SMED30013218
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30013218 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Alignments
SMED30013218 aligns in the following genomic locations:
Homology
BLAST of SMED30013218 vs. TrEMBL
Match: E3T7U0 (Secreted peptide prohormone 7 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 114.39 bits (285), Expect = 1.135e-31 Identity = 56/57 (98.25%), Postives = 56/57 (98.25%), Query Frame = -3 Query: 97 MKFIISLFVVLFLCVVMAMSEIDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSGFV 267 MKFIISLFVVLFLCVVMAMSEIDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSGF Sbjct: 1 MKFIISLFVVLFLCVVMAMSEIDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSGFA 57
BLAST of SMED30013218 vs. TrEMBL
Match: E3T7U3 (Secreted peptide prohormone 8 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 4.552e-19 Identity = 39/57 (68.42%), Postives = 46/57 (80.70%), Query Frame = -3 Query: 97 MKFIISLFVVLFLCVVMAMSEIDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSGFV 267 MK II L + L +C A+ E++KRT+GFGFNRN+ LYKRMLEKRLIDPMTFGSGF Sbjct: 1 MKIIILLAIFLAVCAFEALGEVEKRTMGFGFNRNMLLYKRMLEKRLIDPMTFGSGFA 57
BLAST of SMED30013218 vs. TrEMBL
Match: E3T7T9 (Secreted peptide prohormone 6 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 4.542e-15 Identity = 31/57 (54.39%), Postives = 43/57 (75.44%), Query Frame = -3 Query: 100 NMKFIISLFVVLFLCVVMAMSEIDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSGF 270 ++ ++S+ + + +C+ ++EIDKR G GFNRN +YKRMLEKRLIDPMTFG GF Sbjct: 3 KIRILMSVLLFMAICLAAGLAEIDKRIPGIGFNRNFAIYKRMLEKRLIDPMTFGYGF 59
BLAST of SMED30013218 vs. TrEMBL
Match: A0A193PE78 (Neuropeptide-42 (Fragment) OS=Dugesia japonica OX=6161 GN=DjNp42 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 4.647e-13 Identity = 29/42 (69.05%), Postives = 35/42 (83.33%), Query Frame = -3 Query: 103 CVVMAMSEIDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSG 228 C + A+ E++KRT+GFG N N LYKR+LEKRLIDPMTFGSG Sbjct: 2 CAMGALCELEKRTMGFGLNSNYRLYKRLLEKRLIDPMTFGSG 43
BLAST of SMED30013218 vs. TrEMBL
Match: E3CTK1 (Secreted peptide prohormone-9 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 6.275e-7 Identity = 25/56 (44.64%), Postives = 35/56 (62.50%), Query Frame = -3 Query: 100 MKFIISLFVVLFLCVVMAMSEIDKRTVGFGFNRNLHLYKRMLEKRLIDPMTFGSGF 267 M +I L +V +C+ + KR++ + N LYKR +EKRLIDP+TFGSGF Sbjct: 1 MNSLIILLIVALVCLANVCCGVQKRSLPY--NPEYELYKRFVEKRLIDPLTFGSGF 54 The following BLAST results are available for this feature:
BLAST of SMED30013218 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30013218 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30013218 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of SMED30013218 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30013218 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30013218 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 0
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30013218 ID=SMED30013218|Name=SMED30013218|organism=Schmidtea mediterranea sexual|type=transcript|length=272bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|