPLIGLRNFVMPLRASNFHYHELKHVVIVGDVEYLKREWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIVSARIPNPNEDPTLADKEAILASLNIKAMQFD-DTLGF--YP--LRQTGGTVSPLGSPLSLQK-----KGARFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPEMELILAEGAGLRGGYSTPETLNNRDRCRISQLALQDRPFEGI----TTGSSYGQMFSTALKKHGQLCIGLYRL-------HDQAAV----DSNKRYVITNPPAELRLLLSDYVYVLEQFDPGLEYEPRKNFL 1104          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: M9P2U0 (BK channel family member SLO-1 spliced variant b OS=Dirofilaria immitis OX=6287 PE=2 SV=1)

HSP 1 Score: 1073.54 bits (2775), Expect = 0.000e+0
Identity = 570/1098 (51.91%), Postives = 770/1098 (70.13%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQG---LSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFN---EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSY--SSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSVYLNVDFRKDSL 3313
            KC DE K++ FL +S+      +L++  +R+I ++    R  +    +   D+G   L + +     L  ++V +      ++ KDW+GE+ISGQ++TG+ LV LV +LSIGS+ IY Y+ S  +   E C+ W+ S +QQ+DL FNI FL+YFF+RF+A++DK+ F LE+YSF+D +TIPPSFV +Y+ R W+GLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +T +GF+H++E+SG P       +R  + D  YF++VT+STVGYGDI C T  G+L M+FFILGGLA+FA+ IPE+ ++IGSR +Y   ++ +  K+HI++CG+ITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+ G+ M+S DLSR+++  ADACLVLANKYS DPDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDW+RGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   N P+WLN YL GAGMEMY++  S  F G TF EA  + F  L LLL+AIE K    +E +IAINP   I I+P  QGFFIAQSADE KRAF++C++CH +      IK+C C     F+    ++ +     +R + + +   D  + V+LRR    R   +K   ++  +   R + F+   EQ   ++D+TGMFHWCP + +E+ +L D  Q  M V + H+VVC+FA+ NS LIGL NFVMPLRASNFHY EL ++V +G++EYLKREWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N  +D  L DKEAIL SLN++AM FD D+     +P  L Q   +VS   S   ++K     K ++ G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP++E +LAEG G++G Y TP+TL NRDRCR++ + +   P   I      G +YG +F  AL+R G LCIGLYRL       +D A +    +S KRYVITNPP  L++  SD VY L+ F   L  + RK+ L
Sbjct:   41 KCLDERKYWCFLLSSIVTFCVSMLLVVIWRIIAHIFCQRRERDEMDAVFDQDEGKHELLKGEVDGIALKQEEVQI---GWMTEAKDWAGELISGQSMTGRILVVLVFVLSIGSLIIYFYDASHPNFQVETCISWSDSPSQQIDLGFNIFFLIYFFIRFIAASDKVWFLLEVYSFIDYFTIPPSFVAIYLERNWLGLRFLRALRLMTVPDILQYLNVLKTSSSIRLTQLLSIFISVCLTGAGFVHVLENSGDPFKNFANTHRITYWDCVYFLLVTMSTVGYGDIYCTTFLGRLFMVFFILGGLAMFASYIPEIADLIGSRQKYGGEYKGEHGKKHIVVCGYITYESVSHFLQDFLHEDREDVDVEVVFLHRVPPDLELEGLFKRHFTKVEFFSGTVMDSIDLSRVKVDEADACLVLANKYSSDPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWRRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSRNTPDWLNLYLCGAGMEMYTDTLSHGFVGMTFPEAADLLFTRLGLLLLAIELKDDEKKECNIAINPAPTITIQPQTQGFFIAQSADEVKRAFYWCKQCHEDIMDISLIKKCKCRNLALFRKGAKQV-QLSKRIARATPVSNASND--TAVQLRRLDERRSFGQKNSLSLPPEG--RTIDFSKEFEQQDMKYDSTGMFHWCPARTLEECVL-DRHQAAMTVLNGHVVVCLFADRNSPLIGLRNFVMPLRASNFHYHELKHVVIVGDVEYLKREWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIVSARIPNPNEDPTLADKEAILASLNIKAMQFD-DTLGF--YP--LRQTGGTVSPLGSPLSLQK-----KGARFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPEMELILAEGAGLRGGYSTPETLNNRDRCRISQLALQDRPFEGI----TTGSSYGQMFSTALKRHGQLCIGLYRL-------HDQAAV----DSNKRYVITNPPAELRLLISDYVYVLEPFDPGLEYEARKNFL 1104          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A158N8D0 (Uncharacterized protein OS=Onchocerca volvulus OX=6282 PE=4 SV=1)

HSP 1 Score: 1073.15 bits (2774), Expect = 0.000e+0
Identity = 571/1098 (52.00%), Postives = 772/1098 (70.31%), Query Frame = 2
Query:   53 KCQDE-KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQG---LSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNR-NFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFN---EQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSY--SSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSVYLNVDFRKDSL 3313
            KC DE K++ FL +S+      +L++  +R+I ++    R  +    +   D+G   L + D     +  ++V +      ++ KDW+GE+ISGQ++TG+ LV LV +LSIGS+ IY Y+ S  +   E C+ W+ S +QQ+DL FNI FL+YFF+RF+A++DK+ F LE+YSF+D +TIPPSFV +Y+ R W+GLRF+RA+RLMT+ D+L +LNV+K+SSSIRL  L + F+S+ +T +GF+H++E+SG P       +R  + D  YF++VT+STVGYGDI C T  G+L M+FFILGGLA+FA+ IPE+ ++IGSR +Y   ++ +  K+HI++CG+ITY+SVS+FL DFLH+DREDVDV++V L+  PP+LEL+ + KR+F  VEF+ G+ M+S DLSR+++  ADACLVLANKYS DPDAEDAANIMRVISIKN+   I+VIVQLMQYHNKAYLLNIPSWDW+RGDD +CLAELKLGFIAQSCLAPGFST++ANLF MRSFK   N P+WLN YL GAGMEMY++  S  F G TF EA  + F  L LLL+AIE K    +E +IAINP     I+P  QGFFIAQSADE KRAF++C++CH +      IK+C C     F+  + ++ +     +R + + +   D  + V+LRR  + R   RK   ++  +   R + F    EQ   ++D+TGMFHWCP + +E+ +L D +Q  M V + H+VVC+FA+ NS LIGL NFVMPLRASNFHY EL ++V +G++EYLKREWK+L N P +SIL+GS LSR +LRAVN+N+  MCVI+S++  N  +D  L DKEAIL SLN++AM FD D+     +P  L Q   +VS   S   ++K     K ++ G ++ MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFA+SVLDSLMST YFN++ALTLIRTL+TGGATP++E +LAEG G++G Y TP+TL NRDRCR++ + +   P   I      G +YG +F  AL+R G LCIGLYRL       +D A +    +S KRYVITNPP  L++  SD VY L+QF   L  + RK+ L
Sbjct:   41 KCLDERKYWCFLLSSIVTFCVSMLLVVIWRIIAHVFCQQRERDEIDTVFDQDEGKHELFKGDGDGITIKQEEVQI---GWMTEAKDWAGELISGQSMTGRILVVLVFLLSIGSLIIYFYDASHPNFQVETCIAWSDSPSQQIDLGFNIFFLIYFFIRFIAASDKVWFLLEVYSFIDYFTIPPSFVAIYLERNWLGLRFLRALRLMTVPDILQYLNVLKTSSSIRLTQLLSIFISVCLTGAGFVHVLENSGDPFKNFANTHRITYWDCVYFLLVTMSTVGYGDIYCTTFLGRLFMVFFILGGLAMFASYIPEIADLIGSRQKYGGEYKGEHGKKHIVVCGYITYESVSHFLQDFLHEDREDVDVEVVFLHRVPPDLELEGLFKRHFTKVEFFSGTVMDSIDLSRVKVDEADACLVLANKYSSDPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWRRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSRNTPDWLNLYLCGAGMEMYTDTLSHGFVGMTFPEAADLLFTRLGLLLLAIELKDDEKKECNIAINPAPTTTIQPQTQGFFIAQSADEVKRAFYWCKQCHEDIIDVSLIKKCRCRNLNLFRKGVKQV-QLSKRIARATPVSNASND--TTVQLRRLDDRRSYGRKNSLSLPPEG--RTIDFTKDFEQQDMKYDSTGMFHWCPARTLEECVL-DRNQAAMTVLNGHVVVCLFADRNSPLIGLRNFVMPLRASNFHYHELKHVVIVGDVEYLKREWKTLFNLPKISILNGSPLSRADLRAVNINLCDMCVIVSARIPNPNEDPTLADKEAILASLNIKAMQFD-DTLGF--YP--LRQTGGAVSPLGSPLSLQK-----KGARFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPEMELILAEGAGLRGGYSTPETLNNRDRCRISQLALQDRPFEGI----TTGSSYGQMFSIALKRHGQLCIGLYRL-------HDQAAV----DSNKRYVITNPPAELRLLLSDYVYVLEQFDPGLEYEPRKNFL 1104          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000044980.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000044980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 994.571 bits (2570), Expect = 0.000e+0
Identity = 541/1102 (49.09%), Postives = 725/1102 (65.79%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSK-LNLTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRP-NERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD-----------------IDSFKMENFP--ELLPQISKSVSYSSFGMEKDMTDDKISKS---------GADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + NV  K +      +   D +    D  +    +S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  ++  +T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q  ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+S  INP N +K++ G  GFFIA  A E KRA ++C+ CH +    K IK+C C   K   N   K       +   S L  KK   +    +R + N  P N R  P  I +      +  N    +++D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SA++GL N VMPLRASNFHY EL  IVF+G+LEYLKREW++L NFP +SIL GS LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD                 +D    EN P   L+ Q S +   +   + +    D++  +         G +I MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   36 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---DPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSD-QRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKSNYNGYIK----SIEEVHQSTLSPKKKQRNG--GMRTSPNCSPKNLRHDPLLIPSHDQMETMDVN---VKKYDSTGMFHWCPSKDIEKVILTRSEA-AMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1109          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000050702.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050702.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 540/1102 (49.00%), Postives = 726/1102 (65.88%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSK-LNLTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRP-NERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD-----------------IDSFKMENFP--ELLPQISKSVSYSSFGMEKDMTDDKISKS---------GADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + NV  K +      +   D +    D  +    +S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  ++  +T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q  ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+S  INP N +K++ G  GFFIA  A E KRA ++C+ CH +    K IK+C C             ++FE  +   S L  KK   +    +R + N  P N R  P  I +      +  N    +++D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SA++GL N VMPLRASNFHY EL  IVF+G+LEYLKREW++L NFP +SIL GS LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD                 +D    EN P   L+ Q S +   +   + +    D++  +         G +I MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   36 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---DPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSD-QRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGC-------------KRFE--EVHQSTLSPKKKQRNG--GMRTSPNCSPKNLRHDPLLIPSHDQMETMDVN---VKKYDSTGMFHWCPSKDIEKVILTRSEA-AMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1098          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000050440.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:48528:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 988.023 bits (2553), Expect = 0.000e+0
Identity = 538/1102 (48.82%), Postives = 722/1102 (65.52%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSK-LNLTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRP-NERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD-----------------IDSFKMENFP--ELLPQISKSVSYSSFGMEKDMTDDKISKS---------GADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + NV  K +      +   D +    D  +    +S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  ++  +T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q  ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA  +PE+  +I +R +Y   +   + ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+S  INP N +K++ G  GFFIA  A E KRA ++C+ CH +    K IK+C C   K   N   K       +   S L  KK   +    +R + N  P N R  P  I +      +  N    +++D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SA++GL N VMPLRASNFHY EL  IVF+G+LEYLKREW++L NFP +SIL GS LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD                 +D    EN P   L+ Q S +   +   + +    D++  +         G +I MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   36 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---DPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTYNSTRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSD-QRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKSNYNGYIK----SIEEVHQSTLSPKKKQRNG--GMRTSPNCSPKNLRHDPLLIPSHDQMETMDVN---VKKYDSTGMFHWCPSKDIEKVILTRSEA-AMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1109          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000051878.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000051878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 987.252 bits (2551), Expect = 0.000e+0
Identity = 539/1129 (47.74%), Postives = 729/1129 (64.57%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSK-LNLTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLR------------------------------------KFETTKSRHSN-------LESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQ----KSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + NV  K +      +   D +    D  +    +S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  ++  +T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q  ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+S  INP N +K++ G  GFFIA  A E KRA ++C+ CH +    K IK+C C   K+      +L                                        T +S  SN       +E       S  K +RN  +R +    P N+R+      S   +   +   +++D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SA++GL N VMPLRASNFHY EL  IVF+G+LEYLKREW++L NFP +SIL GS LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD DS  +          + S  ++  GM++   ++             +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   36 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---DPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSD-QRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKKACRRGTRLACCLDCGEADYGCLCMSRSVRSNAETAFPLSPTCLSDNSATLRSSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEA-AMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFD-DSIGLLQ--------ANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1136          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000004500.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000004500.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 982.63 bits (2539), Expect = 0.000e+0
Identity = 542/1148 (47.21%), Postives = 731/1148 (63.68%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSK-LNLTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLR------------------------------------KFETTKSRHSN-------LESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQ----KSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD-----------------IDSFKMENFP--ELLPQISKSVSYSSFGMEKDMTDDKISKS---------GADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + NV  K +      +   D +    D  +    +S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  ++  +T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q  ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+S  INP N +K++ G  GFFIA  A E KRA ++C+ CH +    K IK+C C   K+      +L                                        T +S  SN       +E       S  K +RN  +R +    P N+R+      S   +   +   +++D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SA++GL N VMPLRASNFHY EL  IVF+G+LEYLKREW++L NFP +SIL GS LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD                 +D    EN P   L+ Q S +   +   + +    D++  +         G +I MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  +D+++CL QF
Sbjct:   36 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---DPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSD-QRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKKACRRGTRLACCLDCGEADYGCLCMSRSVRSNAETAFPLSPTCLSDNSATLRSSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEA-AMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQF 1164          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006404.1 (pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 425.631 bits (1093), Expect = 3.148e-139
Identity = 202/377 (53.58%), Postives = 275/377 (72.94%), Query Frame = 2
Query:  776 VESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSC 1900
            VE+SG P     N QN  + +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA  +PE+  +I +R +Y   +   + ++H+++CGHIT +SVSNFL DFLHKDR+DV+V+I+ L++  P LEL+ + +R+F  VEFYQGS +N  DL+R++++ ADAC+++ANKY PDPDAEDA+NIMRVISIKN+ PRI+VI Q++QYHNKA+LLNIPSW W+ GD A+CL+ELKLGFIAQSCLA G ST+LANLF+MRS+        W   YLEG   EMY+EY S AF G +F     + F  L+LLLIAIE +S  +  +SI +NP + ++I+ G   FFIA  + E KRAF++C+ CH +    K IK+CSC
Sbjct:   22 VENSGDPWRDFQNQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKDRDDVNVEILFLHSISPNLELEALFRRHFTQVEFYQGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEE-DTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEHSYGSSILLNPGSHVRIQDGTLAFFIANDSKEVKRAFYYCKACHEDVTDPKKIKKCSC 397          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006399.1 (pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 424.091 bits (1089), Expect = 1.068e-138
Identity = 201/376 (53.46%), Postives = 274/376 (72.87%), Query Frame = 2
Query:  779 ESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSC 1900
            E+SG P     N QN  + +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA  +PE+  +I +R +Y   +   + ++H+++CGHIT +SVSNFL DFLHKDR+DV+V+I+ L++  P LEL+ + +R+F  VEFYQGS +N  DL+R++++ ADAC+++ANKY PDPDAEDA+NIMRVISIKN+ PRI+VI Q++QYHNKA+LLNIPSW W+ GD A+CL+ELKLGFIAQSCLA G ST+LANLF+MRS+        W   YLEG   EMY+EY S AF G +F     + F  L+LLLIAIE +S  +  +SI +NP + ++I+ G   FFIA  + E KRAF++C+ CH +    K IK+CSC
Sbjct:    1 ENSGDPWRDFQNQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKDRDDVNVEILFLHSISPNLELEALFRRHFTQVEFYQGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEE-DTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEHSYGSSILLNPGSHVRIQDGTLAFFIANDSKEVKRAFYYCKACHEDVTDPKKIKKCSC 375          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007042.1 (pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 gene:ENSPMAG00000006371.1 transcript:ENSPMAT00000007042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 304.679 bits (779), Expect = 1.977e-96
Identity = 142/215 (66.05%), Postives = 174/215 (80.93%), Query Frame = 2
Query: 1034 QHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPN------WLNTYLEGAGMEMYSEYFSPAFHGCTF 1660
            +HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R++++ ADACL+LANKY  DPDAEDA+NIMRVISIKN+ PRI+VI Q+ QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLAPG ST+LANLF+MRS+     LP+      W   YLEG   EMY+EY S AF G +F
Sbjct:    1 RHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIEAADACLILANKYCGDPDAEDASNIMRVISIKNYHPRIRVITQMQQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSYIKRVPLPHQIEEDTWQKYYLEGVSNEMYTEYLSNAFTGLSF 215          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: KCNT1 (potassium sodium-activated channel subfamily T member 1 [Source:HGNC Symbol;Acc:HGNC:18865])

HSP 1 Score: 89.3521 bits (220), Expect = 6.816e-19
Identity = 64/239 (26.78%), Postives = 117/239 (48.95%), Query Frame = 2
Query:  707 IRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRY---RNPFRKQKDKQHIILC-GHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLK--RYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNK 1405
            I +C LF    + +    GF HL  ++         +N +     YF IVT STVG+GD++ +    +L+++  I   L +      E++ +   R +     + +R Q +K H++LC   +  D + +FL +F    R   D   VIL     + +++ +L    +   V + QGS +   DL R+++ +A+AC +L ++   D  A D   I+R  ++K+F P   + VQ+++  NK
Sbjct:  196 ILICTLFCLMFTFI---CGFQHLERAA---------ENISLFRSLYFCIVTFSTVGFGDVLPKIWPSQLLVVIMICVALMVLPVQFEELVYLYMERQKSGGNYSRYRAQTEK-HVVLCVSSLKLDLLMDFLNEFYAHPRLQ-DFYTVILCPTDMDSQVRRMLHVPLWAQRVIYLQGSALKDQDLVRVKIDDAEACFILTSRNEVDRTAADHQTILRAWAVKDFAPSCPLYVQILKPENK 420          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008182.1 (pep scaffold:Pmarinus_7.0:GL477494:64178:71076:1 gene:ENSPMAG00000007403.1 transcript:ENSPMAT00000008182.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 4.165e-18
Identity = 43/93 (46.24%), Postives = 60/93 (64.52%), Query Frame = 2
Query:  335 GKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGR 613
            G + V LV +LSIG++ IY  + S      E C  + +  T Q D+  NI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ +
Sbjct:    1 GCSQVVLVFLLSIGALVIYFIDSS---DPIEDCHYFQKDTTLQFDMGLNIFFLLYFGLRFIAANDKLWFWLEVNSIVDFFTVPPVFVSVYLNQ 90          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO28098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F3])

HSP 1 Score: 113.62 bits (283), Expect = 8.549e-29
Identity = 55/116 (47.41%), Postives = 78/116 (67.24%), Query Frame = 2
Query: 2210 VFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQ 2557
            +F++HI+VCVF +    L+GL   VMPLRASN H S+L  IVF+G+ +Y+K EW+ + NF  + IL GS   R +LRAVN N++ M V LS  + +   D  L DK++IL SLN++
Sbjct:   68 IFTHHILVCVFNKKEDPLVGLRKMVMPLRASNLHRSDLKKIVFLGDKDYMKLEWEEICNFHEVYILPGSPFCRADLRAVNANLADMVVFLSGTAVDQAGDPRLADKQSILASLNLK 183          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO32743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU69])

HSP 1 Score: 108.227 bits (269), Expect = 8.709e-24
Identity = 146/634 (23.03%), Postives = 259/634 (40.85%), Query Frame = 2
Query:  692 KSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRK--QKDKQHIILCGH-ITYDSVSNFLADFLHKDR-EDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMY------SEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNR----HYK---YIKQCSCA---------AHKQFQNT-----------LHKLRK--FETTKSRHSNL------ESKKGDESSKVKLRRNRNIRPN--------------ERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGS 2416
            +S+ S ++  L TT V ++ T+   IH +E +            + +   +F+IVT STVGYGD V    T +  +M  I   L L    +  +  ++ SR +    +        +H++LC   +   ++ +FL +F    R  DV V ++  ++    L +   +  +   V + +GS +   DL R + +NA  C +LA++Y+ D +A D   I+R  +I++F P   + VQ+++  NK ++           +  VC  E+K   +A +C+ PG STL+  L      +       W   Y + AG E+Y      S  F P  +  +F  A   + K   + LI ++      +   + +NP     +    + F+IA S++E      +       R    H+K   ++   S A         A  Q +N+             +L++  FE   SR S+       ES    E+ ++++    +  PN                 R H  +  K F  LR NE    R                   ++DS ++        IV    AE+     GL NF++PLRA +     L  I+ +   E  +   +++ +FP L  + G+
Sbjct:  215 QSALSQKVLILITTVVCILFTSVCGIHHLERAS--------LQWSMMKTLWFVIVTFSTVGYGDTVPTHWTTQTFVMIMIGIALVLLPIELERLAFLLFSRQKEGGAYNHLLAGTDRHVVLCATTLRTGTLIDFLNEFYADSRLHDVHVVLLCPSDLDSTLRILLQVPVWAQRVTYLKGSALIDEDLVRAR-RNAAGCFILADRYAADREAADQHTILRTWAIQDFAPATPLFVQILKPENKFHV--------SFAEHVVCEDEIKHALLAVNCVCPGISTLVTLLLHTLHEQYVRGSEKWHEIYGKCAGNEIYDIRLGDSMIFRPYAYK-SFTHAAFHAHKKYGVTLIGVKRH---GKGGRLMLNPGPSHNMAYDDRCFYIAISSEEDTAFKKYEEPKKTKRLSSNHFKKNSFVTASSVALELRGDGSLAGDQSENSPPRPTEGGLDGTARLKEVTFEVGDSRRSSASAFVPDESDMDSETGEMEIENLPSRIPNYIVGVLPVSPYIGRTPMRCHLYQTPKPFCCLRLNEDCEHR------------------EMSDSVRMHRQQHGGIIVSSPVAEA-----GLYNFILPLRAYHRPKITLKPIILLLGEEPNEDFLEAVCHFPMLYYMVGT 804          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: SHAK6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM4])

HSP 1 Score: 53.9138 bits (128), Expect = 2.024e-7
Identity = 54/204 (26.47%), Postives = 86/204 (42.16%), Query Frame = 2
Query:  404 SVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGR--------YWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRN--FLDFTY---FIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMI 976
            SV+  +   C+ W               F + +F+RFL S DK  F + + + +DL  I P F+ L M              +R VR  R+  LS     L ++  +    L  L   F  L +    F      S     A+   NR+  FL   +   + I+T++TVGYGD+  +T  GKL+  F  + G+   A  +P ++
Sbjct:  180 SVFFAIESFCIAW---------------FTLEYFIRFLCSPDKCKFVVSVLNLIDLVAILPFFITLPMTEPTSVSSLAILRCVRLVRVFRIFKLSRYSRGLQILGHTLKASLRELGLLFFFLCVGVILF------SSAVYYAEYNYNRDTEFLSIPHSFWWSIITMTTVGYGDMAPKTLGGKLVGCFCAISGVLAIALPVPVIV 362          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: SHAK3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK45])

HSP 1 Score: 53.9138 bits (128), Expect = 2.120e-7
Identity = 51/186 (27.42%), Postives = 85/186 (45.70%), Query Frame = 2
Query:  470 LAFNIIFLVYFFL----RFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIG-------LRFVRAMRLMTLS------DVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMI 976
            LA  I+ + +F L    R L+S  KL F     + +DL  I P ++ L M    I        +R VR  R+  LS       VLG  + +++SS      +F   +S+V+ +S   +  E           +  +  D  ++ +VT++TVGYGD+   TP GKL+     + G+   A  +P ++
Sbjct:  191 LALEILCIAWFTLEYVVRLLSSPQKLLFVRSFLNVIDLMAILPYYITLPMKDLRITSLAVLRVIRLVRVFRIFKLSRHSRGLQVLG--HTLRASSRELAMLIFFLLISVVLFSSAVYYAEEEEAA------SKFSSIPDAFWWAVVTMTTVGYGDMYPVTPWGKLVGSICAISGVLTIALPVPVIV 368          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: SHAKR8 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIS5])

HSP 1 Score: 52.7582 bits (125), Expect = 4.597e-7
Identity = 52/178 (29.21%), Postives = 88/178 (49.44%), Query Frame = 2
Query:  449 SLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFV---ILYMGRY---WIGLRFVRAMRLMTLSDVLGFLNVIKSS--SSIR--LCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLM-MMFFILGGLAL 949
            +L   L+LA    F +   +R ++  +KL F ++  +++DL  I P FV   I     Y       R +R  R+  L+  +  L ++  +  ++ R  +  LF   +S+V+  SG  +  E    P    +G   +  D  +F+IVT++ VGYGD V  TP GKL+  M  ++G LA+
Sbjct:  182 TLYSCLELACVAWFTMELIMRVISCPNKLKFAMDFSNYIDLAAILPYFVENAIQSAADYVELMNAFRLLRVFRIFKLARHMEELKILGRTIIATWRELMMILFFILISMVMF-SGCTYYAEFDAQP----DGVFSSIPDTAWFVIVTLTNVGYGDAVPVTPIGKLLGTMCALVGVLAI 354          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: ENSORLT00000011055.2 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:101155390])

HSP 1 Score: 1006.9 bits (2602), Expect = 0.000e+0
Identity = 544/1087 (50.05%), Postives = 732/1087 (67.34%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L  W    +  +K     + ++  + I      D    E+    + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  +  + T Q+D+AFNI FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P   +N QN   L +    Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELKLGFIAQSCLA G ST+LANLF+MRSF        W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+S  INP N +K++ G  GFFIA  A E KRA F+C+ CH +    K IK+C C             +KFE  + RHS L  KK         +RN  +R +    P  +R+   F  +  +EQ+       +++D+TGMFHWCP + IE V+L  S+   M V S H+VVC+F +  SALIGL NFVMPLRASNFHY EL +IVF+G+LEYLKREW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN +DDA L DKE IL SLN+++M FD DS ++          + S  ++  GM++   ++             +GA+I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  SD+++CL QF
Sbjct:   39 WWAFLASSMVTFFGGLFIILLWRTLKYL--WTVCCHCKAKKKEVHR-ITTGEHIKRVDKGDSAASEVG-WMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSS---DPIEFCKHFYSNYTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDP--WENFQNSQALSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPVICELCYVKLKLLLIAIEYKSD-QRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALFYCKACHDDISDPKRIKKCGC-------------KKFE--EDRHSALSPKKK--------QRNGGMRNSPNSSPKIMRHDPLF--IPGSEQIESMDENVKKYDSTGMFHWCPSRDIEKVILTRSEA-AMTVLSGHVVVCIFGDVKSALIGLRNFVMPLRASNFHYHELKHIVFVGSLEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFD-DSIRVLQ--------ANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALKGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLNAQSQCTKRYVITNPPYAFELVPSDLIFCLMQF 1066          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 990.719 bits (2560), Expect = 0.000e+0
Identity = 537/1100 (48.82%), Postives = 726/1100 (66.00%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVN----SKLN--LTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS---IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSN----LESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVS------RRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + N+      K+N    +Q   RP     K  D++     S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  +    T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELK GFIAQSCLA G ST+LANLF+MRSF  +     W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS   E  S   I INP N +K++ G  GFFIA  A E KRAF++C+ CH +    K IK+C C    +   T       +    R       +E +     S  K +RN  +R +    P  +        +  NEQ+       +R+D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SAL+GL N VMPLRASNFHY EL  IVF+G+L+YL+REW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN ++DA L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D              +G++I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  SD+++CL QF
Sbjct:   61 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKKKEVQKVNNFANNQAADRP----PKGPDEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSS---DPIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFI-EIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRPAEGATTPGNTGSQKEAGVRFKADCNIVEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLL-IPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEA-SMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IEDASLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLMQF 1128          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 989.564 bits (2557), Expect = 0.000e+0
Identity = 535/1087 (49.22%), Postives = 724/1087 (66.61%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVN----SKLN--LTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + N+      K+N    +Q   RP     K  D++     S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  +    T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELK GFIAQSCLA G ST+LANLF+MRSF  +     W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+SI INP N +K++ G  GFFIA  A E KRAF++C+ CH +    K IK+C C             ++ E      S L  KK   +  ++   N + +   R  P  I   +    +  N    +R+D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SAL+GL N VMPLRASNFHY EL  IVF+G+L+YL+REW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN ++DA L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D              +G++I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  SD+++CL QF
Sbjct:   61 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKKKEVQKVNNFANNQAADRP----PKGPDEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSS---DPIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFI-EIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSE-QRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGC-------------KRLE--DEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMN---IKRYDSTGMFHWCPSKDIEKVILTRSEA-SMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IEDASLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLMQF 1097          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 985.326 bits (2546), Expect = 0.000e+0
Identity = 539/1109 (48.60%), Postives = 725/1109 (65.37%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVN----SKLN--LTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENS---IAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFD--IDSFKMENFPELLPQISKSVSYSS----FGMEKDMT----------------------DDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + N+      K+N    +Q   RP     K  D++     S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  +    T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA+ +PE+IE+IG+R +Y   +     ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMRVISIKN+ P+I++I Q++QYHNKA+LLNIPSW+WK GDDA+CLAELK GFIAQSCLA G ST+LANLF+MRSF  +     W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS   E  S   I INP N +K++ G  GFFIA  A E KRAF++C+ CH +    K IK+C C             ++ E      S L  KK   +  ++   N + +   R  P  I   +    +  N    +R+D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SAL+GL N VMPLRASNFHY EL  IVF+G+L+YL+REW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN ++DA L DKE IL SLN+++M FD  I   +  +     P + +S   SS    F  +  +T                        +  KSG  I+MITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  SD+++CL QF
Sbjct:   61 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKKKEVQKVNNFANNQAADRP----PKGPDEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSS---DPIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFI-EIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGC-------------KRLE--DEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMN---IKRYDSTGMFHWCPSKDIEKVILTRSEA-SMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELAKPGKLMPLVSHSQEKKSGTSIQMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLMQF 1129          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 512/1087 (47.10%), Postives = 694/1087 (63.85%), Query Frame = 2
Query:   71 WYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVN----SKLN--LTDQGLSRPDFIDTKLDDDQVHVEISNC--FSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIA-DNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISK---------SGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQF 3274
            W+ FLA+S+     G+ II  +R ++ L     + N+      K+N    +Q   RP     K  D++     S     + +KDW+G +IS Q LTG+ LV LV  LSIG++ IY  + S      E C  +    T Q+D+AFN+ FL+YF LRF+A+NDKL FWLE+ S VD +T+PP FV +Y+ R W+GLRF+RA+RL+  S++L FLN++K+S+SI+L +L + F+S  +TA+GFIHLVE+SG P     N Q+ ++ +  Y ++VT+STVGYGD+  +T  G+L M+FFILGGLA+FA  +PE+  +I +R +Y   +   + ++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L+N  P LEL+ + KR+F  VEFYQGS +N +DL+R+++++ADACL+LANKY  DPDAEDA+NIMR                   YH          W+WK GDDA+CLAELK GFIAQSCLA G ST+LANLF+MRSF  +     W   YLEG   EMY+EY S AF G +F     + +  LKLLLIAIE KS    E+SI INP N +K++ G  GFFIA  A E KRAF++C+ CH +    K IK+C C             ++ E      S L  KK   +  ++   N + +   R  P  I   +    +  N    +R+D+TGMFHWCP K IE V+L  S+   M V S H+VVC+F +  SAL+GL N VMPLRASNFHY EL  IVF+G+L+YL+REW++L NFP +SIL G+ LSR +LRAVN+N+  MCVILS+  NN ++DA L DKE IL SLN+++M FD DS  +          + S  ++  GM++   D              +G++I +ITEL  DSNVQFLDQDD+D P+TEL++TQPFACG AFAVSVLDSLMS  YFN+N LTLIRTL+TGGATP+LE +LAE   ++G Y TP TL NRDRCRV  + +   P A++    +GGC YG LF +AL+ + +LC G+YRL         +A +   +   KRYVITNPP   ++  SD+++CL QF
Sbjct:   61 WWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKKKEVQKVNNFANNQAADRP----PKGPDEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSS---DPIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGSYNSTRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMR----------------YTLYH---------IWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFI-EIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSE-QRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGC-------------KRLE--DEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMN---IKRYDSTGMFHWCPSKDIEKVILTRSEA-SMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IEDASLQDKECILASLNIKSMQFD-DSIGVLQ--------ANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL---GDGGC-YGDLFCKALKTYNMLCFGIYRL--------RDAHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLMQF 1072          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000050831.1 (SMESG000050831.1)

HSP 1 Score: 2274.2 bits (5892), Expect = 0.000e+0
Identity = 1095/1102 (99.36%), Postives = 1099/1102 (99.73%), Query Frame = 2
Query:   41 GTKFKCQDEKWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSVYLNVDFRKDSLKNVKTEMDHPS 3346
            GTKFKCQDEKWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTD+GLSRPDFIDTK DDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILY+GRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHS LESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQ+SRRFDTTGMFHWCPE+PIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAM FDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSVYLNVDFRKDSLKNVKTEMDHPS
Sbjct:   10 GTKFKCQDEKWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDEGLSRPDFIDTKFDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYLGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSKLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQISRRFDTTGMFHWCPERPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMSFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSVYLNVDFRKDSLKNVKTEMDHPS 1111          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000076792.1 (SMESG000076792.1)

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 576/1139 (50.57%), Postives = 772/1139 (67.78%), Query Frame = 2
Query:   56 CQDEKWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLN--------LT------------DQGLSRPDFIDTKLDD----------DQVHVEISNCFS-------DLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLT-EVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKST--VNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSK----VKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSV--YLNVDFRKDSLKNVKTEM 3334
            C++ +WY FL  S + +  GI  + FYR I    +++R      K N        LT            DQ +  P   + +  D          D V    +   S       + KDW+GEIISGQN TG+ L+S+V  LS+GS+ IY  E+S   G+T E+C+KW+ S TQQ DLAFNI+FL++F LR++A+ DK  FW+E+YS VD+ T+PP+F+   + RYW+GLRF RA+RL++ +DVL FLN++KSSS IRLCHL T F SLV+T++GFIHL+E +G      N QN+ + D+TYF+I T+STVGYGDIVC+T  GKLMM+FFILGGLA+FANSIPE+IEIIG+RNRY   F+K+  KQHIILCGHIT+   +    D  H   E   +   +   F P                            +R+QL+ ADACL+L +KYS DPDAEDAANIMRVISIKN+CP IKVIVQLMQYHNKAYL+NIPSWDW+RGDD VC+AELKLGFIAQSCLAPGFSTLLANLF MRSFK   +LP W+N Y+EGA +EMY+EY SP+FHG TF EAV + F  L LLLIA+E KS    N  +SIAINPK DI IEPG QGFFIA+SAD++KRAF++C  CH++   K +K C+C + + FQ+TL+ +         ++     + +  SK    ++ RR R    + ++R   + +  +   ++FNEQ  RRFD+TGMFHWC  +  E  +L + D L   VFSNHIVVC+FA++NS LIGL +FVMPLR+SN+HY+EL  I+F+G  +YL+REWKSL NFP + +L+GS L+R+ LR +N+N+ +M VILS+  +N + DA+L DKEAILCSLN++AM F  D+ + ++  E+   +S S S+ +                + I MITEL++DS+VQ+LDQDDED+P+TELF+TQPFACGRAFAVSVLDSLMSTAYFNENALTLIRT++TGGAT +LE++L+EG GIQGAYLTP+T+ NRDRCRV  +++  +P +E+F ++     YG LF++  + +GILC GLYRLI +DN+  ++    ++TN K R+V+TNP     +   D V+CL+ F++  Y + + +K  L + K +M
Sbjct:    7 CKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHLVTLFTSLVLTSAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQRTN---CDSGHPSTE-YSIAKCVEKKFKP----------------------------ARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMS--CKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALND--TIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQN----------------SIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVTGGATLELEELLSEGSGIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEK---TYGSLFMKCFKEYGILCFGLYRLI-IDNM--EDCSYSISTN-KNRFVVTNPSPETPLMNQDWVFCLRPFNIDLYKSFNTKKLDLTSTKGKM 1086          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000044594.1 (SMESG000044594.1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 378/1092 (34.62%), Postives = 601/1092 (55.04%), Query Frame = 2
Query:   68 KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSG---GPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLP---NWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWC-PEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSN--NSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGAD------------IKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCN--YGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQ 3271
            KWY F+A        G+L++  +++I N     R   ++   N      S+ + +++ ++D    V         + +  ++IS Q L G+ + S+  + ++ S  +YLYE+       E C      +    DLA N +FL+YF LRF  S +KL FWL  ++ +D +TIP     L + + WIGLRF+R + L+ + +V+   NV+KS +SIR+  L T F S++I  +GF HL+E+SG        +N Q   + D  YFIIVT+STVGYGDI  +T  GK+ ++ FIL  LA FA+ IPE+ E + + ++Y   + K   ++HII+CGHI Y SVS FL DFLH+DR   DV ++ +N   P++E+K++LK YF  V+++QG+ M+  DL R+Q+ NADACL+LA++   DP+ EDA NIMR IS KN+C R  VI+QL+Q+ NK YL NIP+W+ + GD  +C +E++LG +AQSCL PGFSTLL N+F++RS K     P   +WLN Y+ G  ME+YS   S +F+  ++ E V   FK L LLLIAIE K +V+++  + +NP N  +I PG  GFFI  S  ++  A  +C +CH   R    +K C C                          +   GD    V  R    ++  E         +  F+ + F ++    +   G F+ C P+K +++V+   S + ++     HI++C+F+++ ++ IG+ NF+MPLR+     +EL  +V I + +++++EW  +  FP + ++      R     ++++    CVIL++K+N  +  +DA++VDKE I+ +L  QA   +     M+N  ++  +++KS+S  + G E  +     SKS  +            + +I++LAI+SNVQ+LD  +++      ++ +PFA G AF  S+LDSLMSTAY+N+NA+ ++  LI GG+      V           +  +   N+ R  +T       P+++I  + N      Y  +F+E + +   + +GLYR  NL               +  RYVITNPP    I  +DMVYCLQQ
Sbjct:   10 KWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKR-LKISQSTNFETACRSQKN-LESLIEDPSFSVA-------FRPYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLHRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGC--------------------------KGSPGDYELTVISR----LKSEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVI---SSEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQA---ESKRRIMKNNSKI--EMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGS------VDDLDQDDSDTEINLEQRNNQFRINLT-------PVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNL-------LRKETRVETIDRYVITNPPPNFPIEPTDMVYCLQQ 1033          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000014623.1 (SMESG000014623.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 361/1094 (33.00%), Postives = 587/1094 (53.66%), Query Frame = 2
Query:   53 KCQDEKWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTD--QGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVC-VKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDF---TYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRS------FKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLR--FNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILS---SKSNNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSG--ADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFS 3277
            KC ++KWY+FL T+V      I+  G + ++      F    ++ KL+  +  QG  +        +  +++ E  N    ++ W+ + ISGQN TGK +V + C+ +  ++  Y+YE + +    E C + +  +    +DL     F  Y+ +RFLA+ +K+ FW  +YS VDL TIP  FV +Y+   W+GLRF+RA+ LM + D+L +L V+KS++  RL  L T F+ + I  SG  H++E++G   ++    ++NFL F    YF IVT+STVGYGDI   +  GK+ +  FIL   A+FA+ IPE+ EI+ S ++Y   +  +++ +HI++CG+  + S+ +F+ADF ++DR    + +V +N   P+ EL+N+LK  F+  +F +G+ M+  DL R  +  ADAC +LAN    +P  EDAANIMRVIS+KNF   ++V++QL+QY NK+YL NIP+W+  +GD  VC +E++L  +A+SCL PG+ST ++NLF++RS      F+   N  +W+N Y+ G G+E+Y+   S +  G TF + V  S++YL LLLIA+E K  +    ++ INP +         G+FI  S  ES+R   +C  CH                                            +E + +++ + + +  N+    +    Q SFR  R  F   +  + +    F  C  K  ++ L+ +   L+   FSNHI++C+FA+++S  IGL NF++PLR+     ++L  I+   N E+L REW+SLA FP L  +S +++++ +L  + V    +CVI+S   SK N +  D  LVDKE IL +LNV+++                              +K +    I KSG   +  +IT+L +++NVQFLDQ+DED P   +F+++ FACG AF   +LD L+S AYFN +   +I  LI  G     E +  E         + +   N  +C++ I  +  +     F + N  C Y +LF  A + + +L +GLY+++             + ++SKK+ ++TNP     +   D V  LQ  S
Sbjct:    3 KCSEKKWYVFLLTNVI-----IIFSGLFLLLLWKLIKFIYGKISKKLSPINASQGSYKAGEFSGGNNSGRINEENQN-IQIIRVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK--MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCH------------------------------------------GANEGTPLRVDKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAILDKAEKEIDFLKCDYKDFKESLIKNP--LEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKLDTADLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVKSI-----------------------------FKKKLQKKFIGKSGEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEE--------STNMANNNVKCQIRIFNLFDDKFQSCFANTN-RCLYKNLFTYAFKHYHLLLLGLYKVV--------ETTQNILSSSKKKVILTNPDGEFSVSCYDSVLGLQPLS 995          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000078105.1 (SMESG000078105.1)

HSP 1 Score: 469.159 bits (1206), Expect = 8.373e-148
Identity = 326/1087 (29.99%), Postives = 552/1087 (50.78%), Query Frame = 2
Query:   53 KCQDEKWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEII-------SGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFT---YFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKN---DANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYK-YIKQCSCAAHKQFQNTLHKLRKFETTKSRHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQVSRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKS--NNSMDDAFLVDKEAILCSLNVQAMCFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCL 3265
            +C D KW IFL       + G+LI+     +  L        V+SK+ +  +               QV++   N  +D      E +        GQ     T+  L  +L++ S  IY++  + Y  + E C  WN +L + + L  +I FL+ F + F    D L FW +LY+ ++++T+P +F+ +Y+ R ++G  F+R + +  + DV+  L++++  S IRL HL + F+ + +  +G  +L E++G   I  N +N   + +    YFI+VT+STVGYGDI  +T +G++ +  F+L  LA+FA+ IPEM +I+ SR+ Y   FR   +K+H I+CG +    + +FL+ F H++R   +++I+ ++   P+L LK ++KRY   VE+ +G+ M S DL RI+++ AD CLV+  +   + DAED ANIMRVISIK  CP  +VI+QL Q+ NK +LLNIP+W    GD+ +C  E+KLG +A+SCL  GFST + + FT+ S K+   + N P W+  Y  G    +Y E FS  F+G TF E V + +   K+++I +E   +   E++I + P     I      + I+++         +C++CH +++   Y+K+C C                         + +   + S K+ L+++           HN   +K       N+ +  +F+ T    +       D  L D           HIV+ VF+  NS   GL NFV PLR     Y ++  I+ +GN  YL++EWK+++ FP + ++ GS      L    VN ++ CV++++    N+ ++D +LVDKE IL +LN+                         ++Y  +  +  +++   S S  + K+IT+++ID+N+ FL  +  DS +   + T+ FA G A+  S+L+SL+S+ Y++ N + L+R  I G      E+V        G Y            ++ +I  +    +E F++      +  +F  AL +  IL IG+YRL NL N+      ++      KR V+  P   L++H+SD+ Y L
Sbjct:    8 ECNDNKWPIFLGFDCLIYIGGLLILFLKSKLSKL--------VHSKVEMAKEF--------------QVYLGTEN--NDYHMQPNETVLTRPVRYIGQGTFYGTITLLNVVLNLFSFFIYVFNTNEY-YILENCCPWNENLLEIIQLVLSIFFLISFLIDFSMQKDHLEFWKDLYAIINIFTVPNTFIGIYLQRNYVGTFFLRFIWVYKIPDVIQQLDLLEVKSVIRLWHLGSIFMCIWVCGAGLFYLFENTGD--IWHNYKNSQKISYGACFYFILVTMSTVGYGDIYPKTDSGRIFLCLFLLIALAIFASYIPEMWDILKSRSIYDKTFRPVYNKKHNIVCGSLEDQEIESFLSTFYHENRNSKNIRIIFISLNRPKLYLKGLMKRY-PQVEYVEGTEMKSEDLKRIRVEIADCCLVITKRNCENEDAEDKANIMRVISIKECCPNQRVIIQLHQFQNKIHLLNIPNWCPLIGDEVICFNEIKLGILARSCLCAGFSTAICHAFTILSPKHIIKNENNP-WIEQYKRGFSASIYRERFSQFFYGRTFLETVHICYDRFKIIVIGLEVIDSYG-ESTIKLYPNPKHVITKQCWAYCISENQILPYNMSIYCKRCHSDKNSNLYLKKCYCE------------------------IITINSNMSVKIPLKQSL--------LAHNKEMEKI-----LNKNLDNKFEITSRRSFYHSFVKYDKTLFD-----------HIVLLVFSHENSKSAGLINFVKPLRIKKDDYVKIKPIILVGNGVYLEKEWKTISIFPEIYVVVGSCFDLEVLDLAQVNRARTCVLINAPKPFNHKVEDPYLVDKEVILGTLNL-------------------------LNYLKYN-KVSLSESDFSSSSVNTKIITDVSIDTNMHFLYPNSLDSSQNGAYFTKVFASGHAYCNSILNSLLSSTYYDWNTINLLRLFIEGSYDDSFEKV-------PGKYW---------HTQLKLISFS----SERFLNLRNCKTFDEVFQTALNQNNILIIGIYRLFNLKNITEFKNDIV------KRIVLMIPHPDLELHFSDLFYAL 964          
The following BLAST results are available for this feature:
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA10.000e+049.36potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+049.36potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+049.36potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+049.23potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+049.23potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo-10.000e+051.37Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+051.46Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+050.86Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+050.63Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+050.76Calcium-activated potassium channel slo-1 [Source... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo0.000e+049.60gene:FBgn0003429 transcript:FBtr0100631[more]
slo0.000e+049.73gene:FBgn0003429 transcript:FBtr0084684[more]
slo0.000e+050.22gene:FBgn0003429 transcript:FBtr0100632[more]
slo0.000e+049.73gene:FBgn0003429 transcript:FBtr0330287[more]
slo0.000e+050.50gene:FBgn0003429 transcript:FBtr0334294[more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a0.000e+049.22potassium large conductance calcium-activated chan... [more]
kcnma1a0.000e+049.09potassium large conductance calcium-activated chan... [more]
kcnma1a0.000e+048.48potassium large conductance calcium-activated chan... [more]
CABZ01092907.10.000e+056.71potassium large conductance calcium-activated chan... [more]
kcnt21.061e-2923.37potassium channel, subfamily T, member 2 [Source:Z... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA10.000e+049.04potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+048.86potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+048.68potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+048.05potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+047.85potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnma10.000e+049.45potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+049.45potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+049.32potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+049.18potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+049.18potassium large conductance calcium-activated chan... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95V25|SLO1_CAEEL0.000e+050.63Calcium-activated potassium channel slo-1 OS=Caeno... [more]
sp|Q8AYS8|KCMA1_CHICK0.000e+049.32Calcium-activated potassium channel subunit alpha-... [more]
sp|Q90ZC7|KCMA1_XENLA0.000e+048.86Calcium-activated potassium channel subunit alpha-... [more]
sp|O18866|KCMA1_PIG0.000e+049.18Calcium-activated potassium channel subunit alpha-... [more]
sp|Q9BG98|KCMA1_RABIT0.000e+049.13Calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GH630.000e+052.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4E9EW230.000e+051.91Calcium-activated potassium channel slo-1, putativ... [more]
A0A0J9Y9H30.000e+051.91BMA-SLO-1, isoform a; BMA-SLO-1, isoform d OS=Brug... [more]
M9P2U00.000e+051.91BK channel family member SLO-1 spliced variant b O... [more]
A0A158N8D00.000e+052.00Uncharacterized protein OS=Onchocerca volvulus OX=... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044980.10.000e+049.09pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050702.10.000e+049.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050440.10.000e+048.82pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051878.10.000e+047.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000004500.20.000e+047.21pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006404.13.148e-13953.58pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1... [more]
ENSPMAT00000006399.11.068e-13853.46pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1... [more]
ENSPMAT00000007042.11.977e-9666.05pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 g... [more]
KCNT16.816e-1926.78potassium sodium-activated channel subfamily T mem... [more]
ENSPMAT00000008182.14.165e-1846.24pep scaffold:Pmarinus_7.0:GL477494:64178:71076:1 g... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO280988.549e-2947.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327438.709e-2423.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK62.024e-726.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK32.120e-727.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR84.597e-729.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000011055.20.000e+050.05potassium calcium-activated channel subfamily M al... [more]
kcnma1a0.000e+048.82calcium-activated potassium channel subunit alpha-... [more]
kcnma1a0.000e+049.22calcium-activated potassium channel subunit alpha-... [more]
kcnma1a0.000e+048.60calcium-activated potassium channel subunit alpha-... [more]
kcnma1a0.000e+047.10calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050831.10.000e+099.36SMESG000050831.1[more]
SMESG000076792.10.000e+050.57SMESG000076792.1[more]
SMESG000044594.10.000e+034.62SMESG000044594.1[more]
SMESG000014623.10.000e+033.00SMESG000014623.1[more]
SMESG000078105.18.373e-14829.99SMESG000078105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013222 ID=SMED30013222|Name=Calcium-activated potassium channel slo-1, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=3455bp
CAAATTATTATAAATGTCAAACTTATCAATTTCTTCATTAGGAACGAAAT
TCAAATGCCAAGACGAGAAATGGTATATATTTTTAGCCACAAGTGTGGCC
TGCCAGTTGTGCGGAATTTTGATTATTGGATTTTACCGGGTCATTCAAAA
TCTATCAAGATGGTTCCGCAATCCGAATGTCAACTCCAAACTAAACCTGA
CTGATCAGGGGCTGAGCCGGCCGGATTTTATCGACACGAAATTAGACGAC
GACCAAGTTCATGTGGAAATATCCAACTGCTTCTCAGATCTGAAGGACTG
GTCTGGGGAAATTATTTCCGGTCAGAATCTTACGGGTAAAACCTTAGTCA
GTCTTGTATGCATTCTGAGCATCGGGTCCATAGCGATCTATTTGTACGAA
TTATCGGTCTATGACGGCCTAACAGAAGTTTGCGTCAAATGGAATAGGTC
TTTGACTCAACAATTGGATTTGGCGTTTAACATAATATTTTTAGTTTACT
TTTTTCTCAGATTTCTCGCTTCCAATGATAAATTGTGCTTTTGGTTGGAA
CTTTATTCTTTCGTAGACTTATATACAATACCACCATCCTTTGTCATCCT
ATACATGGGACGTTATTGGATCGGTTTGCGTTTCGTTCGCGCAATGAGAC
TAATGACGTTAAGCGATGTTTTGGGGTTTCTGAATGTCATTAAAAGTAGC
AGTTCAATTAGACTTTGCCATTTATTTACAACATTTGTCAGTTTGGTTAT
AACTGCGTCAGGATTTATACACCTTGTTGAAAGTTCCGGTGGTCCAGTGA
TTGCCGATAACGGCCAGAACAGAAATTTCCTGGATTTTACTTATTTCATT
ATTGTAACGATATCGACAGTCGGATATGGAGACATCGTATGTAGAACACC
AACCGGTAAACTGATGATGATGTTTTTTATTTTAGGGGGGTTGGCCTTGT
TTGCCAATTCGATTCCGGAAATGATTGAAATTATAGGCAGTAGAAATCGC
TATCGAAATCCCTTTCGAAAACAAAAAGATAAACAACACATCATCCTATG
TGGACACATTACTTACGATTCAGTTTCGAATTTCCTGGCGGACTTCCTCC
ACAAAGATAGAGAAGATGTCGACGTCAAAATCGTTATTCTGAATAATTTC
CCCCCGGAGTTGGAATTGAAAAATGTTTTGAAAAGATATTTTATTCACGT
TGAGTTTTATCAAGGAAGTGGAATGAATTCCAATGATTTATCAAGAATAC
AACTTCAAAATGCCGACGCGTGTTTGGTATTGGCGAATAAATATTCTCCG
GATCCTGACGCAGAAGACGCAGCGAATATCATGAGGGTCATATCAATAAA
GAACTTCTGTCCAAGAATCAAAGTAATCGTACAACTAATGCAATATCATA
ATAAGGCCTATTTGTTAAATATACCCAGCTGGGATTGGAAAAGAGGCGAC
GATGCTGTTTGTTTGGCTGAATTGAAATTAGGATTTATTGCTCAGAGCTG
CCTAGCGCCGGGATTTTCTACACTATTAGCTAATCTTTTTACCATGAGAT
CTTTTAAAAATGACGCAAATCTCCCAAATTGGTTAAATACATACCTAGAG
GGTGCTGGAATGGAAATGTACTCAGAATACTTTTCTCCGGCGTTTCATGG
ATGTACCTTTGCTGAAGCAGTGGCTATGTCGTTTAAATACCTCAAGTTGC
TACTCATTGCTATCGAAACTAAATCAACTGTAAATGAAGAAAACAGCATA
GCAATAAATCCGAAAAATGACATCAAAATTGAACCGGGAATGCAAGGATT
CTTTATTGCCCAATCGGCTGATGAATCGAAAAGAGCATTCTTCTTTTGTA
GAAAGTGTCATCTTAATCGTCATTATAAATATATCAAACAGTGCTCATGT
GCTGCCCATAAACAATTTCAAAATACTCTCCACAAGCTAAGGAAATTTGA
GACTACAAAATCTCGCCATTCAAATTTGGAATCAAAAAAAGGCGACGAAT
CGTCGAAAGTAAAATTGAGAAGAAACAGAAACATTCGTCCAAATGAGAGA
AAAAGGCCGCATAATATTAGGAATCAAAAATCGTTCCGCGGTTTAAGATT
CAACGAGCAAGTTAGTAGAAGATTCGACACAACAGGAATGTTTCACTGGT
GTCCCGAAAAACCTATTGAAGATGTACTTTTAAACGATTCAGATCAACTA
AAAATGTGTGTCTTCTCCAATCATATCGTTGTTTGCGTTTTTGCCGAATC
AAATAGTGCTTTGATTGGTCTATGTAATTTTGTAATGCCGCTGCGAGCAA
GCAATTTCCATTACAGTGAGCTGAGTTATATCGTATTTATAGGAAATCTA
GAGTACTTGAAACGAGAATGGAAAAGTCTGGCAAACTTTCCTTGTTTATC
AATTTTAAGCGGCTCATCCTTAAGTCGAACCAACCTAAGAGCCGTCAATG
TCAATATGTCAAAAATGTGTGTAATACTCTCATCAAAATCCAACAATTCT
ATGGATGATGCATTTCTTGTCGACAAAGAAGCCATTCTATGTTCTTTGAA
TGTTCAAGCAATGTGTTTTGATATTGATAGCTTTAAAATGGAAAACTTTC
CCGAACTTTTGCCGCAAATCTCAAAATCTGTATCTTATTCTTCATTCGGA
ATGGAGAAAGATATGACAGATGACAAAATATCGAAAAGTGGAGCTGATAT
TAAAATGATAACGGAATTGGCCATAGACAGCAATGTTCAGTTTTTAGATC
AAGATGATGAAGACAGTCCGGAAACGGAATTGTTTATGACACAGCCATTT
GCATGTGGACGTGCGTTTGCTGTTAGTGTTCTTGATTCTTTGATGAGCAC
AGCATATTTCAATGAAAACGCTTTAACATTAATAAGAACTTTAATAACTG
GCGGAGCCACTCCAGATTTGGAGCAAGTTTTAGCGGAAGGATGTGGTATT
CAAGGAGCTTATTTAACACCAGATACTTTAGGAAATCGAGATAGATGCCG
AGTGACAATTATTCAAGTCACTCAGAATCCTCTGGCGGAAATATTTATAT
CGAAGAATGGCGGTTGTAATTATGGTCATTTATTTTTGGAAGCACTGGAA
AGATTTGGTATTTTATGCATCGGTTTGTATAGGCTGATCAATCTTGACAA
TCTCGTCAATGACAATGCTGGTATGATGCTAAATACCAATAGTAAAAAAC
GTTACGTCATCACAAATCCTCCAGATTTTCTACAGATTCACTACTCAGAC
ATGGTTTATTGCTTACAACAGTTCAGCGTTTATTTGAACGTCGACTTTCG
AAAAGATTCACTGAAAAATGTTAAAACCGAGATGGATCATCCAAGTTGAA
TTATAATCTAAAACTGCATGTAGTAGATATTATTTTGATTATAATTTTAA
TAATGATGATTATAATAATTATTATTATTTTGATTAATATTATTATTATT
ATTGT
back to top

protein sequence of SMED30013222-orf-1

>SMED30013222-orf-1 ID=SMED30013222-orf-1|Name=SMED30013222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1112bp
MSNLSISSLGTKFKCQDEKWYIFLATSVACQLCGILIIGFYRVIQNLSRW
FRNPNVNSKLNLTDQGLSRPDFIDTKLDDDQVHVEISNCFSDLKDWSGEI
ISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQ
LDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYMGR
YWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASG
FIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKL
MMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHIT
YDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQ
GSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCP
RIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPG
FSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFA
EAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQ
SADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKS
RHSNLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQV
SRRFDTTGMFHWCPEKPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSAL
IGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSG
SSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAM
CFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMIT
ELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFN
ENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTII
QVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVND
NAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQFSVYLNVDFRKDSL
KNVKTEMDHPS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0006813potassium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0034765regulation of ion transmembrane transport
GO:0040011locomotion
GO:0042493response to drug
GO:0043050pharyngeal pumping
GO:0045214sarcomere organization
GO:0046928regulation of neurotransmitter secretion
GO:0048149behavioral response to ethanol
GO:0050804modulation of synaptic transmission
GO:0055085transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027359Volt_channel_dom_sf
IPR024939Ca-act_K_channel_Slo-1
IPR036291NAD(P)-bd_dom_sf
IPR003929K_chnl_BK_asu
IPR028325VG_K_chnl
IPR016040NAD(P)-bd_dom
IPR013099K_chnl_dom
Vocabulary: molecular function
TermDefinition
GO:0015269calcium-activated potassium channel activity
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
GO:0005515protein binding
GO:0060072large conductance calcium-activated potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0008076voltage-gated potassium channel complex
GO:0016021integral component of membrane
GO:0031430M band
GO:0045202synapse
GO:0055120striated muscle dense body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 150..173
score: 25.26
coord: 176..196
score: 27.49
coord: 269..291
score: 35.68
coord: 298..324
score: 21.27
NoneNo IPR availablePRINTSPR01449BKCHANNELAcoord: 372..392
score: 47.62
coord: 415..435
score: 76.19
coord: 544..561
score: 33.33
coord: 448..461
score: 42.86
coord: 910..925
score: 68.75
coord: 675..689
score: 26.67
coord: 494..509
score: 83.07
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 338..471
e-value: 5.4E-17
score: 63.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 235..337
e-value: 1.9E-17
score: 64.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 647..671
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 647..681
NoneNo IPR availablePANTHERPTHR10027CALCIUM-ACTIVATED POTASSIUM CHANNEL ALPHA CHAINcoord: 84..1088
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 112..324
NoneNo IPR availableTMHMMTMhelixcoord: 153..170
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 275..292
NoneNo IPR availableTMHMMTMhelixcoord: 233..255
NoneNo IPR availableTMHMMTMhelixcoord: 304..326
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 244..317
e-value: 4.5E-15
score: 55.4
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 106..234
e-value: 1.2E-8
score: 36.7
IPR003929Calcium-activated potassium channel BK, alpha subunitPFAMPF03493BK_channel_acoord: 471..567
e-value: 7.8E-34
score: 115.8
IPR024939Calcium-activated potassium channel Slo-1PANTHERPTHR10027:SF28CALCIUM-ACTIVATED POTASSIUM CHANNEL SUBUNIT ALPHA-1coord: 84..1088
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 340..503