Eukaryotic translation initiation factor 3 subunit D

Overview
NameEukaryotic translation initiation factor 3 subunit D
Smed IDSMED30013220
Length (bp)1793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 3 subunit D (SMED30013220) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 3 subunit D (SMED30013220) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 3 subunit D (SMED30013220) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 3 subunit D (SMED30013220) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013220

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013220h1SMcG0015153 SmedASXL_008682SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013220h1SMcG0015153 SmedASXL_008682SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30013220h1SMcG0015153 dd_Smed_v4_2254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013220h1SMcG0015153 dd_Smed_v4_2254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013220h1SMcG0015153 dd_Smed_v4_2254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Human
Match: EIF3D (eukaryotic translation initiation factor 3 subunit D [Source:HGNC Symbol;Acc:HGNC:3278])

HSP 1 Score: 493.041 bits (1268), Expect = 6.191e-169
Identity = 281/540 (52.04%), Postives = 376/540 (69.63%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEK-IYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DES+F +V+T + QK+ Y R R RFA    RRDK  +   Q   Q     L K  K   RER +  ++  KQ+G      W+    ++++  R++SV+V+  W+V EE++F +  K+         D+  CG L YYDK FDR++TR+ + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LM C+RSV SWDI+ QRVG  LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L   K  Y+FPNPNPF+++D D++ + SV YRYRR+ LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H+ILGTQQFKP EFA+QINL +ENAWG+LR +ID+CMKL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQI----LPKSAKQKERERIRLQKKFQKQFGVRQK--WD----QKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLP 523          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Human
Match: EIF3D (eukaryotic translation initiation factor 3 subunit D [Source:HGNC Symbol;Acc:HGNC:3278])

HSP 1 Score: 493.041 bits (1268), Expect = 6.191e-169
Identity = 281/540 (52.04%), Postives = 376/540 (69.63%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEK-IYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DES+F +V+T + QK+ Y R R RFA    RRDK  +   Q   Q     L K  K   RER +  ++  KQ+G      W+    ++++  R++SV+V+  W+V EE++F +  K+         D+  CG L YYDK FDR++TR+ + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LM C+RSV SWDI+ QRVG  LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L   K  Y+FPNPNPF+++D D++ + SV YRYRR+ LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H+ILGTQQFKP EFA+QINL +ENAWG+LR +ID+CMKL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQI----LPKSAKQKERERIRLQKKFQKQFGVRQK--WD----QKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLP 523          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Human
Match: EIF3D (eukaryotic translation initiation factor 3 subunit D [Source:HGNC Symbol;Acc:HGNC:3278])

HSP 1 Score: 213.001 bits (541), Expect = 4.083e-64
Identity = 124/280 (44.29%), Postives = 175/280 (62.50%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIA 875
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DES+F +V+T + QK+ Y R R RFA    RRDK  +   Q   Q     L K  K   RER +  ++  KQ+G      W+     +++  R++SV+V+  W+V EE++F +  K+         D+  CG L YYDK FDR++TR+ + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LM C+RSV SWDI+ 
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQI----LPKSAKQKERERIRLQKKFQKQFGVRQK--WDQ----KSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMSCTRSVYSWDIVV 269          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Human
Match: EIF3D (eukaryotic translation initiation factor 3 subunit D [Source:HGNC Symbol;Acc:HGNC:3278])

HSP 1 Score: 117.472 bits (293), Expect = 5.074e-30
Identity = 79/183 (43.17%), Postives = 111/183 (60.66%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEE 584
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DES+F +V+T + QK+ Y R R RFA    RRDK  +   Q   Q     L K  K   RER +  ++  KQ+G      W+     +++  R++SV+V+  W+V EE
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQI----LPKSAKQKERERIRLQKKFQKQFG--VRQKWDQ----KSQKPRDSSVEVRSDWEVKEE 173          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Human
Match: EIF3D (eukaryotic translation initiation factor 3 subunit D [Source:HGNC Symbol;Acc:HGNC:3278])

HSP 1 Score: 111.309 bits (277), Expect = 1.954e-28
Identity = 50/93 (53.76%), Postives = 68/93 (73.12%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNY 314
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DES+F +V+T + QK+ Y
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAY 93          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Celegans
Match: eif-3.D (Eukaryotic translation initiation factor 3 subunit D [Source:UniProtKB/Swiss-Prot;Acc:P30642])

HSP 1 Score: 338.576 bits (867), Expect = 6.982e-109
Identity = 214/559 (38.28%), Postives = 308/559 (55.10%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGP-STVPEKFSDLPYQPFNKDIKLGKIADWTSTYNPESRKNK------FNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHRE--ASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDL--FTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXT---FINHNFVQQVLNP-EKIYSFPNPN-PFLDEDDDRSNLGSVGYRYRRFDLGNDI-----KLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            L KF L  + DN  GWGP ++       +P+Q FNK  ++G++ADW        R N+      + +    G+Q+ Y H  DE  F +V+T K    N    +  F   +    K++QK+ ++ E   +    + ++ I +E+Q+  +   ++ G           R      +E   SVQV+  W V+EE+  S FSKL+LP    G D+     G L YYDK  DRVS +N+  L+    + +NV T +DP+I++LA   AGNVF TD +++ LM   RSV SWDI+A RVGD LF D R      + V     +         + N  +N    AT   +IN NF +QV+   +  ++F N   PF DE+   S      Y+YR+++LGN +     +LVCR E D V+      G  +    +TI+A NEWDS  SGG+DWR KLD+Q+GAV+  EIKNN+ K+AKWT+ A+LAGSD +KLGYV+R   + +  H IL TQ  KP EFA+ I L M+N WG+LR +ID CMK  PG YL+MKDP   ++R+Y +P
Sbjct:    3 LPKFELLSLADNTVGWGPLASSSSADEPVPFQQFNKADRIGRVADWIGVDRFYRRGNERYNERVYGSAANAGSQFDYIHGMDEHNFQLVDTSKPMARN---PQRNFRVRQMHLRKMMQKENEKREMVNQSTNLRMKRSIAKEQQRAFKMWQRRGGNARQGQRGQGGRFGGDRPKERLPSVQVRPEWVVLEEMNLSAFSKLALPNIPGGDDIGDHQYGSLQYYDKTIDRVSVKNSIPLQRCAGVFYNVTTTEDPVIQELAQGGAGNVFGTDIILATLMTAPRSVYSWDIVAYRVGDKLFFDKRNTRDILNPVETLTVSETSAEPPSFDGNGINNAKDLATEAFYINQNFRRQVVKRNDAGFTFKNARAPFEDEETGES---GTAYKYRKWNLGNGVDGKPVELVCRTELDGVIH-----GLGNETQTLTIKAFNEWDSTQSGGVDWRTKLDVQKGAVMATEIKNNSAKVAKWTLQALLAGSDTMKLGYVSRNNARSTQNHSILLTQYVKPTEFASNIALNMDNCWGILRCVIDSCMKQKPGKYLLMKDPQSPVIRLYSLP 550          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Fly
Match: eIF3d1 (gene:FBgn0040227 transcript:FBtr0089622)

HSP 1 Score: 474.552 bits (1220), Expect = 7.898e-162
Identity = 270/550 (49.09%), Postives = 374/550 (68.00%), Query Frame = 3
Query:   42 AKFSLFD---IDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWTSTYNPESR-KNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGL------TKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVL---NPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            A+F  F+   +  N  GWGP  +P+ F D+PYQPF+K+ +LGKI DWT+T N + + +NK+ +    G QY+Y+HE+DE+TFH+V+T + QK  + R R           + ++  +    +  R GL      T   K +     +  R + K++G          +R      RE+SV V+  W  +EE++F R  KLSLP  + GVD+ TCG L YYDK +DR++ +N + L+ ++R++H V T DDP+IR+L+ +  GNVFATD +++ +MC +RS  SWDI+ ++VGD +F+D R  +T FD +TVNE++VEPP ++ ++ NSP NL++EATFINHNF QQVL   + E  Y F   NPF+ ED+D   + SVGYRY++++LG+DI LV RCEHD V++  T  GE   P F+TI+ALNEWDS+++ G++WR KLD QRGAVL  E++NNA KLAKWTV A+LAGSDQLKLGYV+R  P+  S H+ILGTQQFKP EFATQINL M+NAWG+LR IIDL MK   G YLIMKDPNK I+R+YD+P
Sbjct:    9 AQFPSFEKPTVQFNEKGWGPCELPDTFKDVPYQPFSKNDRLGKICDWTNTSNNDKKYQNKYASSFGTGIQYSYYHEEDETTFHLVDTARVQKPPHQRGRF----------RNMRNSRSGRGRNARGGLNTHGMTTLSGKNVKARDPRHGRGMGKKFG----------HRGPPPKMRESSVAVRADWASIEEMDFPRLIKLSLPNIKEGVDIVTCGTLEYYDKTYDRINVKNEKPLQKIDRIVHTVTTTDDPVIRRLS-KTVGNVFATDAILATIMCSTRSNYSWDIVIEKVGDKVFMDKR-DHTEFDLLTVNESSVEPPTDDDSSCNSPRNLAIEATFINHNFSQQVLKTGDQEPKYKFEESNPFISEDED-IQVASVGYRYKKWELGSDIVLVARCEHDGVLQ--TPSGE---PQFMTIKALNEWDSKLANGVEWRQKLDTQRGAVLANELRNNACKLAKWTVQAVLAGSDQLKLGYVSRINPRDHSRHVILGTQQFKPHEFATQINLSMDNAWGILRCIIDLVMKQKDGKYLIMKDPNKPIIRLYDIP 530          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Fly
Match: eIF3d2 (gene:FBgn0037994 transcript:FBtr0082546)

HSP 1 Score: 442.195 bits (1136), Expect = 3.376e-149
Identity = 252/539 (46.75%), Postives = 349/539 (64.75%), Query Frame = 3
Query:   63 IDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWTSTYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKE------QKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVL---NPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            ++ N  GWGP  VPE   D+PYQPF K  +LGKI DWT+    +   +K+ +     +QYAYF+EDD+STFH+V+T         Q+  Y         +R R  +                     KY      ++ + + +++GR              RI RE+SV V+  W  +EEI+F R  KL+LP  + G D+ TCG L +YDK +DRV+ RN + L+ M+R++H V T DDP+IR+L+ +  GNVFATD ++S +MCC+RS  SWD++ +++G  +FLD R  N  FD +TVNET+VEPP++E  ++NS  +L++EAT INHNF QQVL   + E  + F  PNPF +   D   L S+GYRYR++DLGND+ L+ RC+H+ V++    D +     F++I+ALNEWDS+++  ++WR KLD QRGAVL +E++NNA KLA+WTV A+LAGSDQLKLGYV+R  P+    H+ILGTQQFKP EFATQINL M+NAWGVLR +IDL M+   G YLIMKDPNK ++R+YDVP
Sbjct:   12 VEYNEHGWGPCEVPEL--DVPYQPFCKSDRLGKICDWTAMVPEKKFPSKYASTFGNNSQYAYFYEDDDSTFHLVDTTGSKATKPYQRGRYRPNMRNNVRSRGRTGRGTPNIASLGGSTAGGATASTTKYGKGRNTRNTQNMGRRFGR----------NAPTRI-RESSVMVQSDWVSIEEIDFPRLLKLALPNIKDGKDIATCGWLEFYDKLYDRVNLRNEKPLQKMDRVVHTVTTTDDPVIRRLS-RTMGNVFATDEILSTIMCCTRSNYSWDVVVEKLGTKVFLDKR-YNDQFDLLTVNETSVEPPMDEEGSINSAHSLAMEATLINHNFSQQVLRIGDQEPRFMFEEPNPFEEPGVD---LASIGYRYRQWDLGNDVVLIARCKHNGVIQGPNGDVQ-----FLSIKALNEWDSKVTNSVEWRQKLDTQRGAVLASELRNNACKLARWTVEAVLAGSDQLKLGYVSRMNPRDHLRHVILGTQQFKPQEFATQINLNMDNAWGVLRCLIDLVMRQPDGKYLIMKDPNKPMIRLYDVP 527          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Zebrafish
Match: eif3d (eukaryotic translation initiation factor 3, subunit D [Source:NCBI gene;Acc:336498])

HSP 1 Score: 505.753 bits (1301), Expect = 5.774e-174
Identity = 285/540 (52.78%), Postives = 377/540 (69.81%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLN-PEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPEKF D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   + Q +  R++SV+V+  W+V EE++F R  K+        +D+  CG L +YDK FDR++TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E ++LNSP NL++EAT+INHNF QQ L    + Y FPNPNPF++ED ++S + SV YRYRR+ LG DI L+ RCEHD V+    A+GE     F+ ++ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H++LGTQQFKP EFA+QINL MENAWG+LR +ID+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFHAPVIQDNPSGWGPCAVPEKFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDEASFQLVDTAKTQKTAYQRNRMRFAQRNLRRDK--DRRTLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WDQKSQAQLK-PRDSSVEVRSDWEVKEEMDFPRLMKMRYMDVADPLDIECCGALEHYDKAFDRITTRNEKPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGSSLNSPRNLAMEATYINHNFSQQCLRMGGERYKFPNPNPFVEEDTEKSEVASVAYRYRRWKLGEDIDLIVRCEHDGVMTG--ANGEVS---FINVKTLNEWDSRYCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAILAGSEYLKLGYVSRYHVKDSSRHVVLGTQQFKPNEFASQINLSMENAWGILRCVIDICRKLEEGKYLILKDPNKQVIRVYSLP 526          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Zebrafish
Match: eif3d (eukaryotic translation initiation factor 3, subunit D [Source:NCBI gene;Acc:336498])

HSP 1 Score: 503.827 bits (1296), Expect = 2.847e-173
Identity = 284/540 (52.59%), Postives = 376/540 (69.63%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLN-PEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPEKF D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   ++     R++SV+V+  W+V EE++F R  K+        +D+  CG L +YDK FDR++TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E ++LNSP NL++EAT+INHNF QQ L    + Y FPNPNPF++ED ++S + SV YRYRR+ LG DI L+ RCEHD V+    A+GE     F+ ++ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H++LGTQQFKP EFA+QINL MENAWG+LR +ID+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFHAPVIQDNPSGWGPCAVPEKFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDEASFQLVDTAKTQKTAYQRNRMRFAQRNLRRDK--DRRTLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WD---QKSQLKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMDVADPLDIECCGALEHYDKAFDRITTRNEKPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGSSLNSPRNLAMEATYINHNFSQQCLRMGGERYKFPNPNPFVEEDTEKSEVASVAYRYRRWKLGEDIDLIVRCEHDGVMTG--ANGEVS---FINVKTLNEWDSRYCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAILAGSEYLKLGYVSRYHVKDSSRHVVLGTQQFKPNEFASQINLSMENAWGILRCVIDICRKLEEGKYLILKDPNKQVIRVYSLP 524          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Zebrafish
Match: eif3d (eukaryotic translation initiation factor 3, subunit D [Source:NCBI gene;Acc:336498])

HSP 1 Score: 72.0182 bits (175), Expect = 1.712e-15
Identity = 31/54 (57.41%), Postives = 37/54 (68.52%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWTSTYNPESR 200
            +AKF    I DNP GWGP  VPEKF D+PYQPF+K  +LGK+ADWT     + R
Sbjct:    1 MAKFHAPVIQDNPSGWGPCAVPEKFKDMPYQPFSKGDRLGKVADWTGATYQDKR 54          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Zebrafish
Match: eif3d (eukaryotic translation initiation factor 3, subunit D [Source:NCBI gene;Acc:336498])

HSP 1 Score: 62.3882 bits (150), Expect = 2.814e-12
Identity = 26/41 (63.41%), Postives = 30/41 (73.17%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGK 161
            +AKF    I DNP GWGP  VPEKF D+PYQPF+K  +LGK
Sbjct:    1 MAKFHAPVIQDNPSGWGPCAVPEKFKDMPYQPFSKGDRLGK 41          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Xenopus
Match: rtcb (RNA 2',3'-cyclic phosphate and 5'-OH ligase [Source:Xenbase;Acc:XB-GENE-974751])

HSP 1 Score: 494.582 bits (1272), Expect = 1.878e-169
Identity = 280/540 (51.85%), Postives = 378/540 (70.00%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEK-IYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I+DNP GWGP  VP++F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFH++DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   + Q +  R++SV+V+  W+V EE++F R  K+        +D+  CG L +YDK FDR++TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDI+ QRVG  +F D R  N++FD +TV+ETA EPP ++ N+LNSP NL++EAT+INHNF QQ L   K  ++FPNPNPF+++D D++ + SV YRYRR+ LG+DI LV RCEHD  +    A+GE     FV I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K S+ H++LGTQQFKP EFA QINL MENAWG+LR ++D+CMKL  G YLI+KDPNKQ++RIY +P
Sbjct:    1 MAKFQAPVINDNPLGWGPCAVPDQFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHDEDETSFQLVDTTKMQKTAYQRNRLRFAQRNLRRDK--DRRNMLQFNMQTLPKSAKQKERDRLRLQ--KKFQKQFGVRQK--WDQKSQAQLK-PRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPLDIECCGALEFYDKAFDRITTRNERPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIVVQRVGSKIFFDKR-DNSDFDLLTVSETANEPPQDDVNSLNSPRNLAMEATYINHNFSQQCLRMGKEKHTFPNPNPFIEDDVDKNEVASVAYRYRRWKLGDDIDLVVRCEHDGFMTG--ANGEVS---FVNIKTLNEWDSRYCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRCHVKDSTRHVVLGTQQFKPNEFANQINLSMENAWGILRCVVDICMKLDEGKYLILKDPNKQVIRIYSLP 526          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Xenopus
Match: rtcb (RNA 2',3'-cyclic phosphate and 5'-OH ligase [Source:Xenbase;Acc:XB-GENE-974751])

HSP 1 Score: 494.582 bits (1272), Expect = 1.941e-169
Identity = 280/540 (51.85%), Postives = 378/540 (70.00%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEK-IYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I+DNP GWGP  VP++F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFH++DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   + Q +  R++SV+V+  W+V EE++F R  K+        +D+  CG L +YDK FDR++TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDI+ QRVG  +F D R  N++FD +TV+ETA EPP ++ N+LNSP NL++EAT+INHNF QQ L   K  ++FPNPNPF+++D D++ + SV YRYRR+ LG+DI LV RCEHD  +    A+GE     FV I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K S+ H++LGTQQFKP EFA QINL MENAWG+LR ++D+CMKL  G YLI+KDPNKQ++RIY +P
Sbjct:    1 MAKFQAPVINDNPLGWGPCAVPDQFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHDEDETSFQLVDTTKMQKTAYQRNRLRFAQRNLRRDK--DRRNMLQFNMQTLPKSAKQKERDRLRLQ--KKFQKQFGVRQK--WDQKSQAQLK-PRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPLDIECCGALEFYDKAFDRITTRNERPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIVVQRVGSKIFFDKR-DNSDFDLLTVSETANEPPQDDVNSLNSPRNLAMEATYINHNFSQQCLRMGKEKHTFPNPNPFIEDDVDKNEVASVAYRYRRWKLGDDIDLVVRCEHDGFMTG--ANGEVS---FVNIKTLNEWDSRYCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRCHVKDSTRHVVLGTQQFKPNEFANQINLSMENAWGILRCVVDICMKLDEGKYLILKDPNKQVIRIYSLP 526          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Xenopus
Match: rtcb (RNA 2',3'-cyclic phosphate and 5'-OH ligase [Source:Xenbase;Acc:XB-GENE-974751])

HSP 1 Score: 260.766 bits (665), Expect = 2.837e-80
Identity = 119/197 (60.41%), Postives = 153/197 (77.66%), Query Frame = 3
Query: 1062 EKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +K ++FPNPNPF+++D D++ + SV YRYRR+ LG+DI LV RCEHD  +    A+GE     FV I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K S+ H++LGTQQFKP EFA QINL MENAWG+LR ++D+CMKL  G YLI+KDPNKQ++RIY +P
Sbjct:  219 KKKHTFPNPNPFIEDDVDKNEVASVAYRYRRWKLGDDIDLVVRCEHDGFMTG--ANGEVS---FVNIKTLNEWDSRYCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRCHVKDSTRHVVLGTQQFKPNEFANQINLSMENAWGILRCVVDICMKLDEGKYLILKDPNKQVIRIYSLP 410          

HSP 2 Score: 151.754 bits (382), Expect = 1.414e-39
Identity = 94/228 (41.23%), Postives = 139/228 (60.96%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLK 719
            +AKF    I+DNP GWGP  VP++F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFH++DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   ++     R++SV+V+  W+V EE++F R  K+        +D+  CG L +YDK FDR++TRN + LK
Sbjct:    1 MAKFQAPVINDNPLGWGPCAVPDQFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHDEDETSFQLVDTTKMQKTAYQRNRLRFAQRNLRRDK--DRRNMLQFNMQTLPKSAKQKERDRLRLQ--KKFQKQFGVRQK--WD---QKSQLKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPLDIECCGALEFYDKAFDRITTRNERPLK 219          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Mouse
Match: Eif3d (eukaryotic translation initiation factor 3, subunit D [Source:MGI Symbol;Acc:MGI:1933181])

HSP 1 Score: 491.886 bits (1265), Expect = 1.419e-168
Identity = 278/540 (51.48%), Postives = 377/540 (69.81%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLN-PEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T + QK+ Y R R RFA    RRDK     ++ + Q     L K  K   RER +  ++  KQ+G      W+    ++++  R++SV+V+  W+V EE++F +  K+         D+  CG L YYDK FDR++TR+ + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LM C+RSV SWDI+ QRVG  LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L    + Y+FPNPNPF+++D D++ + SV YRYRR+ LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H+ILGTQQFKP EFA+QINL +ENAWG+LR +ID+CMKL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDETSFQLVDTARTQKTAYQRNRMRFAQRNLRRDK----DRRNMVQFNLQTLPKSAKQKERERIRLQKKFQKQFGVRQK--WD----QKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGRERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLP 523          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Mouse
Match: Eif3d (eukaryotic translation initiation factor 3, subunit D [Source:MGI Symbol;Acc:MGI:1933181])

HSP 1 Score: 111.694 bits (278), Expect = 3.506e-28
Identity = 75/179 (41.90%), Postives = 108/179 (60.34%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWK 572
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T + QK+ Y R R RFA    RRDK  +   Q   Q     L K  K   RER +  ++  KQ+G      W+     +++  R++SV+V+  W+
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDETSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMVQFNLQT----LPKSAKQKERERIRLQKKFQKQFG--VRQKWDQ----KSQKPRDSSVEVRSDWE 169          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. UniProt/SwissProt
Match: sp|Q6TH15|EIF3D_DANRE (Eukaryotic translation initiation factor 3 subunit D OS=Danio rerio OX=7955 GN=eif3d PE=2 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 4.359e-173
Identity = 285/540 (52.78%), Postives = 377/540 (69.81%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLN-PEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPEKF D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   + Q +  R++SV+V+  W+V EE++F R  K+        +D+  CG L +YDK FDR++TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E ++LNSP NL++EAT+INHNF QQ L    + Y FPNPNPF++ED ++S + SV YRYRR+ LG DI L+ RCEHD V+    A+GE     F+ ++ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H++LGTQQFKP EFA+QINL MENAWG+LR +ID+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFHAPVIQDNPSGWGPCAVPEKFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDEASFQLVDTAKTQKTAYQRNRMRFAQRNLRRDK--DRRTLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WDQKSQAQLK-PRDSSVEVRSDWEVKEEMDFPRLMKMRYMDVADPLDIECCGALEHYDKAFDRITTRNEKPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGSSLNSPRNLAMEATYINHNFSQQCLRMGGERYKFPNPNPFVEEDTEKSEVASVAYRYRRWKLGEDIDLIVRCEHDGVMTG--ANGEVS---FINVKTLNEWDSRYCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAILAGSEYLKLGYVSRYHVKDSSRHVVLGTQQFKPNEFASQINLSMENAWGILRCVIDICRKLEEGKYLILKDPNKQVIRVYSLP 526          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. UniProt/SwissProt
Match: sp|Q6P8G0|EIF3D_XENTR (Eukaryotic translation initiation factor 3 subunit D OS=Xenopus tropicalis OX=8364 GN=eif3d PE=2 SV=1)

HSP 1 Score: 494.582 bits (1272), Expect = 1.029e-168
Identity = 280/540 (51.85%), Postives = 378/540 (70.00%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEK-IYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I+DNP GWGP  VP++F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFH++DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   + Q +  R++SV+V+  W+V EE++F R  K+        +D+  CG L +YDK FDR++TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDI+ QRVG  +F D R  N++FD +TV+ETA EPP ++ N+LNSP NL++EAT+INHNF QQ L   K  ++FPNPNPF+++D D++ + SV YRYRR+ LG+DI LV RCEHD  +    A+GE     FV I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K S+ H++LGTQQFKP EFA QINL MENAWG+LR ++D+CMKL  G YLI+KDPNKQ++RIY +P
Sbjct:    1 MAKFQAPVINDNPLGWGPCAVPDQFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHDEDETSFQLVDTTKMQKTAYQRNRLRFAQRNLRRDK--DRRNMLQFNMQTLPKSAKQKERDRLRLQ--KKFQKQFGVRQK--WDQKSQAQLK-PRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPLDIECCGALEFYDKAFDRITTRNERPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIVVQRVGSKIFFDKR-DNSDFDLLTVSETANEPPQDDVNSLNSPRNLAMEATYINHNFSQQCLRMGKEKHTFPNPNPFIEDDVDKNEVASVAYRYRRWKLGDDIDLVVRCEHDGFMTG--ANGEVS---FVNIKTLNEWDSRYCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRCHVKDSTRHVVLGTQQFKPNEFANQINLSMENAWGILRCVVDICMKLDEGKYLILKDPNKQVIRIYSLP 526          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. UniProt/SwissProt
Match: sp|O15371|EIF3D_HUMAN (Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 2.973e-168
Identity = 281/540 (52.04%), Postives = 376/540 (69.63%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEK-IYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DES+F +V+T + QK+ Y R R RFA    RRDK  +   Q   Q     L K  K   RER +  ++  KQ+G      W+    ++++  R++SV+V+  W+V EE++F +  K+         D+  CG L YYDK FDR++TR+ + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LM C+RSV SWDI+ QRVG  LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L   K  Y+FPNPNPF+++D D++ + SV YRYRR+ LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H+ILGTQQFKP EFA+QINL +ENAWG+LR +ID+CMKL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQI----LPKSAKQKERERIRLQKKFQKQFGVRQK--WD----QKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLP 523          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. UniProt/SwissProt
Match: sp|Q5R925|EIF3D_PONAB (Eukaryotic translation initiation factor 3 subunit D OS=Pongo abelii OX=9601 GN=EIF3D PE=2 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 6.358e-168
Identity = 281/540 (52.04%), Postives = 375/540 (69.44%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEK-IYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DES+F +V+T + QK+ Y R R RFA    RRDK  +   Q   Q     L K  K   RER +  ++  KQ+G      W+    ++++  R++SV+V+  W+V EE++F +  K+         D+  CG L YYDK FDR++TR+ + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LM C+RSV SWDI+ QRVG  LF D R  N++FD  TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L   K  Y+FPNPNPF+++D D++ + SV YRYRR+ LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H+ILGTQQFKP EFA+QINL +ENAWG+LR +ID+CMKL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQI----LPKSAKQKERERIRLQKKFQKQFGVRQK--WD----QKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKR-DNSDFDLPTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLP 523          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. UniProt/SwissProt
Match: sp|Q3T122|EIF3D_BOVIN (Eukaryotic translation initiation factor 3 subunit D OS=Bos taurus OX=9913 GN=EIF3D PE=2 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 6.787e-168
Identity = 280/540 (51.85%), Postives = 376/540 (69.63%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEK-IYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPE+F D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T + QK+ Y R R RFA    RRDK  +   Q   Q     L K  K   RER +  ++  KQ+G      W+    ++++  R++SV+V+  W+V EE++F +  K+         D+  CG L YYDK FDR++TR+ + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LM C+RSV SWDI+ QRVG  LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L   K  Y+FPNPNPF+++D D++ + SV YRYRR+ LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAV+  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K SS H+ILGTQQFKP EFA+QINL +ENAWG+LR +ID+CMKL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDETSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQT----LPKSAKQKERERIRLQKKFQKQFGVRQK--WD----QKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLP 523          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. TrEMBL
Match: A0A1S3K4X2 (Eukaryotic translation initiation factor 3 subunit D OS=Lingula unguis OX=7574 GN=LOC106178782 PE=3 SV=1)

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 301/541 (55.64%), Postives = 397/541 (73.38%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVL--NPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +A F+   I DNP+GWGP  VPEKF D+PYQPF+K  +LGK++DWT STY      NK+++    G+QYAY+HE+DESTF +V+T K QK  Y R R +F  N+ RR++  ++QQ     Q    L+K QK   R+R + +R+  KQ+GR       +D R+    HR+ASVQV+DTW VVEE++F R +KLSLP      D+  CG + YY+K++DRV+T+N +KLK +NR+ H V T DDP+IRKLA  K GNVFATD +++ +MCC+RS  SWDI+AQRVG+ LFLD R  ++ FD +TV+ETA+EPP EE  ++NSP +L+LEATFINHNF QQVL  N EK +SF N NPF+ E+DD   + SVGYRYR++DLGNDI+L+CR EHD V+      G ++   F+ I+ALNEWDSR SGG+DWR++LD+QRGAVL  E+KNN+ KLAKWTV A+LAGSDQ+K GYV+R   + S+ H+ILGTQQFKP+EFA+QINL M+N WG+LR I+D  MK+  G YLIMKDPNK ++RIYD+P
Sbjct:    1 MAHFTPPVIQDNPNGWGPCQVPEKFKDMPYQPFSKGDRLGKVSDWTGSTYQDRRYMNKYSSQFGGGSQYAYYHEEDESTFQLVDTAKVQKPIYQRARMKFNQNKLRRERERRQQQNAASMQV---LSKTQKSRERDRMRQLRKFQKQFGRT-----MHDQRKIQLKHRDASVQVRDTWDVVEEMDFPRLTKLSLPTVGEPQDIVCCGSMEYYNKSYDRVTTKNEKKLKRVNRIFHKVTTTDDPVIRKLAKSK-GNVFATDVILATIMCCTRSTYSWDIVAQRVGNKLFLDKR-DDSEFDLLTVSETAIEPPQEEGTSINSPRSLALEATFINHNFSQQVLKMNQEK-FSFENKNPFVQEEDD-GEVASVGYRYRKWDLGNDIELICRTEHDGVMV-----GPNNETNFINIKALNEWDSRFSGGVDWRSRLDVQRGAVLATELKNNSCKLAKWTVCALLAGSDQIKFGYVSRVHQRDSAKHVILGTQQFKPIEFASQINLSMDNGWGILRCIVDTLMKMKEGKYLIMKDPNKPMIRIYDIP 524          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. TrEMBL
Match: A0A1S3K577 (Eukaryotic translation initiation factor 3 subunit D OS=Lingula unguis OX=7574 GN=LOC106178782 PE=3 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 301/541 (55.64%), Postives = 397/541 (73.38%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVL--NPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +A F+   I DNP+GWGP  VPEKF D+PYQPF+K  +LGK++DWT STY      NK+++    G+QYAY+HE+DESTF +V+T K QK  Y R R +F  N+ RR++  ++QQ     Q    L+K QK   R+R + +R+  KQ+GR       +D R+    HR+ASVQV+DTW VVEE++F R +KLSLP      D+  CG + YY+K++DRV+T+N +KLK +NR+ H V T DDP+IRKLA  K GNVFATD +++ +MCC+RS  SWDI+AQRVG+ LFLD R  ++ FD +TV+ETA+EPP EE  ++NSP +L+LEATFINHNF QQVL  N EK +SF N NPF+ E+DD   + SVGYRYR++DLGNDI+L+CR EHD V+      G ++   F+ I+ALNEWDSR SGG+DWR++LD+QRGAVL  E+KNN+ KLAKWTV A+LAGSDQ+K GYV+R   + S+ H+ILGTQQFKP+EFA+QINL M+N WG+LR I+D  MK+  G YLIMKDPNK ++RIYD+P
Sbjct:    1 MAHFTPPVIQDNPNGWGPCQVPEKFKDMPYQPFSKGDRLGKVSDWTGSTYQDRRYMNKYSSQFGGGSQYAYYHEEDESTFQLVDTAKVQKPIYQRARMKFNQNKLRRERERRQQQNAASMQV---LSKTQKSRERDRMRQLRKFQKQFGRT-----MHDQRKIQLKHRDASVQVRDTWDVVEEMDFPRLTKLSLPTVGEPQDIVCCGSMEYYNKSYDRVTTKNEKKLKRVNRIFHKVTTTDDPVIRKLAKSK-GNVFATDVILATIMCCTRSTYSWDIVAQRVGNKLFLDKR-DDSEFDLLTVSETAIEPPQEEGTSINSPRSLALEATFINHNFSQQVLKMNQEK-FSFENKNPFVQEEDD-GEVASVGYRYRKWDLGNDIELICRTEHDGVMV-----GPNNETNFINIKALNEWDSRFSGGVDWRSRLDVQRGAVLATELKNNSCKLAKWTVCALLAGSDQIKFGYVSRVHQRDSAKHVILGTQQFKPIEFASQINLSMDNGWGILRCIVDTLMKMKEGKYLIMKDPNKPMIRIYDIP 524          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. TrEMBL
Match: A0A3P8YRX5 (Eukaryotic translation initiation factor 3 subunit D OS=Esox lucius OX=8010 GN=EIF3D PE=3 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 4.493e-173
Identity = 287/540 (53.15%), Postives = 379/540 (70.19%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLN-PEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF   +I DNPDGWGP  VPEKF D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   ++     R++SV+V+  W+V EE++F R  K+     E  +D+  CG L YYDK FDR++TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L    + + FPNPNPF++ED D+S + SV YRYRR+ LG+DI L+ RCEHD V+    A+GE     F+ ++ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  AMLAGS+ LKLGYV+R   K S+ H+ILGTQQF+P EFA+QINL MENAWG+LR +ID+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFHAPEIQDNPDGWGPCAVPEKFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDETSFQLVDTAKTQKTAYQRNRMRFAQRNLRRDK--DRRNLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WD---QKSQLKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMDVEDPIDIECCGALEYYDKAFDRITTRNEKPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGGERHKFPNPNPFVEEDMDKSEVASVAYRYRRWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINVKTLNEWDSRHCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAMLAGSEYLKLGYVSRYHAKDSARHVILGTQQFQPTEFASQINLSMENAWGILRCVIDICRKLDEGKYLILKDPNKQVIRVYSLP 524          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. TrEMBL
Match: A0A0B7AUR0 (Eukaryotic translation initiation factor 3 subunit D OS=Arion vulgaris OX=1028688 GN=ORF143420 PE=3 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 4.903e-173
Identity = 290/541 (53.60%), Postives = 391/541 (72.27%), Query Frame = 3
Query:   42 AKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXX-XXXXXXXTFINHNFVQQVL--NPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            A F    I DNP GWGP+ +P++F D+PYQPF+KD++LGK++DWT +TY  +    K+N+    G+QYAY+HE+DESTF +V+T + QK  Y R+   F  NR RRD+  ++QQ Q   Q    LTK QK   R+RQ+ +++  KQ+G+    +  N  +   R +R+ASVQ+KD W VVEE++F R SKL+LP  + G DL TCG + +YDK +DRV+T+N ++L+ +NR+ H V T DDPIIR+LA  + GNVFATD +++ +MCC RS  SWD++ QRVG+ LF D R  +++FD +TV+ETA EPP E+ +   +   +L+LEATFINHNF QQVL  N EK + F   NPF+  ++D S + SVGYRYR++DLGN+I L+ R EHDA     T  G S+   F+ ++ALNEWDSR +GG+DWR++LD QRGAVL  E+KNN+ KLAKWTVSA+LAGSDQ+K GYV+R   K ++ H+ILGTQQFKP+EFA+QINL M+NAWG+LR IID CMKL  G YLIMKDPNK ++RIYD+P
Sbjct:    4 AHFIPPQIQDNPHGWGPNQIPDQFKDMPYQPFSKDVRLGKVSDWTGNTYQDKRYLGKYNSAFGGGSQYAYYHEEDESTFQLVDTSRVQKPIYQRRGRLFQQNRQRRDRERRQQQNQASMQV---LTKTQKNRERDRQRLLKKWQKQFGK---QMQENRSKMPIR-NRDASVQIKDDWAVVEEMDFPRLSKLNLPDIKEGEDLVTCGSMEFYDKTYDRVTTKNEKRLRRINRIFHKVTTTDDPIIRQLAKTQ-GNVFATDAILATMMCCPRSSYSWDVVVQRVGNKLFFDKR-DDSDFDLLTVSETATEPPQEDGSANINSPRSLALEATFINHNFSQQVLKMNEEK-HGFEKSNPFVQGEED-SEVASVGYRYRKWDLGNEIVLIARTEHDA-----TTFGPSNEIQFMNVKALNEWDSRFAGGVDWRSRLDTQRGAVLATELKNNSCKLAKWTVSALLAGSDQIKFGYVSRLHVKDTAKHVILGTQQFKPVEFASQINLNMDNAWGILRCIIDTCMKLKEGKYLIMKDPNKPVVRIYDIP 528          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. TrEMBL
Match: A0A4W5L132 (Eukaryotic translation initiation factor 3 subunit D OS=Hucho hucho OX=62062 GN=EIF3D PE=3 SV=1)

HSP 1 Score: 512.686 bits (1319), Expect = 7.265e-173
Identity = 287/539 (53.25%), Postives = 376/539 (69.76%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF   +I DNP GWGP  VPEKF D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   ++     R++SV+V+  W+V EE++F R  K+     E   D+  CG L YYDK FDRV+TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L   K + FPNPNPF++ED D+S + SV YRYRR+ LG DI L+ RCEHD V+    A+GE     F+ ++ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  AMLAGS+ LKLGYV+R   K S+ H++LGTQQF+P EFA+QINL MENAWG+LR +ID+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFHAPEIQDNPSGWGPCAVPEKFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDETSFQLVDTAKTQKTAYQRNRMRFAQRNLRRDK--DRRNLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WD---QKSQLKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVEDPTDIECCGALEYYDKAFDRVTTRNEKPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLVMWKKHKFPNPNPFVEEDIDKSEVASVAYRYRRWKLGEDIDLIVRCEHDGVMTG--ANGEVS---FINVKTLNEWDSRHCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAMLAGSEYLKLGYVSRYHAKDSARHVVLGTQQFQPTEFASQINLSMENAWGILRCVIDICRKLEEGKYLILKDPNKQVIRVYSLP 523          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Cavefish
Match: eif3d (eukaryotic translation initiation factor 3 subunit D [Source:NCBI gene;Acc:103040764])

HSP 1 Score: 499.975 bits (1286), Expect = 9.709e-172
Identity = 288/540 (53.33%), Postives = 375/540 (69.44%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLN-PEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  VPEKF D+PYQPF+K  +LGK+ADWT +TY  +   NK+++    G+QYAYFHE+DE++F +V+T K QK+ Y R R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   + Q +  R++SV+V+  W+V EE++F R  K+         D+  CG L YYDK FDRV+TRN + LK + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E N+LNSP NL++EAT+INHNF QQ L    + + FP  NPF++ED D+S + SV YRYRR+ LG DI L+ RCEHD V+    A+GE     F+ ++ALNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  A+LAGS+ LKLGYV+R   K S+ H+ILGTQQFKP EFA+QINL MENAWG+LR +ID+C KL  G YLI+KDPNKQ++RIY +P
Sbjct:    1 MAKFLAPVIQDNPSGWGPCAVPEKFKDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDEASFQLVDTAKTQKTAYQRNRMRFAQRNLRRDK--DRRNLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WDQKSQAQLK-PRDSSVEVRSDWEVKEEMDFPRLMKMRYMDVADPSDIECCGALEYYDKAFDRVTTRNEKPLKSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSLNSPRNLAMEATYINHNFSQQCLRMGGERHKFPTSNPFVEEDMDKSEVASVAYRYRRWKLGEDIDLIVRCEHDGVMTG--ANGELS---FINVKALNEWDSRHCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSARHVILGTQQFKPNEFASQINLSMENAWGILRCVIDICRKLDEGKYLILKDPNKQVIRIYSLP 526          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Sea Lamprey
Match: eif3d (eukaryotic translation initiation factor 3, subunit D [Source:NCBI gene;Acc:336498])

HSP 1 Score: 229.565 bits (584), Expect = 6.319e-71
Identity = 133/300 (44.33%), Postives = 193/300 (64.33%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDF 935
            +A F    I DN +GWGP  +PE+F D+PYQPF+K  +LGK+ADWT STY  +   NK+++    G+QYAYFHE+DE +F +V+T + QKS + + R +F   RN R +  ++ Q Q      L  + KQK  +R+RQ+ I+++ KQ+G      W+   ++  +  R++SV+V+  W V EE++F R  K+        VD+   GEL +YDK FDR++TR+ + LK + R+ H V T DDP+IRKL A+  GNVFATD +++ LMCC+RSV SWDI+ QRVG  LF D R  N++F F
Sbjct:    1 MAHFVAPLIQDNHNGWGPCAIPEQFKDMPYQPFSKADRLGKVADWTGSTYQDKRYTNKYSSQFGGGSQYAYFHEEDEGSFQLVDTTRVQKSIFQKNRMKFTQQRNMRREKERRLQMQALNMQTLSKSAKQKE-SRDRQR-IQKLQKQFG--GRQRWD---QKGQQKPRDSSVEVRSDWDVKEEMDFPRLMKMRYVDVAEPVDIECLGELEHYDKAFDRITTRSEKPLKSIKRIFHTVTTTDDPVIRKL-AKSEGNVFATDAILATLMCCTRSVYSWDILVQRVGSKLFFDKR-DNSDFGF 291          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Nematostella
Match: EDO35013 (Eukaryotic translation initiation factor 3 subunit D [Source:UniProtKB/Swiss-Prot;Acc:A7SMR1])

HSP 1 Score: 445.662 bits (1145), Expect = 7.503e-151
Identity = 265/543 (48.80%), Postives = 365/543 (67.22%), Query Frame = 3
Query:   42 AKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQ-YAYFHEDDESTFHMVNTMKEQKSNYIXXXXX-XXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIH-REASVQVKDTWKVVE--EIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            AKF   +I DNPDGWGP +VP  F D+PYQPF+K  +LGK++DWT S Y      NK+ +    GNQ ++Y+HE+DE++F +V+T + Q+  Y+R RNR       RRD    + Q Q        L++ +   N+ +    R++ + +G      W++  ++   +H R ASV V++ WKV+E  E++F R SKL+LP  E    L+ CG + YYDK +DRV+T+N   L  +NR+ H V T DDPII KL +Q  GNVFATD ++S LM C+RS  SWDI+ QRVG  LF D R  ++ FD +TV ETA +  ++E + +N+P+NLSLEATFIN NF QQVL   ++ +F +PNPF+ ++DD S + SV YRYR++DLG+ I+L+ RCEHDA+++     G       V I+ LNEWD +++G +DWR KLD QRGAVL  E+KNN+ KLAKWT +++LAGS+ LKLGYV+R     +S H ILGTQQF+P EFATQI L M+NAWGVLR IID+CMK   G  LI+KDP+K ++RIYD+P
Sbjct:    5 AKFCAPEIQDNPDGWGPCSVPTAFKDIPYQPFSKADRLGKVSDWTGSVYQDRRYANKYQSQFGTGNQMFSYYHEEDETSFQLVDTSRTQRPGYMRNRNRFNQRGGYRRDNRGGRFQGQGGNMGMQNLSRGRDTRNKFQ----RKMQRNWG--GGRHWSD--KKTGGMHKRVASVTVREEWKVLEDGELDFPRLSKLNLPNVEEPETLYECGSVEYYDKAYDRVTTKNEVPLVGVNRVFHKVTTTDDPIISKLLSQ--GNVFATDAIISTLMTCTRSNYSWDIVVQRVGSKLFFDKR-DDSEFDLLTVGETANDLNIDETSGINTPTNLSLEATFINQNFSQQVLKRGEVKTFDHPNPFVTDEDD-STVASVCYRYRKWDLGDGIQLIVRCEHDAIMQ-----GPRGETCLVNIKTLNEWDPKMTG-VDWRQKLDSQRGAVLATELKNNSCKLAKWTANSILAGSEYLKLGYVSRVNFLDTSKHTILGTQQFRPREFATQIALNMDNAWGVLRCIIDICMKQPEGKLLILKDPSKGVIRIYDIP 529          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Medaka
Match: eif3d (eukaryotic translation initiation factor 3 subunit D [Source:NCBI gene;Acc:101166133])

HSP 1 Score: 499.59 bits (1285), Expect = 1.399e-171
Identity = 280/540 (51.85%), Postives = 372/540 (68.89%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPE-KIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  +PEKF D+PYQPF+K  +LGK++DWT +TY  +   N++ +    G+ YAYFHE++E+TF +V+T K QK+ Y + R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   +   +  R++SV+V+  W+V EE++F R  K+        VD+  CG L YYDK FDR++TRN + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L    + Y FPNPNPF++ED D+S + SV YRYR + LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  AMLAGS+ LKLGYV+R   K S+ H+ILGTQ FKP EFA+QINL MENAWG+LR ++D+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFQAPVIQDNPTGWGPCAIPEKFRDMPYQPFSKGDRLGKVSDWTGATYQDKRYPNRYTSQFGGGSVYAYFHEENETTFQLVDTAKTQKTAYQKNRMRFAQRNLRRDK--DRRNLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WDQKSQVAQQKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPVDIECCGALEYYDKAFDRITTRNEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMRGERYKFPNPNPFVEEDMDKSEVASVAYRYRHWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRYCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAMLAGSEYLKLGYVSRYHLKDSARHVILGTQHFKPNEFASQINLSMENAWGILRCVVDICRKLDEGKYLILKDPNKQVIRVYSLP 527          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Medaka
Match: eif3d (eukaryotic translation initiation factor 3 subunit D [Source:NCBI gene;Acc:101166133])

HSP 1 Score: 499.204 bits (1284), Expect = 2.193e-171
Identity = 280/540 (51.85%), Postives = 372/540 (68.89%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPE-KIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  +PEKF D+PYQPF+K  +LGK++DWT +TY  +   N++ +    G+ YAYFHE++E+TF +V+T K QK+ Y + R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   +   +  R++SV+V+  W+V EE++F R  K+        VD+  CG L YYDK FDR++TRN + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L    + Y FPNPNPF++ED D+S + SV YRYR + LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  AMLAGS+ LKLGYV+R   K S+ H+ILGTQ FKP EFA+QINL MENAWG+LR ++D+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFQAPVIQDNPTGWGPCAIPEKFRDMPYQPFSKGDRLGKVSDWTGATYQDKRYPNRYTSQFGGGSVYAYFHEENETTFQLVDTAKTQKTAYQKNRMRFAQRNLRRDK--DRRNLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WDQKSQVAQQKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPVDIECCGALEYYDKAFDRITTRNEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMRGERYKFPNPNPFVEEDMDKSEVASVAYRYRHWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRYCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAMLAGSEYLKLGYVSRYHLKDSARHVILGTQHFKPNEFASQINLSMENAWGILRCVVDICRKLDEGKYLILKDPNKQVIRVYSLP 527          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Medaka
Match: eif3d (eukaryotic translation initiation factor 3 subunit D [Source:NCBI gene;Acc:101166133])

HSP 1 Score: 497.278 bits (1279), Expect = 1.062e-170
Identity = 280/540 (51.85%), Postives = 372/540 (68.89%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPE-KIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  +PEKF D+PYQPF+K  +LGK++DWT +TY  +   N++ +    G+ YAYFHE++E+TF +V+T K QK+ Y + R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   ++     R++SV+V+  W+V EE++F R  K+        VD+  CG L YYDK FDR++TRN + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L    + Y FPNPNPF++ED D+S + SV YRYR + LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  AMLAGS+ LKLGYV+R   K S+ H+ILGTQ FKP EFA+QINL MENAWG+LR ++D+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFQAPVIQDNPTGWGPCAIPEKFRDMPYQPFSKGDRLGKVSDWTGATYQDKRYPNRYTSQFGGGSVYAYFHEENETTFQLVDTAKTQKTAYQKNRMRFAQRNLRRDK--DRRNLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WD---QKSQVKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPVDIECCGALEYYDKAFDRITTRNEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMRGERYKFPNPNPFVEEDMDKSEVASVAYRYRHWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRYCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAMLAGSEYLKLGYVSRYHAKDSARHVILGTQHFKPNEFASQINLSMENAWGILRCVVDICRKLDEGKYLILKDPNKQVIRVYSLP 524          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Medaka
Match: eif3d (eukaryotic translation initiation factor 3 subunit D [Source:NCBI gene;Acc:101166133])

HSP 1 Score: 497.278 bits (1279), Expect = 1.062e-170
Identity = 280/540 (51.85%), Postives = 372/540 (68.89%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPE-KIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  +PEKF D+PYQPF+K  +LGK++DWT +TY  +   N++ +    G+ YAYFHE++E+TF +V+T K QK+ Y + R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   ++     R++SV+V+  W+V EE++F R  K+        VD+  CG L YYDK FDR++TRN + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L    + Y FPNPNPF++ED D+S + SV YRYR + LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  AMLAGS+ LKLGYV+R   K S+ H+ILGTQ FKP EFA+QINL MENAWG+LR ++D+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFQAPVIQDNPTGWGPCAIPEKFRDMPYQPFSKGDRLGKVSDWTGATYQDKRYPNRYTSQFGGGSVYAYFHEENETTFQLVDTAKTQKTAYQKNRMRFAQRNLRRDK--DRRNLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WD---QKSQVKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPVDIECCGALEYYDKAFDRITTRNEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMRGERYKFPNPNPFVEEDMDKSEVASVAYRYRHWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRYCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAMLAGSEYLKLGYVSRYHAKDSARHVILGTQHFKPNEFASQINLSMENAWGILRCVVDICRKLDEGKYLILKDPNKQVIRVYSLP 524          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Medaka
Match: eif3d (eukaryotic translation initiation factor 3 subunit D [Source:NCBI gene;Acc:101166133])

HSP 1 Score: 497.278 bits (1279), Expect = 1.062e-170
Identity = 280/540 (51.85%), Postives = 372/540 (68.89%), Query Frame = 3
Query:   39 LAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT-STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPE-KIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            +AKF    I DNP GWGP  +PEKF D+PYQPF+K  +LGK++DWT +TY  +   N++ +    G+ YAYFHE++E+TF +V+T K QK+ Y + R RFA    RRDK   ++         L  + KQK  +R R Q  ++  KQ+G      W+   ++     R++SV+V+  W+V EE++F R  K+        VD+  CG L YYDK FDR++TRN + L+ + R+ H V T DDP+IRKLA  + GNVFATD +++ LMCC+RSV SWDII QRVG+ LF D R  N++FD +TV+ETA EPP +E N+ NSP NL++EAT+INHNF QQ L    + Y FPNPNPF++ED D+S + SV YRYR + LG+DI L+ RCEHD V+    A+GE     F+ I+ LNEWDSR   G+DWR KLD QRGAVL  E+KNN++KLA+WT  AMLAGS+ LKLGYV+R   K S+ H+ILGTQ FKP EFA+QINL MENAWG+LR ++D+C KL  G YLI+KDPNKQ++R+Y +P
Sbjct:    1 MAKFQAPVIQDNPTGWGPCAIPEKFRDMPYQPFSKGDRLGKVSDWTGATYQDKRYPNRYTSQFGGGSVYAYFHEENETTFQLVDTAKTQKTAYQKNRMRFAQRNLRRDK--DRRNLTQFNMQTLPKSAKQKERDRMRLQ--KKFQKQFGVRQK--WD---QKSQVKPRDSSVEVRSDWEVKEEMDFPRLMKMRYMEVSDPVDIECCGALEYYDKAFDRITTRNEKPLRSIKRIFHTVTTTDDPVIRKLAKTQ-GNVFATDAILATLMCCTRSVNSWDIIVQRVGNKLFFDKR-DNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMRGERYKFPNPNPFVEEDMDKSEVASVAYRYRHWKLGDDIDLIVRCEHDGVMTG--ANGEVS---FINIKTLNEWDSRYCNGVDWRQKLDSQRGAVLATELKNNSYKLARWTCCAMLAGSEYLKLGYVSRYHAKDSARHVILGTQHFKPNEFASQINLSMENAWGILRCVVDICRKLDEGKYLILKDPNKQVIRVYSLP 524          
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Planmine SMEST
Match: SMESG000020924.1 (SMESG000020924.1)

HSP 1 Score: 1004.97 bits (2597), Expect = 0.000e+0
Identity = 540/542 (99.63%), Postives = 540/542 (99.63%), Query Frame = 3
Query:   27 MNAILAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWTSTYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIXXXXXXXXXXXXXDKVLXXXXXXXXXXTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFINHNFVQQVLNPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 1652
            MNAILAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWTSTYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIRQRNRFAANRNRRDKVLQKQQQQIEQQTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFVTVNETAVEPPVEEPNNLNS SNLSLEATFINHNFVQQVLNPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQ KGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP
Sbjct:    1 MNAILAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWTSTYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIRQRNRFAANRNRRDKVLQKQQQQIEQQTRLGLTKKQKYINRERQQDIRRINKQYGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPITETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRKLAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTNFDFVTVNETAVEPPVEEPNNLNSASNLSLEATFINHNFVQQVLNPEKIYSFPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTADGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFKLAKWTVSAMLAGSDQLKLGYVTREQSKGSSLHIILGTQQFKPLEFATQINLKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVP 542          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF3D6.191e-16952.04eukaryotic translation initiation factor 3 subunit... [more]
EIF3D6.191e-16952.04eukaryotic translation initiation factor 3 subunit... [more]
EIF3D4.083e-6444.29eukaryotic translation initiation factor 3 subunit... [more]
EIF3D5.074e-3043.17eukaryotic translation initiation factor 3 subunit... [more]
EIF3D1.954e-2853.76eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif-3.D6.982e-10938.28Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eIF3d17.898e-16249.09gene:FBgn0040227 transcript:FBtr0089622[more]
eIF3d23.376e-14946.75gene:FBgn0037994 transcript:FBtr0082546[more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eif3d5.774e-17452.78eukaryotic translation initiation factor 3, subuni... [more]
eif3d2.847e-17352.59eukaryotic translation initiation factor 3, subuni... [more]
eif3d1.712e-1557.41eukaryotic translation initiation factor 3, subuni... [more]
eif3d2.814e-1263.41eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rtcb1.878e-16951.85RNA 2',3'-cyclic phosphate and 5'-OH ligase [Sourc... [more]
rtcb1.941e-16951.85RNA 2',3'-cyclic phosphate and 5'-OH ligase [Sourc... [more]
rtcb2.837e-8060.41RNA 2',3'-cyclic phosphate and 5'-OH ligase [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Eif3d1.419e-16851.48eukaryotic translation initiation factor 3, subuni... [more]
Eif3d3.506e-2841.90eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6TH15|EIF3D_DANRE4.359e-17352.78Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q6P8G0|EIF3D_XENTR1.029e-16851.85Eukaryotic translation initiation factor 3 subunit... [more]
sp|O15371|EIF3D_HUMAN2.973e-16852.04Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q5R925|EIF3D_PONAB6.358e-16852.04Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q3T122|EIF3D_BOVIN6.787e-16851.85Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K4X20.000e+055.64Eukaryotic translation initiation factor 3 subunit... [more]
A0A1S3K5770.000e+055.64Eukaryotic translation initiation factor 3 subunit... [more]
A0A3P8YRX54.493e-17353.15Eukaryotic translation initiation factor 3 subunit... [more]
A0A0B7AUR04.903e-17353.60Eukaryotic translation initiation factor 3 subunit... [more]
A0A4W5L1327.265e-17353.25Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif3d9.709e-17253.33eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif3d6.319e-7144.33eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO350137.503e-15148.80Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif3d1.399e-17151.85eukaryotic translation initiation factor 3 subunit... [more]
eif3d2.193e-17151.85eukaryotic translation initiation factor 3 subunit... [more]
eif3d1.062e-17051.85eukaryotic translation initiation factor 3 subunit... [more]
eif3d1.062e-17051.85eukaryotic translation initiation factor 3 subunit... [more]
eif3d1.062e-17051.85eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit D vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000020924.10.000e+099.63SMESG000020924.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013220 ID=SMED30013220|Name=Eukaryotic translation initiation factor 3 subunit D|organism=Schmidtea mediterranea sexual|type=transcript|length=1793bp
CCGACTTTAAATTATAATAACGTTTAATGAATGCAATTTTAGCTAAATTT
TCTTTATTTGATATTGATGATAATCCTGATGGATGGGGACCATCAACTGT
TCCAGAAAAGTTTTCTGATTTGCCTTATCAACCTTTCAACAAAGATATTA
AATTAGGAAAAATTGCTGATTGGACCAGTACTTATAATCCAGAAAGTAGA
AAAAATAAATTTAATACTATGAATCCCCAAGGTAACCAATATGCTTATTT
TCACGAAGACGACGAAAGTACTTTCCACATGGTTAACACGATGAAAGAGC
AAAAATCAAATTATATTCGCCAAAGGAATAGATTTGCTGCAAATAGAAAT
CGCCGGGACAAAGTCCTTCAAAAGCAGCAACAGCAAATTGAACAACAAAC
AAGACTAGGACTTACTAAAAAGCAAAAATATATAAATCGAGAGCGTCAAC
AAGATATAAGAAGAATTAATAAGCAATATGGAAGACTTAATACAAATGTA
TGGAATAATGATTATCGCAGACAGAACAGGATACATAGAGAAGCTTCAGT
TCAAGTTAAAGATACCTGGAAAGTAGTGGAAGAAATTGAATTTTCTCGTT
TCAGTAAATTATCTCTACCTATTACTGAAACTGGTGTTGATTTATTTACT
TGTGGAGAATTGGCGTATTATGATAAGAATTTCGATAGGGTTTCTACAAG
AAACACACAGAAATTGAAACTTATGAATAGATTAATACACAATGTAGCCA
CAGGTGATGATCCAATCATTCGTAAATTGGCTGCTCAAAAAGCCGGAAAT
GTTTTTGCTACGGATCGTTTAGTGTCATGTTTAATGTGTTGTTCTCGTTC
TGTTGAATCCTGGGATATAATTGCACAGAGAGTTGGTGATATTCTTTTCC
TTGATACACGACCAGGAAATACGAATTTCGATTTCGTCACTGTAAACGAA
ACGGCCGTTGAACCACCTGTTGAAGAACCCAATAATCTTAACTCTCCAAG
CAATTTGTCATTAGAAGCAACGTTTATCAATCATAACTTCGTTCAACAAG
TTCTAAATCCGGAAAAAATTTATTCTTTCCCAAATCCAAACCCGTTCCTT
GATGAAGATGATGATAGGAGCAATTTGGGTTCGGTTGGCTATCGATATCG
TCGATTTGATCTCGGAAACGACATCAAATTGGTGTGTCGATGTGAACACG
ATGCAGTAGTGGAAAATAAAACTGCCGACGGCGAATCCGACAGTCCGTTG
TTTGTCACTATTCGTGCTCTCAACGAATGGGATTCGAGAATATCCGGTGG
AATCGATTGGAGAGCCAAGCTCGACATTCAACGTGGAGCGGTTCTGGGAG
CAGAAATCAAAAACAACGCATTCAAATTGGCGAAATGGACCGTGTCAGCC
ATGCTAGCCGGATCGGATCAGTTGAAATTGGGCTACGTTACCAGAGAGCA
ACCGAAGGGAAGCAGTTTGCACATTATTCTCGGCACCCAGCAGTTCAAGC
CCCTTGAGTTTGCAACTCAAATAAACCTGAAAATGGAGAATGCCTGGGGT
GTTCTGCGCTCGATTATTGACTTGTGCATGAAGCTGACACCTGGATTATA
TTTGATTATGAAGGATCCAAACAAGCAAATATTGAGAATCTATGACGTTC
CAAATGATGCATTTGAAGACGAGGCTGATGCCAATAGCGAAGAAGAAGAG
GAGGAAGAGAATTAATTTAGCACTGCTCCAAGTTATGGTGTTTCCGTCTC
AAATTAGTCAAAATAAATATATTCTCTTTAAAAAAGATCGGAA
back to top

protein sequence of SMED30013220-orf-1

>SMED30013220-orf-1 ID=SMED30013220-orf-1|Name=SMED30013220-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MNAILAKFSLFDIDDNPDGWGPSTVPEKFSDLPYQPFNKDIKLGKIADWT
STYNPESRKNKFNTMNPQGNQYAYFHEDDESTFHMVNTMKEQKSNYIRQR
NRFAANRNRRDKVLQKQQQQIEQQTRLGLTKKQKYINRERQQDIRRINKQ
YGRLNTNVWNNDYRRQNRIHREASVQVKDTWKVVEEIEFSRFSKLSLPIT
ETGVDLFTCGELAYYDKNFDRVSTRNTQKLKLMNRLIHNVATGDDPIIRK
LAAQKAGNVFATDRLVSCLMCCSRSVESWDIIAQRVGDILFLDTRPGNTN
FDFVTVNETAVEPPVEEPNNLNSPSNLSLEATFINHNFVQQVLNPEKIYS
FPNPNPFLDEDDDRSNLGSVGYRYRRFDLGNDIKLVCRCEHDAVVENKTA
DGESDSPLFVTIRALNEWDSRISGGIDWRAKLDIQRGAVLGAEIKNNAFK
LAKWTVSAMLAGSDQLKLGYVTREQPKGSSLHIILGTQQFKPLEFATQIN
LKMENAWGVLRSIIDLCMKLTPGLYLIMKDPNKQILRIYDVPNDAFEDEA
DANSEEEEEEEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001732formation of cytoplasmic translation initiation complex
GO:0002183cytoplasmic translational initiation
GO:0002191cap-dependent translational initiation
GO:0006412translation
GO:0006413translational initiation
Vocabulary: cellular component
TermDefinition
GO:0016282eukaryotic 43S preinitiation complex
GO:0033290eukaryotic 48S preinitiation complex
GO:0005852eukaryotic translation initiation factor 3 complex
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007783eIF3d
Vocabulary: molecular function
TermDefinition
GO:0003743translation initiation factor activity
GO:0003723RNA binding
GO:0098808mRNA cap binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007783Eukaryotic translation initiation factor 3 subunit DPIRSFPIRSF016281Transl_init_eIF3dcoord: 3..562
e-value: 1.5E-197
score: 655.4
IPR007783Eukaryotic translation initiation factor 3 subunit DPFAMPF05091eIF-3_zetacoord: 9..540
e-value: 1.7E-191
score: 637.8
IPR007783Eukaryotic translation initiation factor 3 subunit DPANTHERPTHR12399EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 7coord: 5..561