Chromodomain-helicase-DNA-binding protein

Overview
NameChromodomain-helicase-DNA-binding protein
Smed IDSMED30013216
Length (bp)9901
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromodomain-helicase-DNA-binding protein (SMED30013216) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromodomain-helicase-DNA-binding protein (SMED30013216) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromodomain-helicase-DNA-binding protein (SMED30013216) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromodomain-helicase-DNA-binding protein (SMED30013216) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013216

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30013216h1SMcG0013239 Contig31150uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013216h1SMcG0013239 Contig31150newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30013216h1SMcG0013239 dd_Smed_v4_7985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013216h1SMcG0013239 dd_Smed_v4_7985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30013216h1SMcG0013239 dd_Smed_v4_7985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30013216h1SMcG0013239 dd_Smed_v4_7985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013216h1SMcG0013239 dd_Smed_v4_12815_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30013216h1SMcG0013239 dd_Smed_v4_12815_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30013216h1SMcG0013239 dd_Smed_v4_12815_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013216h1SMcG0013239 dd_Smed_v4_12815_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013216h1SMcG0013239 Contig55262uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013216h1SMcG0013239 Contig55262newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013216h1SMcG0013239 Contig55510newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD9 (chromodomain helicase DNA binding protein 9 [Source:HGNC Symbol;Acc:HGNC:25701])

HSP 1 Score: 1154.04 bits (2984), Expect = 0.000e+0
Identity = 638/1437 (44.40%), Postives = 873/1437 (60.75%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVS--VSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKL--WRQKESERNKIKTNYQSLDP----ALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL SR V   +S G+        + EE+++KY+ +SY+HCEW + E ++ D     K+KR+K     + +   + +E  FNPDYVE+DRVLE             F  D    E ++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +  +W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F              N    +  LQ  +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  ES    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D   I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +  +               R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RGR+G+K                           +    ++ D ++++     + P  +  D               +++HI+   +K+L R++ LY+L  E+IG E  Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    +   +  E DK   +PT + L  RLR++I ++Q+    RQ +  +         + P    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K+++SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  212 EEDAAIVDKILSSRTVKKEISPGV------MIDTEEFFVKYKNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLEV-----------SFCEDKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRRLDRPPSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRD----------TYNPAASDFHLQ--AMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGD---------------------------EKPKLRRPCDRSNG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRGRKGKK---------------------------VKTQTSSFDIQKAEWLRKYN-PEQLLQDEG-------------YKKHIKHHCNKVLLRVRMLYYLKQEVIGNE-CQKVFDGVDASDIDVWVPE------PDHSEVPAEWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGDGQLMEGDKV-YWPTQSALTTRLRRLITAYQRTNKNRQIQQIQPTFSVPTSVMQPIYEEATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVSRTDYHILRDPELSF 1520          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD9 (chromodomain helicase DNA binding protein 9 [Source:HGNC Symbol;Acc:HGNC:25701])

HSP 1 Score: 1147.11 bits (2966), Expect = 0.000e+0
Identity = 643/1437 (44.75%), Postives = 874/1437 (60.82%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLW--RQKESERNKIKTNYQSLDP----ALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL SR V   +S G+        + EE+++KY+ +SY+HCEW + E ++ D     K+KR+K     + +   + +E  FNPDYVE+DRVLE         CE     D    E ++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +  +W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F              N    +  LQ  +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  ES    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D   I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +  +               R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RG   RKG         KK      + +I++    +E +   + EQ                          L    +++HI+   +K+L R++ LY+L  E+IG E  Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    +   +  E DK   +PT + L  RLR++I ++Q+    RQ +  +         + P    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K+++SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  686 EEDAAIVDKILSSRTVKKEISPGV------MIDTEEFFVKYKNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLEVS------FCE-----DKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRRLDRPPSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRD----------TYNPAASDFHLQ--AMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGD---------------------------EKPKLRRPCDRSNG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRG---RKG---------KKVKTQTSSFDIQK----AEWLRKYNPEQ-------------------------LLQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNE-CQKVFDGVDASDIDVWVPEP------DHSEVPAEWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGDGQLMEGDKVY-WPTQSALTTRLRRLITAYQRTNKNRQIQQIQPTFSVPTSVMQPIYEEATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVSRTDYHILRDPELSF 1994          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD9 (chromodomain helicase DNA binding protein 9 [Source:HGNC Symbol;Acc:HGNC:25701])

HSP 1 Score: 1147.11 bits (2966), Expect = 0.000e+0
Identity = 643/1437 (44.75%), Postives = 874/1437 (60.82%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLW--RQKESERNKIKTNYQSLDP----ALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL SR V   +S G+        + EE+++KY+ +SY+HCEW + E ++ D     K+KR+K     + +   + +E  FNPDYVE+DRVLE         CE     D    E ++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +  +W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F              N    +  LQ  +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  ES    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D   I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +  +               R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RG   RKG         KK      + +I++    +E +   + EQ                          L    +++HI+   +K+L R++ LY+L  E+IG E  Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    +   +  E DK   +PT + L  RLR++I ++Q+    RQ +  +         + P    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K+++SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  686 EEDAAIVDKILSSRTVKKEISPGV------MIDTEEFFVKYKNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLEVS------FCE-----DKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRRLDRPPSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRD----------TYNPAASDFHLQ--AMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGD---------------------------EKPKLRRPCDRSNG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRG---RKG---------KKVKTQTSSFDIQK----AEWLRKYNPEQ-------------------------LLQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNE-CQKVFDGVDASDIDVWVPEP------DHSEVPAEWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGDGQLMEGDKVY-WPTQSALTTRLRRLITAYQRTNKNRQIQQIQPTFSVPTSVMQPIYEEATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVSRTDYHILRDPELSF 1994          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD9 (chromodomain helicase DNA binding protein 9 [Source:HGNC Symbol;Acc:HGNC:25701])

HSP 1 Score: 1146.72 bits (2965), Expect = 0.000e+0
Identity = 643/1437 (44.75%), Postives = 874/1437 (60.82%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLW--RQKESERNKIKTNYQSLDP----ALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL SR V   +S G+        + EE+++KY+ +SY+HCEW + E ++ D     K+KR+K     + +   + +E  FNPDYVE+DRVLE         CE     D    E ++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +  +W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F              N    +  LQ  +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  ES    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D   I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +  +               R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RG   RKG         KK      + +I++    +E +   + EQ                          L    +++HI+   +K+L R++ LY+L  E+IG E  Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    +   +  E DK   +PT + L  RLR++I ++Q+    RQ +  +         + P    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K+++SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  686 EEDAAIVDKILSSRTVKKEISPGV------MIDTEEFFVKYKNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLEVS------FCE-----DKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRRLDRPPSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRD----------TYNPAASDFHLQ--AMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGD---------------------------EKPKLRRPCDRSNG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRG---RKG---------KKVKTQTSSFDIQK----AEWLRKYNPEQ-------------------------LLQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNE-CQKVFDGVDASDIDVWVPEP------DHSEVPAEWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGDGQLMEGDKVY-WPTQSALTTRLRRLITAYQRTNKNRQIQQIQPTFSVPTSVMQPIYEEATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVSRTDYHILRDPELSF 1994          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Match: CHD9 (chromodomain helicase DNA binding protein 9 [Source:HGNC Symbol;Acc:HGNC:25701])

HSP 1 Score: 1146.72 bits (2965), Expect = 0.000e+0
Identity = 643/1437 (44.75%), Postives = 874/1437 (60.82%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLW--RQKESERNKIKTNYQSLDP----ALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL SR V   +S G+        + EE+++KY+ +SY+HCEW + E ++ D     K+KR+K     + +   + +E  FNPDYVE+DRVLE         CE     D    E ++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +  +W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F              N    +  LQ  +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  ES    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D   I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +  +               R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RG   RKG         KK      + +I++    +E +   + EQ                          L    +++HI+   +K+L R++ LY+L  E+IG E  Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    +   +  E DK   +PT + L  RLR++I ++Q+    RQ +  +         + P    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K+++SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  686 EEDAAIVDKILSSRTVKKEISPGV------MIDTEEFFVKYKNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLEVS------FCE-----DKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRRLDRPPSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRD----------TYNPAASDFHLQ--AMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGD---------------------------EKPKLRRPCDRSNG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRG---RKG---------KKVKTQTSSFDIQK----AEWLRKYNPEQ-------------------------LLQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNE-CQKVFDGVDASDIDVWVPEP------DHSEVPAEWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGDGQLMEGDKVY-WPTQSALTTRLRRLITAYQRTNKNRQIQQIQPTFSVPTSVMQPIYEEATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVSRTDYHILRDPELSF 1994          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: chd-7 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O61845])

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 444/926 (47.95%), Postives = 613/926 (66.20%), Query Frame = 3
Query: 2832 EYYLKYRGFSYIHCEWKSSESV--IDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAF-SLDHESSQPHKLLF---NAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCK-LIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSD-PEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRS-DIKLDDPNFWQKWAKKAGVDENEICNS-----LIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDM--DRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLG 5561
            ++ +K++G SY+HCEWK++  +  ID    +K+KR+K  K+++  E DE  FN D+V +DRV+               DL     +   + L+KW+SL YEE+TWE  E +   KV+ + +R      +  E  +P  + WK ++  +V+KNGN LR+YQ EGV+WL +C+   +NCILADEMGLGKT+Q+I FL  +++YG  GPFL++VPLST+ NW REFE W+++N I+YHGSA +R+++Q+YE F    H  ++  K  F   +A+ITT+E ++SD+ F  K  W   +IDEAHRLKN+ CK L+ GL    ++ RVLLTGTPLQNN+ ELF+LLNFL   +F   + FL Q+G+ ++++QV  L+ +L+PMMLRRLKEDVEKSL PKEE ++EV+L+++QKK+YRAILERNF+ L KG S    P+LMN MMELRKCCNHPFLI GAEEAI+N+F            + +   DEETL   +++ +SGK+VLI KLLPKL++  HKVLIFSQMV+VLD+LE++LI   Y +ERIDG + G LRQ AIDRF+ +  ++FVFLLCT+AGGLGINLTAAD VII+DSDWNPQNDLQAQARCHRIGQ+KLV VYRLIT NTYEREMFD+ASLKLGLDKA+LQS T  +++  + LSKK++E+LLK GAYGS+MD++ +  KF EEDI+ IL  R+  I L   ++ S F+KA+F+ + N+  DI +DDP FW KWA+KA VD  +   +     LI+++PR R  T R++ N    D    +ES      +++                                 D + D S S    ++   + + FK EK L Q+GWGRW  A  K   ++ IS +++E + RT+L +  R + GDDRI  F+ +L+ P+      K   G
Sbjct: 1059 QFLIKWKGRSYVHCEWKTAAELLEIDKRVEAKIKRFKVKKMSSYIEDDED-FNSDFVIVDRVV---------------DL-ITEDDGQEFVLIKWKSLGYEEVTWEPIEMIPADKVELWRERQVIDPAKIREKQRPEPEEWKKMSTSKVWKNGNSLREYQFEGVDWLLYCYYNAQNCILADEMGLGKTVQTITFLSRIYDYGIHGPFLVVVPLSTIQNWVREFETWTDMNAIVYHGSAYAREVLQQYEVFYDKRHCGAKNWKKNFVKIDALITTFETVVSDVEFLKKIPWRVCVIDEAHRLKNRNCKLLVNGLLAFRMEHRVLLTGTPLQNNIDELFSLLNFLHPQQFDNSATFLEQFGSCQTDDQVQKLQEILKPMMLRRLKEDVEKSLGPKEETIIEVQLSDMQKKFYRAILERNFSHLCKGTSA---PSLMNVMMELRKCCNHPFLINGAEEAIMNDFR-----------LAHPDWDEETLAHKALIQASGKVVLIEKLLPKLRKDGHKVLIFSQMVKVLDLLEEFLISMSYPFERIDGNVRGDLRQAAIDRFSKENSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQKKLVKVYRLITSNTYEREMFDKASLKLGLDKAVLQSTTALKAEGTA-LSKKDVEELLKKGAYGSIMDEENESSKFNEEDIETILQRRTQTITLEAGQKGSLFAKATFNSSHNKGDDIDIDDPEFWTKWAEKAQVDVEKATATPDGRELIIEEPRKR--TKRFEENKDEGDSDGSEESGNRKRGAAEKRKRR-------------------------RGNDEDGDYSGSYRPDELATSKAEYFKVEKVLAQYGWGRW--AEIKKYGELEISEQDIEHMSRTLLLHCIREFRGDDRIRQFVFNLIRPQGIQENQKLGAG 1923          

HSP 2 Score: 59.3066 bits (142), Expect = 6.562e-8
Identity = 34/100 (34.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query: 5811 FRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDP--CFGFVN 6104
            F+RH+ R ++KL+ +I  L  L   +IG ERA +   N  +TDI   PE+       S+     W++  DKC ++G ++HG + +D I  D   CF   N
Sbjct: 1947 FQRHVHRHANKLMVKIDMLKHLEIHLIGDERALVEDFNVKWTDI-KLPEMPTI----SETFIEGWDSDCDKCFLIGCWRHGLDNFDAIRVDENLCFAEKN 2041          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 491.5 bits (1264), Expect = 4.288e-144
Identity = 298/760 (39.21%), Postives = 440/760 (57.89%), Query Frame = 3
Query: 2829 EEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLK--INNLEEQDECLF-----NPDYVEIDRVLESKQIEVNKKCENEFDLDFV-----------NKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQR--NSYAYTENSELIKPTHKNWKPITMDRVYK----NGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFN-YGFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQ---------LSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRST------VIRLNNSERNSSFSKASFSITDNRSDI 4982
            +++++K+ G+S++H  W+S  S+        L   K LK   N +++Q E        + +Y+E     E +Q    + CE    ++ V           +      YL+KW  LPY + TWE  + V P ++K Y  R  N  +  +NS +++   K  K  +M    K    + + LRDYQLEG+NW+ + W    + ILADEMGLGKTIQSI+ L  LF+ Y   GP+L++VPLST+  WQ+EF QW+  +N+++Y G   SR +I++YE F          K+  NAI+TTYE+LL D  F S   WAA ++DEAHRLKN    L + L       ++L+TGTPLQN+++EL+ LL+F+   KF C  +F + + N  + + +++L   L+P +LRR+K+DVEKSL PK E ++ V++T  QK++Y+ IL +N+  LSKGV G+ I   +N +MEL+KCCNH  L +  +                       I D+   +   ++ SSGKL+L+ KLL +LK   H+VLIFSQMV +LDIL++YL   ++  +R+DG +   LR++A+D + +     F FLL T+AGGLGINL  AD VII+DSDWNPQNDLQA +R HRIGQ K VN+YRL+T+ + E E+ +RA  KL LD  ++Q M  T    +S+           K+E+  +LK GA   L  + +  E+  E DID+IL+   T      V++ N  E  SSF  A+F+I D   DI
Sbjct:  237 QQFFVKWTGWSHLHNTWESENSLA-------LMNAKGLKKVQNYVKKQKEVEMWKRSADKEYIEF---FECEQQMAEELCEEYKKVERVVAHQTSRDRAADGSMATEYLIKWSGLPYSDCTWEDEKMVAPEQIKAYYHRIENLKSPNKNSNVLRKRPKFEKFESMPDFLKTDGESTHKLRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFHRYDLAGPYLVVVPLSTMAAWQKEFAQWAPEMNLVVYMGDVVSRDMIRQYEWFV-----GGTKKMKINAILTTYEILLKDKAFLSSIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDCWEEFETAH-NESNHKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKWILTKNYRELSKGVKGS-INGFVNLVMELKKCCNHASLTRQYDH----------------------IYDDAQGRLQQLLKSSGKLILLDKLLCRLKDKGHRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKLVLDHLVIQRMDTTGKTVLSKNATASGSVPFDKQELSAILKFGAV-ELFKEKEGEEQEPEVDIDRILMGAETREAEEEVMKEN--ELLSSFKYANFAI-DEEKDI 953          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 447.588 bits (1150), Expect = 1.169e-127
Identity = 297/861 (34.49%), Postives = 442/861 (51.34%), Query Frame = 3
Query: 2832 EYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRY-KNLKINNLEEQDECLFN---------------------PDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSE----------------------DVDPAKVKEYL--QRNSYAYTENSELIKPTHKNWKPITM--------DRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGF-KGPFLIIVPLSTLGNWQREFEQW-SNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHK---------LLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFL-IKGAEEA--ILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEK-FVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDK-----DGE-----KFCEEDID------KILLSRSTVIRLNNSERN--------SSFSKASFSITDN-------------RSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTN 5096
            E+++K++  +Y  CEW  SE+++D  F + ++ Y + +   N    +E   +                     P++++I R++                L +   +    YLVKW+ L YE  TWE+ +                      D  P  V++ +  QR +       + +    K  + I +        D + + G  L  YQLEG+NWL  CW    + ILADEMGLGKT+QS+ FL  L   G  KGPFLI  PLST+ NW+RE E W  +  ++ Y G  +SR +I+++E   +D       K         L F+ ++T+YE +  D    S   WAA ++DEAHRLKN +    + LR  ++Q+RVLLTGTPLQNN++ELF+LLNFL   +F     F +++  +  E+Q+  L  LL P MLRRLK DV   +  K+E++V VEL+ +QKKYY+ IL RNF  L+    G  + +L+N +MEL+KCCNHP+L +K   EA  + N    G+                      +++ ++GK VL+ K+L KLK   H+VLIFSQM  +LDILED+   E Y+YERIDG I G  RQ+AIDR+ +   K FVFLL T+AGGLGINL  AD VIIYDSDWNP ND+QA +R HR+GQ+  V +YR +T+ + E  +   A  K+ L   ++++     +K    +SK E++D+L+ G      +++      DGE     K  E++I         LL R+      + E+         SSF  A+++  +              +   +  DPN+W+K  K     + E     +    R+RRQ N
Sbjct:  426 EFFVKWKYLAYWQCEW-LSETLMDVYFTALVRMYWRKVDSENPPIFEESTLSRHHSDHDPYKLRERFYQYGVKPEWMQIHRIINH--------------LSYAKSQQD--YLVKWKELSYEHATWERDDTDIANYEDAIIKYWHHRERMLNDEVPRNVQKMIAKQREAKGLGPKEDEVTSRRKKREKIDILKKYEVQPDFISETGGNLHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIREHEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQYRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEFSEISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDALNVKNGGTQM-SLINIIMELKKCCNHPYLFMKACLEAPKLKNGMYEGS----------------------ALIKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVRAGL--GAKDGKSMSKTELDDVLRWGTEELFKEEEAPVEGADGEGTSSKKPNEQEIVWDDAAVDFLLDRNKEEEGQDGEKKEHWTNEYLSSFKVATYNTKEADDADDDEDETEVIKEGTEEQDPNYWEKLLKHHYEQDQETELQKLGKGKRVRRQVN 1244          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 447.973 bits (1151), Expect = 1.579e-127
Identity = 253/616 (41.07%), Postives = 357/616 (57.95%), Query Frame = 3
Query: 3096 YLVKWRSLPYEEITWEKSE----DVDPAKVKEYLQRNSYA---YTENSELIKPTHKNWK-----------------------PITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGF-KGPFLIIVPLSTLGNWQREFEQW-SNLNIILYHGSAKSRKLIQKYE-AFSLDHESSQP--------HKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQS-MTYTESKPISQLSKKEIEDLLKLG 4814
            YLVKW+ L Y++ TWE+ +    + + A +K +  R S       +N + +   H+  K                        +  D V + G  L  YQLEG+NWL  CW    + ILADEMGLGKT+QS+ FL  L   G  KGPFLI  PLST+ NW+RE EQW  +  ++ Y G   +R +++++E +F      S P          + F+ ++T+YE +  D    S  +W A ++DEAHRLKN +    + L    + +RVLLTGTPLQNN++ELF+LLNFL   +F     F +++  +  E+Q+  L  LL P MLRRLK DV   +  K E++V VEL+ +QKK+Y+ IL RNF  L+    G  + +LMN +MEL+KCCNHP+L   AE   L        M   T  I+N                SGK VL+ K+L KLK   H+VLIFSQM R+LDI+ED   YE Y+YERIDG I G +RQ+AIDR+ +   ++F+FLL T+AGGLGINL  AD VIIYDSDWNP ND+QA +R HR+GQ+  V +YR +T+ + E ++   A  K+ L+  ++++ +   E K    +SK E++D+L+ G
Sbjct:  507 YLVKWKELSYDQATWERDDSNIANYEEAIIKYWQHRESKLNEDIPKNVQKMIAKHREAKGLPPKEDEKKKKKREKIDIRKKYEVQPDYVTETGGKLHPYQLEGLNWLRHCWSNGTDAILADEMGLGKTVQSLTFLYSLMKEGHCKGPFLIAAPLSTIINWEREAEQWCPDFYVVTYVGLRDARVVLREHEFSFVEGAVRSGPKASKMKTTENMKFHVLLTSYETINMDKTILSSIEWGALVVDEAHRLKNNQSLFFKNLNEYTIHYRVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFNEISKEDQIEKLHNLLGPHMLRRLKADVLTGMPSKSELIVRVELSAMQKKWYKNILTRNFDALNVKNGGTQM-SLMNVLMELKKCCNHPYLFVKAE---LEAPKEKNGMYEGTALIKN----------------SGKFVLLQKMLRKLKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKKSVEEKITSVAKKKMLLNHLVVRAGLGGKEGK---TMSKTELDDVLRWG 1099          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 374.015 bits (959), Expect = 2.135e-108
Identity = 217/520 (41.73%), Postives = 310/520 (59.62%), Query Frame = 3
Query: 3276 KNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKG-PFLIIVPLSTLGNWQREFEQW-SNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGN---LRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGA 4817
            +NG  +RDYQ+ G+NWL        N ILADEMGLGKT+Q+I+ +  + +Y  K  P L+IVP STL NW  EF++W  ++N ++  G   +R  + +        +   P K  F+   TTYE++L       K  W   IIDEAHR+KN++ KL E +R L+ + R+L+TGTPLQNN+ EL+ LLNFL    F    DF S + N     + + V  L  +LQP +LRR+K DVEKSL PK+E+ V V L+ +Q+++Y  +L ++   ++ G        LMN +M LRKC NHP+L  GAE                  F  ++           +V +SGK+V++ KLL K K+   +VLIFSQ  R+LD+LED+  +  Y+Y R+DG      R  AI+ + + D +KF+F+L T+AGGLGINL  ADVVIIYDSDWNPQ+DLQA  R HRIGQ+K V V+RLIT NT +  + ++A  KL LD  ++Q    +E++    L K ++  +++ GA
Sbjct:  128 ENGE-MRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLR--------DVILPQK--FDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDFDSWFSNDAMSGNTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVLMKDIDIIN-GAGKVEKARLMNILMHLRKCVNHPYLFDGAEPG--------------PPFTTDQ----------HLVDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQGRMSEAQ--KTLGKGDMISMIRHGA 609          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: kis (gene:FBgn0266557 transcript:FBtr0308254)

HSP 1 Score: 911.753 bits (2355), Expect = 0.000e+0
Identity = 443/776 (57.09%), Postives = 569/776 (73.32%), Query Frame = 3
Query: 2823 EVEEYYLKYRGFSYIHCEWKSSESVI--DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAY-TENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHK--LLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFY-SMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPIS--QLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVD----ENEICNSLIMDKPRLRRQTNRY 5102
            +VEEY++KYR FSY+HCEW++ E ++  D    +K++R++   + ++N  E  ++  FN D+ E+DRVL+                D  + ET  +YLVKW+SLPYE+ TWE  EDVD  K+++YL+ N     +E     +P  + WK +    VYK GN LR YQLEG+NWL F W    NCILADEMGLGKTIQS+ F+  ++ YG +GPFL+I PLST+ NWQREFE W+++N+++YHGS  S+++IQ YE +    ES +  K  + FN +ITT+E++++D +    F W   +IDEAHRLKN+ CKL+EGLR L+L+ RVLL+GTPLQNN+ ELF+LLNFLE S+F  + +F+S++G+LR+EE+V  L+ LL+PMMLRRLK+DVEKSLAPKEE ++EVELTNIQKKYYR ILE+NF+FL KG +  NIPNLMNTMMELRKCC HP+L+ GAEE I  +F S                 E+   +Y +++ S+GK+VLI KLLPKLK   H+VLIFSQMVR LDILEDYL+Y KY +ERIDGRI G LRQEAIDR++    ++FVFLLCTKAGGLGINLTAAD VIIYDSDWNPQNDLQAQARCHRIGQ+K+V +YRL+ RNTYEREMFD+AS+KLGLDKA+LQSM    SK  +  QLSKKEIEDLLK GAYG++MDDD  G+KFCEEDID IL  R+ VI +  SE+ S+FSKASF+ + NRSDI +DDP+FW KWAKK  +D    E +    L++ +PR R Q  RY
Sbjct: 1878 DVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFNQDFTEVDRVLDMS-----------VHTDETSGETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAPLSTIPNWQREFEGWTDMNVVVYHGSVTSKQMIQDYEYY-YKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKSQH--------------GEDPESYYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVITM-ESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRY 2626          

HSP 2 Score: 95.5153 bits (236), Expect = 9.975e-19
Identity = 53/190 (27.89%), Postives = 92/190 (48.42%), Query Frame = 3
Query: 6459 KWSRREETEFYRAINSFGIEKHSETDEII---------WTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEV 7001
            KW+RREE EF R +  +G++ H  T             WT F+   +L RKS+E+LT+Y+K F  MC++      L   +     +     +   + ++    +     E+  +P +E+R+KLC    D P WW  G HD  ++  + K+G  R+E  I +D N  F ++    +R+ +    +++ LE 
Sbjct: 3173 KWNRREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSPDWTKFKQMAHLERKSDETLTDYYKVFVAMCKRQAG-LKLSESERGLEGIIEEIEKEHAKLILDRLEVLAKLREVARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETFIFNDPNFSFGESEKRFIRELEAQIQRTIKLEA 3361          

HSP 3 Score: 83.1889 bits (204), Expect = 5.079e-15
Identity = 62/211 (29.38%), Postives = 99/211 (46.92%), Query Frame = 3
Query: 5322 RYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMK---RHLGYSAPVARGRRGRKGLEEMISAITKKDMIVP-ENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGS-----EFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNT 5927
            + + FK EK LL FGWGRW   LE   FK      ++E   R IL Y  + Y GD++I +FI DL+ P  D    K    H G    V RGR G K  +E     T         N      +  S  ++  D++   +  +       +  + ++ S     +  A +   +++H+ R ++K+L R++ LY++ HE+IG +  Q I +NT
Sbjct: 2696 KSECFKVEKGLLSFGWGRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSNKESTGVSTPAPGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRHANKVLLRVRMLYYIQHEVIG-DFVQQIKDNT 2905          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: kis (gene:FBgn0266557 transcript:FBtr0299837)

HSP 1 Score: 911.368 bits (2354), Expect = 0.000e+0
Identity = 443/775 (57.16%), Postives = 569/775 (73.42%), Query Frame = 3
Query: 2823 EVEEYYLKYRGFSYIHCEWKSSESVI--DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAY-TENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHK--LLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPIS--QLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVD----ENEICNSLIMDKPRLRRQTNRY 5102
            +VEEY++KYR FSY+HCEW++ E ++  D    +K++R++   + ++N  E  ++  FN D+ E+DRVL+                D  + ET  +YLVKW+SLPYE+ TWE  EDVD  K+++YL+ N     +E     +P  + WK +    VYK GN LR YQLEG+NWL F W    NCILADEMGLGKTIQS+ F+  ++ YG +GPFL+I PLST+ NWQREFE W+++N+++YHGS  S+++IQ YE +    ES +  K  + FN +ITT+E++++D +    F W   +IDEAHRLKN+ CKL+EGLR L+L+ RVLL+GTPLQNN+ ELF+LLNFLE S+F  + +F+S++G+LR+EE+V  L+ LL+PMMLRRLK+DVEKSLAPKEE ++EVELTNIQKKYYR ILE+NF+FL KG +  NIPNLMNTMMELRKCC HP+L+ GAEE I  +F S                D E+  + +++ S+GK+VLI KLLPKLK   H+VLIFSQMVR LDILEDYL+Y KY +ERIDGRI G LRQEAIDR++    ++FVFLLCTKAGGLGINLTAAD VIIYDSDWNPQNDLQAQARCHRIGQ+K+V +YRL+ RNTYEREMFD+AS+KLGLDKA+LQSM    SK  +  QLSKKEIEDLLK GAYG++MDDD  G+KFCEEDID IL  R+ VI +  SE+ S+FSKASF+ + NRSDI +DDP+FW KWAKK  +D    E +    L++ +PR R Q  RY
Sbjct: 1878 DVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFNQDFTEVDRVLDMS-----------VHTDETSGETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAPLSTIPNWQREFEGWTDMNVVVYHGSVTSKQMIQDYEYY-YKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKS------------QHGEDPESY-YKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVITM-ESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRY 2626          

HSP 2 Score: 115.546 bits (288), Expect = 1.013e-24
Identity = 89/298 (29.87%), Postives = 139/298 (46.64%), Query Frame = 3
Query: 5322 RYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMK---RHLGYSAPVARGRRGRKGLEEMISAITKKDMIVP-ENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGS-----EFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLP-SWWNTT-VDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWF----SGNNYPVCS----DDEKNMK 6158
            + + FK EK LL FGWGRW   LE   FK      ++E   R IL Y  + Y GD++I +FI DL+ P  D    K    H G    V RGR G K  +E     T         N      +  S  ++  D++   +  +       +  + ++ S     +  A +   +++H+ R ++K+L R++ LY++ HE+IG +  Q I +NT  +++P  P          D +P SWWN    DK L++G +KHG E Y  +  DP   FV       +G++  V S    +D+ N K
Sbjct: 2696 KSECFKVEKGLLSFGWGRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSNKESTGVSTPAPGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRHANKVLLRVRMLYYIQHEVIG-DFVQQIKDNTPISELPIRPPPT------PDQVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNLCFVTHVGAGAAGDDLAVTSLPINEDDANSK 2986          

HSP 3 Score: 95.5153 bits (236), Expect = 1.136e-18
Identity = 57/191 (29.84%), Postives = 96/191 (50.26%), Query Frame = 3
Query: 6459 KWSRREETEFYRAINSFGIEKHSETD---------EIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERAN-RCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEV 7001
            KW+RREE EF R +  +G++ H  T             WT F+   +L RKS+E+LT+Y+K F  MC++  Q    L +    LE      E+ + + ++    +     E+  +P +E+R+KLC    D P WW  G HD  ++  + K+G  R+E  I +D N  F ++    +R+ +    +++ LE 
Sbjct: 3438 KWNRREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSPDWTKFKQMAHLERKSDETLTDYYKVFVAMCKR--QAGLKLSESERGLEGIIEEIEKEHAKLILDRLEVLAKLREVARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETFIFNDPNFSFGESEKRFIRELEAQIQRTIKLEA 3626          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: kis (gene:FBgn0266557 transcript:FBtr0078144)

HSP 1 Score: 910.598 bits (2352), Expect = 0.000e+0
Identity = 443/776 (57.09%), Postives = 569/776 (73.32%), Query Frame = 3
Query: 2823 EVEEYYLKYRGFSYIHCEWKSSESVI--DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAY-TENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHK--LLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFY-SMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPIS--QLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVD----ENEICNSLIMDKPRLRRQTNRY 5102
            +VEEY++KYR FSY+HCEW++ E ++  D    +K++R++   + ++N  E  ++  FN D+ E+DRVL+                D  + ET  +YLVKW+SLPYE+ TWE  EDVD  K+++YL+ N     +E     +P  + WK +    VYK GN LR YQLEG+NWL F W    NCILADEMGLGKTIQS+ F+  ++ YG +GPFL+I PLST+ NWQREFE W+++N+++YHGS  S+++IQ YE +    ES +  K  + FN +ITT+E++++D +    F W   +IDEAHRLKN+ CKL+EGLR L+L+ RVLL+GTPLQNN+ ELF+LLNFLE S+F  + +F+S++G+LR+EE+V  L+ LL+PMMLRRLK+DVEKSLAPKEE ++EVELTNIQKKYYR ILE+NF+FL KG +  NIPNLMNTMMELRKCC HP+L+ GAEE I  +F S                 E+   +Y +++ S+GK+VLI KLLPKLK   H+VLIFSQMVR LDILEDYL+Y KY +ERIDGRI G LRQEAIDR++    ++FVFLLCTKAGGLGINLTAAD VIIYDSDWNPQNDLQAQARCHRIGQ+K+V +YRL+ RNTYEREMFD+AS+KLGLDKA+LQSM    SK  +  QLSKKEIEDLLK GAYG++MDDD  G+KFCEEDID IL  R+ VI +  SE+ S+FSKASF+ + NRSDI +DDP+FW KWAKK  +D    E +    L++ +PR R Q  RY
Sbjct: 1878 DVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFNQDFTEVDRVLDMS-----------VHTDETSGETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAPLSTIPNWQREFEGWTDMNVVVYHGSVTSKQMIQDYEYY-YKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKSQH--------------GEDPESYYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVITM-ESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRY 2626          

HSP 2 Score: 122.479 bits (306), Expect = 7.445e-27
Identity = 109/398 (27.39%), Postives = 178/398 (44.72%), Query Frame = 3
Query: 5322 RYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMK---RHLGYSAPVARGRRGRKGLEEMISAITKKDMIVP-ENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGS-----EFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLP-SWWNTT-VDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWF----SGNNYPVCS----DDEKNMKK--------------------------NKN-------PSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKE 6359
            + + FK EK LL FGWGRW   LE   FK      ++E   R IL Y  + Y GD++I +FI DL+ P  D    K    H G    V RGR G K  +E     T         N      +  S  ++  D++   +  +       +  + ++ S     +  A +   +++H+ R ++K+L R++ LY++ HE+IG +  Q I +NT  +++P  P          D +P SWWN    DK L++G +KHG E Y  +  DP   FV       +G++  V S    +D+ N K                           NK+       PS + LD +E+  +A S   T    +D  +       +P+  +LN RLR++I ++Q+ ++++E
Sbjct: 2696 KSECFKVEKGLLSFGWGRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSNKESTGVSTPAPGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRHANKVLLRVRMLYYIQHEVIG-DFVQQIKDNTPISELPIRPPPT------PDQVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNLCFVTHVGAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTKDSDSTKLTGGDNKDSLLDPERPSSSGLDEEES--VAGSYPPTVAAVEDATTM------WPSMQDLNTRLRRVITAYQRNYKKEE 3078          

HSP 3 Score: 95.5153 bits (236), Expect = 1.077e-18
Identity = 53/190 (27.89%), Postives = 92/190 (48.42%), Query Frame = 3
Query: 6459 KWSRREETEFYRAINSFGIEKHSETD---------EIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEV 7001
            KW+RREE EF R +  +G++ H  T             WT F+   +L RKS+E+LT+Y+K F  MC++      L   +     +     +   + ++    +     E+  +P +E+R+KLC    D P WW  G HD  ++  + K+G  R+E  I +D N  F ++    +R+ +    +++ LE 
Sbjct: 3243 KWNRREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSPDWTKFKQMAHLERKSDETLTDYYKVFVAMCKRQAG-LKLSESERGLEGIIEEIEKEHAKLILDRLEVLAKLREVARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETFIFNDPNFSFGESEKRFIRELEAQIQRTIKLEA 3431          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: kis (gene:FBgn0266557 transcript:FBtr0308255)

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 443/776 (57.09%), Postives = 569/776 (73.32%), Query Frame = 3
Query: 2823 EVEEYYLKYRGFSYIHCEWKSSESVI--DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAY-TENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHK--LLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFY-SMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPIS--QLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVD----ENEICNSLIMDKPRLRRQTNRY 5102
            +VEEY++KYR FSY+HCEW++ E ++  D    +K++R++   + ++N  E  ++  FN D+ E+DRVL+                D  + ET  +YLVKW+SLPYE+ TWE  EDVD  K+++YL+ N     +E     +P  + WK +    VYK GN LR YQLEG+NWL F W    NCILADEMGLGKTIQS+ F+  ++ YG +GPFL+I PLST+ NWQREFE W+++N+++YHGS  S+++IQ YE +    ES +  K  + FN +ITT+E++++D +    F W   +IDEAHRLKN+ CKL+EGLR L+L+ RVLL+GTPLQNN+ ELF+LLNFLE S+F  + +F+S++G+LR+EE+V  L+ LL+PMMLRRLK+DVEKSLAPKEE ++EVELTNIQKKYYR ILE+NF+FL KG +  NIPNLMNTMMELRKCC HP+L+ GAEE I  +F S                 E+   +Y +++ S+GK+VLI KLLPKLK   H+VLIFSQMVR LDILEDYL+Y KY +ERIDGRI G LRQEAIDR++    ++FVFLLCTKAGGLGINLTAAD VIIYDSDWNPQNDLQAQARCHRIGQ+K+V +YRL+ RNTYEREMFD+AS+KLGLDKA+LQSM    SK  +  QLSKKEIEDLLK GAYG++MDDD  G+KFCEEDID IL  R+ VI +  SE+ S+FSKASF+ + NRSDI +DDP+FW KWAKK  +D    E +    L++ +PR R Q  RY
Sbjct: 1878 DVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFNQDFTEVDRVLDMS-----------VHTDETSGETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAPLSTIPNWQREFEGWTDMNVVVYHGSVTSKQMIQDYEYY-YKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKSQH--------------GEDPESYYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVITM-ESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRY 2626          

HSP 2 Score: 196.438 bits (498), Expect = 3.025e-49
Identity = 163/621 (26.25%), Postives = 275/621 (44.28%), Query Frame = 3
Query: 5322 RYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMK---RHLGYSAPVARGRRGRKGLEEMISAITKKDMIVP-ENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGS-----EFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLP-SWWNTT-VDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWF----SGNNYPVCS----DDEKNMKK--------------------------NKN-------PSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETD---------EIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEV 7001
            + + FK EK LL FGWGRW   LE   FK      ++E   R IL Y  + Y GD++I +FI DL+ P  D    K    H G    V RGR G K  +E     T         N      +  S  ++  D++   +  +       +  + ++ S     +  A +   +++H+ R ++K+L R++ LY++ HE+IG +  Q I +NT  +++P  P          D +P SWWN    DK L++G +KHG E Y  +  DP   FV       +G++  V S    +D+ N K                           NK+       PS + LD +E+  +A S   T    +D  +       +P+  +LN RLR++I ++Q+ ++++E +  +     +      L  +            KW+RREE EF R +  +G++ H  T             WT F+   +L RKS+E+LT+Y+K F  MC++      L   +     +     +   + ++    +     E+  +P +E+R+KLC    D P WW  G HD  ++  + K+G  R+E  I +D N  F ++    +R+ +    +++ LE 
Sbjct: 2696 KSECFKVEKGLLSFGWGRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSNKESTGVSTPAPGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRHANKVLLRVRMLYYIQHEVIG-DFVQQIKDNTPISELPIRPPPT------PDQVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNLCFVTHVGAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTKDSDSTKLTGGDNKDSLLDPERPSSSGLDEEES--VAGSYPPTVAAVEDATTM------WPSMQDLNTRLRRVITAYQRNYKKEELKLQQKAKKMERQGKMELAAKERESQRLQLIPKKWNRREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSPDWTKFKQMAHLERKSDETLTDYYKVFVAMCKRQAG-LKLSESERGLEGIIEEIEKEHAKLILDRLEVLAKLREVARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETFIFNDPNFSFGESEKRFIRELEAQIQRTIKLEA 3300          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Match: kis (gene:FBgn0266557 transcript:FBtr0308253)

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 443/776 (57.09%), Postives = 569/776 (73.32%), Query Frame = 3
Query: 2823 EVEEYYLKYRGFSYIHCEWKSSESVI--DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAY-TENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHK--LLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFY-SMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPIS--QLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVD----ENEICNSLIMDKPRLRRQTNRY 5102
            +VEEY++KYR FSY+HCEW++ E ++  D    +K++R++   + ++N  E  ++  FN D+ E+DRVL+                D  + ET  +YLVKW+SLPYE+ TWE  EDVD  K+++YL+ N     +E     +P  + WK +    VYK GN LR YQLEG+NWL F W    NCILADEMGLGKTIQS+ F+  ++ YG +GPFL+I PLST+ NWQREFE W+++N+++YHGS  S+++IQ YE +    ES +  K  + FN +ITT+E++++D +    F W   +IDEAHRLKN+ CKL+EGLR L+L+ RVLL+GTPLQNN+ ELF+LLNFLE S+F  + +F+S++G+LR+EE+V  L+ LL+PMMLRRLK+DVEKSLAPKEE ++EVELTNIQKKYYR ILE+NF+FL KG +  NIPNLMNTMMELRKCC HP+L+ GAEE I  +F S                 E+   +Y +++ S+GK+VLI KLLPKLK   H+VLIFSQMVR LDILEDYL+Y KY +ERIDGRI G LRQEAIDR++    ++FVFLLCTKAGGLGINLTAAD VIIYDSDWNPQNDLQAQARCHRIGQ+K+V +YRL+ RNTYEREMFD+AS+KLGLDKA+LQSM    SK  +  QLSKKEIEDLLK GAYG++MDDD  G+KFCEEDID IL  R+ VI +  SE+ S+FSKASF+ + NRSDI +DDP+FW KWAKK  +D    E +    L++ +PR R Q  RY
Sbjct: 1878 DVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFNQDFTEVDRVLDMS-----------VHTDETSGETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAPLSTIPNWQREFEGWTDMNVVVYHGSVTSKQMIQDYEYY-YKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKSQH--------------GEDPESYYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVITM-ESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRY 2626          

HSP 2 Score: 116.701 bits (291), Expect = 3.852e-25
Identity = 115/433 (26.56%), Postives = 181/433 (41.80%), Query Frame = 3
Query: 5322 RYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMK---RHLGYSAPVARGR--RGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPV----SVNGDNSDNGS-------------------------EFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDS----------DYLP-SWWNTT-VDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWF----SGNNYPVCS----DDEKNMKK--------------------------NKN-------PSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKE 6359
            + + FK EK LL FGWGRW   LE   FK      ++E   R IL Y  + Y GD++I +FI DL+ P  D    K    H G    V RGR  +GR G                     K N E +          S   +  +TP     +++G + D+G                          +  A +   +++H+ R ++K+L R++ LY++ HE+IG +  Q I +NT  +      +L L   L+S          D +P SWWN    DK L++G +KHG E Y  +  DP   FV       +G++  V S    +D+ N K                           NK+       PS + LD +E+  +A S   T    +D  +       +P+  +LN RLR++I ++Q+ ++++E
Sbjct: 2696 KSECFKVEKGLLSFGWGRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNAKGRNG--------------------GKSNKESTGVSTPAPGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRHANKVLLRVRMLYYIQHEVIG-DFVQQIKDNTPISSTRAKQQLALNLNLESELPIRPPPTPDQVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNLCFVTHVGAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTKDSDSTKLTGGDNKDSLLDPERPSSSGLDEEES--VAGSYPPTVAAVEDATTM------WPSMQDLNTRLRRVITAYQRNYKKEE 3099          

HSP 3 Score: 95.5153 bits (236), Expect = 1.095e-18
Identity = 53/190 (27.89%), Postives = 92/190 (48.42%), Query Frame = 3
Query: 6459 KWSRREETEFYRAINSFGIEKHSETD---------EIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEV 7001
            KW+RREE EF R +  +G++ H  T             WT F+   +L RKS+E+LT+Y+K F  MC++      L   +     +     +   + ++    +     E+  +P +E+R+KLC    D P WW  G HD  ++  + K+G  R+E  I +D N  F ++    +R+ +    +++ LE 
Sbjct: 3264 KWNRREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSPDWTKFKQMAHLERKSDETLTDYYKVFVAMCKRQAG-LKLSESERGLEGIIEEIEKEHAKLILDRLEVLAKLREVARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETFIFNDPNFSFGESEKRFIRELEAQIQRTIKLEA 3452          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:ZFIN;Acc:ZDB-GENE-030131-497])

HSP 1 Score: 1141.72 bits (2952), Expect = 0.000e+0
Identity = 629/1446 (43.50%), Postives = 873/1446 (60.37%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVS--VSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPIS------QLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMIS-AITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLD------SQETMEIAESTDTTQLNSKDKNSEIDKKDDF-PTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPAL--LTPEMNSHMNND-----GKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNL 6926
            E    +V KI+ SR+V   VS G+        E+EEY++KY+ +SY+HCEW + + +  D     K+KR+K     K +   + +E  FNPDYVE+DRVLE    E           D  + E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ ++   A    + + +P   +WK +   R Y N N LRDYQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E++  G KGPFLII PLST+ NW+REF  W++LN+I+YHGS  SR+++Q+YE +  D +         F A+ITT+E++L      +   W   IIDEAHRLKNK CKL+EG +++ L+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E+ F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FL+KG    N+PNL+NTMMELRKCCNHP+LIKGAEE I+ +F        +   +Q            +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFDRASLKLGLDKA+LQSM+  ++          QLSKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  R S+F+KASF  + NR+DI LDDPNFW KWAKKA +D + +   NSL++D PR+R+QT  +        E+S  ES+G                              P    P +  ++              R + F+ EK LL +GWGRW+  L    FK  +S +++E +CR +L Y   HY GDD+I SF+ DL+ P  D  T  ++ HLG S PV RGR+G+K   +  S  I K + I       K N E                             SD+G          +++H++   +K+L R++ LY+L  E+IG +  Q +L   + ++I    E+++   LD   +P+ WW+   DKCL+LG++KHG+EKY+ I  DP   F++               GN++     D  + +    P+  K D      S   + I ++ +   +      +       + P+ + L  RLR++I + Q+  + ++    +I    Q++ PAL  + P +    N        +  +W+RREE +FYR +++FG+    +     WT FR    L +K++ESL +Y  AF  MC+++C R P +  D  +++L ++ I+ ERA+R L ++ ++ KIR +++ HP++ + + LC+   D P WW  G HD  +L G +K+G +RT+  I+ D  L
Sbjct:  238 EEDAAVVDKIMASRVVKKEVSPGV------LVEIEEYFVKYKNYSYLHCEWATEQQLEKDKRIQQKIKRFKIKQAQKAHFFADIEEDPFNPDYVEVDRVLEVSYCE-----------DKDSGEPVVYYLVKWCSLPYEDSTWELMEDVDQTKIEEF-KKLQAAKPHTNRMERPPASHWKKLEKSRKYCNENSLRDYQLEGVNWLLFNWYNRRNCILADEMGLGKTIQSITFLEEIYRTGIKGPFLIIAPLSTIANWEREFRTWTHLNVIVYHGSVVSRQMLQQYEMYCRDSQGRVIRGAYRFQAVITTFEMILGGCPELNAIDWRCVIIDEAHRLKNKNCKLLEGFKLMSLEHKVLLTGTPLQNTVEELFSLLHFLEPTRFPSENTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLAKGAGQANVPNLLNTMMELRKCCNHPYLIKGAEEKIMEDFKEVYSPAAVDFHLQ------------AMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLITRNSYEREMFDRASLKLGLDKAVLQSMSGRDNSLAGGGQMQQQLSKKEIEDLLRRGAYGAIMDEEDEGNKFCEEDIDQILQRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWDKWAKKAEIDMDTVNGRNSLVIDTPRVRKQTRPFSSTKDELAELSEGESSGD---------------------------DKPKLRRPHDRLNS------------YGRTECFRVEKNLLVYGWGRWKDILAHGRFKRQLSERDVEWICRALLSYCLVHYRGDDKIKSFMWDLIAPTEDGRTKELQNHLGLSTPVPRGRKGKKMKTQSSSFDIQKAEWIR------KHNPEHML--------------------------SDDG----------YKKHLKHHCNKVLLRVRMLYYLKQELIGAQ-CQQVLEGIDASEI----EIRV-PELDRSEMPAMWWDMLSDKCLLLGVYKHGYEKYNTIRADPKLCFLDRVGRPDEKAIAAEQRGNDF--IDGDVDDPEYKPAPALMKDDMEDDASSPGDLVITDAGEGGSMLDGGGGTLSSGSGVYWPSPSALTARLRRLITASQRFTKSRQIL--QIHQTQQAMTPALYPMPPTLTDTFNPKIAAKIERQQRWTRREEADFYRVVSTFGVVFDPDLGRFDWTKFRAMARLHKKTDESLHKYLCAFIAMCRRVC-RLPAIEGDMVDSSLAIQPITEERASRTLYRVELLRKIREQVLRHPQLYEHLALCQPGPDLPVWWETGSHDRDLLLGAAKHGVSRTDYHILRDPEL 1561          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:ZFIN;Acc:ZDB-GENE-030131-497])

HSP 1 Score: 1141.72 bits (2952), Expect = 0.000e+0
Identity = 629/1446 (43.50%), Postives = 873/1446 (60.37%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVS--VSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPIS------QLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMIS-AITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLD------SQETMEIAESTDTTQLNSKDKNSEIDKKDDF-PTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPAL--LTPEMNSHMNND-----GKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNL 6926
            E    +V KI+ SR+V   VS G+        E+EEY++KY+ +SY+HCEW + + +  D     K+KR+K     K +   + +E  FNPDYVE+DRVLE    E           D  + E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ ++   A    + + +P   +WK +   R Y N N LRDYQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E++  G KGPFLII PLST+ NW+REF  W++LN+I+YHGS  SR+++Q+YE +  D +         F A+ITT+E++L      +   W   IIDEAHRLKNK CKL+EG +++ L+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E+ F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FL+KG    N+PNL+NTMMELRKCCNHP+LIKGAEE I+ +F        +   +Q            +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFDRASLKLGLDKA+LQSM+  ++          QLSKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  R S+F+KASF  + NR+DI LDDPNFW KWAKKA +D + +   NSL++D PR+R+QT  +        E+S  ES+G                              P    P +  ++              R + F+ EK LL +GWGRW+  L    FK  +S +++E +CR +L Y   HY GDD+I SF+ DL+ P  D  T  ++ HLG S PV RGR+G+K   +  S  I K + I       K N E                             SD+G          +++H++   +K+L R++ LY+L  E+IG +  Q +L   + ++I    E+++   LD   +P+ WW+   DKCL+LG++KHG+EKY+ I  DP   F++               GN++     D  + +    P+  K D      S   + I ++ +   +      +       + P+ + L  RLR++I + Q+  + ++    +I    Q++ PAL  + P +    N        +  +W+RREE +FYR +++FG+    +     WT FR    L +K++ESL +Y  AF  MC+++C R P +  D  +++L ++ I+ ERA+R L ++ ++ KIR +++ HP++ + + LC+   D P WW  G HD  +L G +K+G +RT+  I+ D  L
Sbjct:  234 EEDAAVVDKIMASRVVKKEVSPGV------LVEIEEYFVKYKNYSYLHCEWATEQQLEKDKRIQQKIKRFKIKQAQKAHFFADIEEDPFNPDYVEVDRVLEVSYCE-----------DKDSGEPVVYYLVKWCSLPYEDSTWELMEDVDQTKIEEF-KKLQAAKPHTNRMERPPASHWKKLEKSRKYCNENSLRDYQLEGVNWLLFNWYNRRNCILADEMGLGKTIQSITFLEEIYRTGIKGPFLIIAPLSTIANWEREFRTWTHLNVIVYHGSVVSRQMLQQYEMYCRDSQGRVIRGAYRFQAVITTFEMILGGCPELNAIDWRCVIIDEAHRLKNKNCKLLEGFKLMSLEHKVLLTGTPLQNTVEELFSLLHFLEPTRFPSENTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLAKGAGQANVPNLLNTMMELRKCCNHPYLIKGAEEKIMEDFKEVYSPAAVDFHLQ------------AMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLITRNSYEREMFDRASLKLGLDKAVLQSMSGRDNSLAGGGQMQQQLSKKEIEDLLRRGAYGAIMDEEDEGNKFCEEDIDQILQRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWDKWAKKAEIDMDTVNGRNSLVIDTPRVRKQTRPFSSTKDELAELSEGESSGD---------------------------DKPKLRRPHDRLNS------------YGRTECFRVEKNLLVYGWGRWKDILAHGRFKRQLSERDVEWICRALLSYCLVHYRGDDKIKSFMWDLIAPTEDGRTKELQNHLGLSTPVPRGRKGKKMKTQSSSFDIQKAEWIR------KHNPEHML--------------------------SDDG----------YKKHLKHHCNKVLLRVRMLYYLKQELIGAQ-CQQVLEGIDASEI----EIRV-PELDRSEMPAMWWDMLSDKCLLLGVYKHGYEKYNTIRADPKLCFLDRVGRPDEKAIAAEQRGNDF--IDGDVDDPEYKPAPALMKDDMEDDASSPGDLVITDAGEGGSMLDGGGGTLSSGSGVYWPSPSALTARLRRLITASQRFTKSRQIL--QIHQTQQAMTPALYPMPPTLTDTFNPKIAAKIERQQRWTRREEADFYRVVSTFGVVFDPDLGRFDWTKFRAMARLHKKTDESLHKYLCAFIAMCRRVC-RLPAIEGDMVDSSLAIQPITEERASRTLYRVELLRKIREQVLRHPQLYEHLALCQPGPDLPVWWETGSHDRDLLLGAAKHGVSRTDYHILRDPEL 1557          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd6 (chromodomain helicase DNA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-130530-559])

HSP 1 Score: 1117.45 bits (2889), Expect = 0.000e+0
Identity = 632/1459 (43.32%), Postives = 876/1459 (60.04%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKNLKINN---LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESS-QPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES-KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKA--GVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMD----RYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSN--TMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKL-FTYLDSDY--LPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWF------------SGNNYPVCSDDEKNMKKNKNPSFNKLDS---QETMEIAES--TDTTQLN------------SKDKNSEIDKKD--DFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKT------AKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNN---TLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E +  I++KIL  R V+      A  +  EE+EE+Y+KYR FSY+HC+W + E +  DP    K+KR++N +        E DE LFNPDY+E+DRVLE   I +    E          E + +YLVKW SL YEE TWE  EDVDP K+KE+ +       ++ E  +P  + W+ +   R Y+NGN LR+YQLEG+NWL F W   +NCILADEMGLGKTIQSI FL E+F  G +GPFLII PLST+ NW+REF  W+ +N+I+YHGS  SR++I +YE +  D + +    +  F  +ITT+E++++D     K  W   +IDEAHRLKN+ CKL+EGL++++L+ +VLLTGTPLQN+V+ELF+LLNFLE S+F  E+ FL ++G+L++EEQV  L+ +L+PMMLRRLK+DVEK+LAPKEE ++EVELTNIQKKYYRAILE+NF FL+KG + +N+PNL+NTMMELRKCCNHP+LI GAEE IL +F             +    D    Q  +M+ ++GKLVLI KLLPKL    HKVL+FSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLDKA+LQ +    S   + QLSK E+EDLL+ GAYG+LMD++ +G KFCEEDID+IL  R+  I + +  + S+F+KASF  + NR+DI LDDPNFWQKWAK A   +D      SL++D PR+R+QT  Y  NS   DE+       S  DS                                   D+E     ++   D +    R + F+ EK LL FGWGRW+  L    FK  ++ +++E LCR +L Y  RHY GDD+I SFI DL+ P  D +   ++ H G SAPV RGR+G+K          K  +  PE +N                  +D   + +  V +  D              ++++H+++  +K+L R++ LY+L  E++G    Q          + G P  KL  T  D DY  +P+ WW+   DK L++G+ KHG+E+Y+ +  DP   F+               SG   P  + D  + K ++    N + S   +E +EI E   +D T  N            + D  +E+ ++    +P  + L  RLR++I ++Q+  R++    + +   ++ + P         H   +          +W+RRE+ +FYR ++SFG+    E     W+ FR    L RK++ESL  YF +F +MC+  C R P   D+ N   +L V+ I+ ERA R L +I ++ K+R +++ HP +  R++LC  +   P WW  G HD  +L G++K+G +RT+  I++D  L F
Sbjct:  301 EDEANIIEKILSVRTVNKEM---APDEPPEEMEEFYVKYRNFSYLHCKWATLEELEKDPRIHQKIKRFRNKQAQMKHIFTEPDEDLFNPDYIEVDRVLE---IAITTDTET--------GEEVTHYLVKWCSLSYEESTWELQEDVDPVKIKEFEELKKVPEMKHVE--RPLPEQWQKLEKSRDYRNGNQLREYQLEGMNWLLFNWYNRKNCILADEMGLGKTIQSITFLYEIFLMGLRGPFLIIAPLSTITNWEREFRTWTEMNVIVYHGSQISRQMILQYEMYHRDEQGNIMSGEFKFQGVITTFEMIMADCPELKKINWRCVVIDEAHRLKNRNCKLLEGLKLMNLEHKVLLTGTPLQNSVEELFSLLNFLEPSQFPSETTFLEEFGDLKTEEQVKKLQAILKPMMLRRLKDDVEKNLAPKEETIIEVELTNIQKKYYRAILEKNFAFLAKGANQHNMPNLINTMMELRKCCNHPYLITGAEEKILESFR------------KTYSSDAADFQLQAMIQAAGKLVLIDKLLPKLLAGGHKVLVFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFSKVDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQDINRKGSLNGVQQLSKMEVEDLLRKGAYGALMDEEDEGSKFCEEDIDQILQRRTQTITIQSEGKGSTFAKASFVSSGNRTDISLDDPNFWQKWAKIAELEIDSKAEKESLVIDTPRVRKQTRHY--NSFEDDEL----MEFSELDS-----------------------------------DSEERPCRTRRLSDRNRRYLRAECFRVEKNLLIFGWGRWKDILNHGRFKWHLAERDMEVLCRALLVYCVRHYKGDDKIKSFIWDLITPTEDGHNQALQNHSGLSAPVPRGRKGKK---------LKNQLSPPELKN------------------ADWLAHCNPEVVLQDD--------------SYKKHLKQHCNKVLLRVRMLYYLKVEVLGDAATQA---------LEGIPSSKLEVTLPDIDYIEIPTIWWDAEADKSLLIGVHKHGYERYNAMRADPALCFLERVGMPDVTALTVEQSGAETPSDAPDGIS-KSDEIKEENHVKSEELEEKVEIKEEPMSDETAKNDNMVTGCFVASLAGDLTAELMEQGRIQWPAGSALTARLRRLITAYQRYTRREPLRHDFLL--HEGIAPVAWQIGEFRHCTTEPDPLFLEWQRRWTRREQADFYRTVSSFGVVYDPEKKNFDWSQFRALARLERKTDESLERYFHSFVSMCRTAC-RLPPRKDEGNVDPSLFVDPITEERAARTLYRIELLRKVREQVLRHPLLGARLQLCRPSLYLPVWWECGKHDRDLLIGVAKHGLSRTDFYILNDPQLSF 1636          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd6 (chromodomain helicase DNA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-130530-559])

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 632/1459 (43.32%), Postives = 876/1459 (60.04%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKNLKINN---LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESS-QPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES-KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKA--GVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMD----RYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSN--TMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKL-FTYLDSDY--LPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWF------------SGNNYPVCSDDEKNMKKNKNPSFNKLDS---QETMEIAES--TDTTQLN------------SKDKNSEIDKKD--DFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKT------AKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNN---TLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E +  I++KIL  R V+      A  +  EE+EE+Y+KYR FSY+HC+W + E +  DP    K+KR++N +        E DE LFNPDY+E+DRVLE   I +    E          E + +YLVKW SL YEE TWE  EDVDP K+KE+ +       ++ E  +P  + W+ +   R Y+NGN LR+YQLEG+NWL F W   +NCILADEMGLGKTIQSI FL E+F  G +GPFLII PLST+ NW+REF  W+ +N+I+YHGS  SR++I +YE +  D + +    +  F  +ITT+E++++D     K  W   +IDEAHRLKN+ CKL+EGL++++L+ +VLLTGTPLQN+V+ELF+LLNFLE S+F  E+ FL ++G+L++EEQV  L+ +L+PMMLRRLK+DVEK+LAPKEE ++EVELTNIQKKYYRAILE+NF FL+KG + +N+PNL+NTMMELRKCCNHP+LI GAEE IL +F             +    D    Q  +M+ ++GKLVLI KLLPKL    HKVL+FSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLDKA+LQ +    S   + QLSK E+EDLL+ GAYG+LMD++ +G KFCEEDID+IL  R+  I + +  + S+F+KASF  + NR+DI LDDPNFWQKWAK A   +D      SL++D PR+R+QT  Y  NS   DE+       S  DS                                   D+E     ++   D +    R + F+ EK LL FGWGRW+  L    FK  ++ +++E LCR +L Y  RHY GDD+I SFI DL+ P  D +   ++ H G SAPV RGR+G+K          K  +  PE +N                  +D   + +  V +  D              ++++H+++  +K+L R++ LY+L  E++G    Q          + G P  KL  T  D DY  +P+ WW+   DK L++G+ KHG+E+Y+ +  DP   F+               SG   P  + D  + K ++    N + S   +E +EI E   +D T  N            + D  +E+ ++    +P  + L  RLR++I ++Q+  R++    + +   ++ + P         H   +          +W+RRE+ +FYR ++SFG+    E     W+ FR    L RK++ESL  YF +F +MC+  C R P   D+ N   +L V+ I+ ERA R L +I ++ K+R +++ HP +  R++LC  +   P WW  G HD  +L G++K+G +RT+  I++D  L F
Sbjct:  285 EDEANIIEKILSVRTVNKEM---APDEPPEEMEEFYVKYRNFSYLHCKWATLEELEKDPRIHQKIKRFRNKQAQMKHIFTEPDEDLFNPDYIEVDRVLE---IAITTDTET--------GEEVTHYLVKWCSLSYEESTWELQEDVDPVKIKEFEELKKVPEMKHVE--RPLPEQWQKLEKSRDYRNGNQLREYQLEGMNWLLFNWYNRKNCILADEMGLGKTIQSITFLYEIFLMGLRGPFLIIAPLSTITNWEREFRTWTEMNVIVYHGSQISRQMILQYEMYHRDEQGNIMSGEFKFQGVITTFEMIMADCPELKKINWRCVVIDEAHRLKNRNCKLLEGLKLMNLEHKVLLTGTPLQNSVEELFSLLNFLEPSQFPSETTFLEEFGDLKTEEQVKKLQAILKPMMLRRLKDDVEKNLAPKEETIIEVELTNIQKKYYRAILEKNFAFLAKGANQHNMPNLINTMMELRKCCNHPYLITGAEEKILESFR------------KTYSSDAADFQLQAMIQAAGKLVLIDKLLPKLLAGGHKVLVFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFSKVDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQDINRKGSLNGVQQLSKMEVEDLLRKGAYGALMDEEDEGSKFCEEDIDQILQRRTQTITIQSEGKGSTFAKASFVSSGNRTDISLDDPNFWQKWAKIAELEIDSKAEKESLVIDTPRVRKQTRHY--NSFEDDEL----MEFSELDS-----------------------------------DSEERPCRTRRLSDRNRRYLRAECFRVEKNLLIFGWGRWKDILNHGRFKWHLAERDMEVLCRALLVYCVRHYKGDDKIKSFIWDLITPTEDGHNQALQNHSGLSAPVPRGRKGKK---------LKNQLSPPELKN------------------ADWLAHCNPEVVLQDD--------------SYKKHLKQHCNKVLLRVRMLYYLKVEVLGDAATQA---------LEGIPSSKLEVTLPDIDYIEIPTIWWDAEADKSLLIGVHKHGYERYNAMRADPALCFLERVGMPDVTALTVEQSGAETPSDAPDGIS-KSDEIKEENHVKSEELEEKVEIKEEPMSDETAKNDNMVTGCFVASLAGDLTAELMEQGRIQWPAGSALTARLRRLITAYQRYTRREPLRHDFLL--HEGIAPVAWQIGEFRHCTTEPDPLFLEWQRRWTRREQADFYRTVSSFGVVYDPEKKNFDWSQFRALARLERKTDESLERYFHSFVSMCRTAC-RLPPRKDEGNVDPSLFVDPITEERAARTLYRIELLRKVREQVLRHPLLGARLQLCRPSLYLPVWWECGKHDRDLLIGVAKHGLSRTDFYILNDPQLSF 1620          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Match: chd7 (chromodomain helicase DNA binding protein 7 [Source:ZFIN;Acc:ZDB-GENE-070912-179])

HSP 1 Score: 1112.83 bits (2877), Expect = 0.000e+0
Identity = 629/1543 (40.76%), Postives = 894/1543 (57.94%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKNLKINN--LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-----FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSK--------GVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE--SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRY---KPNSTL-YDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESD--SNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKD-----KNSEIDKKDD----------------------FPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDP------ALLT------PEMNSHMNNDG---------------------------KTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYD---DNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEV---NKIAPKNCCKKIDKNENQNEI 7064
            +++  +V+KI+G R+          I    EVEE+Y+K++GFSY+HC W   E +  D     K+KR++  +  +  + E D+  FNPDYVE+DRVL+     V++  +        N E +  YLVKW SLPYE+ TWE   D+D  K++E+ +R      +   + +P   +W+     R YKN N LR+YQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E++  G  GPFL+I PLST+ NW+REF  W+ LN+++YHGS  SRK IQ YE +  D +     +++     F+A+ITT+E++L+D        W   IIDEAHRLKN+ CKL+EGL+M+D++ +VLLTGTPLQN V+ELF+LLNFLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPKEE ++EVELTN+QKKYYRAILE+NF FLSK        G  G+N+PNL+NTMMELRKCCNHP+LI GAEE I+  F             +   +D+      +M+ ++GKLVLI KLLPKLK   H+VLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  E  +  + QLSKKEIEDLL+ GAYG+LM+++ +G KFCEEDID+IL  R+  I + +  + S+F+KASF    NR+DI L+DP+FWQKWAKKA +D + I   N+L++D PR+R+QT  Y   K +  + Y E+  D                                        SE K  +        TQ   R + F+ EK LL +GWGRW   L    FK P+  +++E++CR +L Y   HY GD+ I  FI DL+ P  D  S T+  H G SAPV RGR+G+KG            + V + R                  Q+D   + +  + +  D              +++RH++   +K+L R++ LY+L  E+IG ++A  IL  T+ +++    ++ +     +D    WW+   DK L++G+FKHG+EKY+ +  DP   F+         V   D K +   +  +    D  E  E        +++ KD      NS +D  +D                      +P  + L  RLR++I ++Q+  ++++  +  +    +          A++T      P+       DG                           +  +W+RREE +FYR +++FG+          W+ FR    L +K++ESL +Y+ +F  MC+++C R PL  +    + T+ ++ I+ ERA+R L +I ++ +IR +++ HP +E+R+ LC+ + D P+WW  G HD  +L+G +K+G +RT+  I++D  L F    L+  R+  Q   K V L V   + + P    K  +  E Q ++
Sbjct:  840 DAEGPVVEKIMGMRMGKKELASGEEI----EVEEFYVKFKGFSYLHCRWADIEELEKDKRIQQKIKRFRAKQALSTFVTEMDDEPFNPDYVEVDRVLD-----VSESTDE-------NGELVTLYLVKWCSLPYEDSTWELKADIDQVKIEEF-ERVMAREPQLKRVERPPTSDWQKSESSREYKNANALREYQLEGVNWLLFNWYNTRNCILADEMGLGKTIQSITFLYEIYLKGIHGPFLVIAPLSTIPNWEREFRTWTELNVVVYHGSQASRKTIQAYEMYYRDTQG----RIIKGAYKFHAVITTFEMILTDCPELRNVPWRCVIIDEAHRLKNRNCKLLEGLKMMDMEHKVLLTGTPLQNTVEELFSLLNFLEPDRFPSESTFMQEFGDLKTEEQVQKLQGILKPMMLRRLKEDVEKNLAPKEETIIEVELTNVQKKYYRAILEKNFAFLSKSGAGGGSGGGGGSNVPNLLNTMMELRKCCNHPYLINGAEEKIMEEFR------------ETHPLDQPEFHLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQMVRCLDILEDYLIQRRYPYERIDGRVRGNLRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKSVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRENAANGVQQLSKKEIEDLLRKGAYGALMEEEDEGSKFCEEDIDQILQRRTQTITIESEGKGSTFAKASFVSAGNRTDISLEDPDFWQKWAKKAELDLDAINGRNNLVIDTPRVRKQTRHYSSMKEDDLMEYSELESD----------------------------------------SEDKPIQKPRRPQDRTQGYPRSECFRVEKNLLVYGWGRWGDILSHGRFKRPLRERDVETICRALLAYCLLHYRGDENIKGFIWDLITPTEDGQSRTLTNHSGLSAPVPRGRKGKKG-----------KLPVAQTRM----------------PQADWLADCNPDLLLQED--------------SYKRHLKHHCNKVLLRVRMLYYLRQEVIG-DQADRILEGTDSSEL----DIWIPQPFHADVPTDWWDLDADKSLLIGVFKHGYEKYNSMRADPTLCFLER-------VGMPDAKAIAAEQRGADMMADGVEGEEEDPEYKPLRMSFKDDLDDFTNSPLDDNNDGMDGETGEAPKLGENGKPGNLYWPPASALTARLRRLITAYQRTHKREQLRQEAMAKPDRRRRRPRDDILAMVTEGGAYVPDGAVAFMADGGAFMAKGSPFIPDSAALLADSAAYFKERRQRWTRREEADFYRVVSTFGVVYDVHRQCFDWSQFRAFARLDKKTDESLEKYYCSFVAMCKRVC-RMPLKSETELPDPTIIIDPITEERASRTLYRIELLRRIREQVLPHPLLEERLSLCQPSPDLPAWWEPGRHDRDLLRGAAKHGVSRTDYHILNDPELSF----LEAYRKFTQG--KGVELPVIVSDPLTPLTLPKDEEVKEEQGDV 2249          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: chd8 (chromodomain helicase DNA binding protein 8 [Source:NCBI gene;Acc:100192376])

HSP 1 Score: 1147.88 bits (2968), Expect = 0.000e+0
Identity = 625/1433 (43.61%), Postives = 867/1433 (60.50%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE---SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNMKKNKNPSFNKL-DSQETMEIAESTDTTQLNS-KDKNSEIDKKDD--------FPTNAELNIRLRKIIGSFQKLWRQK----ESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R+          +    EVEEY++KY+ +SY+HCEW + E +  D     KLKR+K    ++ +  ++DE  FNPDYVE+DR+L+                D  N E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ +R          + +P   +WK + + R Y+NGN LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSI FL E++N G +GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D +    P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E++FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FL+KG S +N PNL+NTMMELRKCCNHP+LI GAEE I++ F   T +      +Q            +MV SSGKLVLI KLLPKL+   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G +RQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +   S PI Q +KKEIEDLL+ GAY ++MD+D +G KFCEEDID+ILL R+T I + +  + S+FSKASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +        E S  ES+                                            +DD      QD      R D F+ EK LL +GWGRW   L    FK  ++ +++E +CR IL Y   HY GD+ I SFI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N +     E                                           +++H++   +K+L R++ LYFL  E+IG  +A  +L+      I  +     F  +D   +PS WW+   DK L++G+FKHG+EKY+ +  DP   F+    G       D++    ++    F++L D  +     E  +   L++ KD   E+ +  +        +P  + L  RLR++I ++Q+ ++++    E+E    K   +  + A    E+        K  +W+RRE  +F+R ++SFG+E   +T    W  FR    L +K++ESL +YF  F  MC+++C+  P   D+  + +L +E IS ERA+R L +++++ ++R +++ HP +  R+ LC    + P WW +G HD  +L+G ++YG +RT++ I+ D    F
Sbjct:  591 EEDAAIVDKILSMRLAKKELPTGEYV----EVEEYFVKYKNYSYLHCEWATIEQLERDKRIHQKLKRFKTKMTQMQHFLQEDEESFNPDYVEVDRILDESH-----------STDKDNGEPVVYYLVKWCSLPYEDSTWELKEDVDDGKIEEF-KRIEARQPNLKRVARPAATSWKKLELSREYQNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSITFLQEVYNVGIRGPFLVIAPLSTITNWEREFGSWTQMNTIVYHGSLASRQMIQQYEMYCKDSKGRLIPGAYKFDALITTFEMVLSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPTQFSSEAEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLTKGASQSNTPNLLNTMMELRKCCNHPYLITGAEEKIISEFREATPVVPPDFHVQ------------AMVRSSGKLVLIDKLLPKLRAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNMRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDNHLSGPIQQFTKKEIEDLLRKGAYAAIMDEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFSKASFVASENRTDISLDDPNFWQKWAKKADLDLDLLSSKNTLVIDTPRIRKQTRHFTNKDDDMVEFSDLESD--------------------------------------------DDDRPKARRQDRKHGYGRTDCFRVEKHLLVYGWGRWRDILTHGRFKRGMNERDVEKICRAILVYCLLHYRGDENIKSFIWDLITPAENGKTKQLQNHSGLSIPVPRGRKGKKVKSQSSFDIHKADWIHKYNPDTLFQDE------------------------------------------GYKKHLKHQCNKVLLRVRMLYFLRQEVIG-NQAMKVLSGVEARQIDIW-----FPQVDQVEVPSRWWDREADKSLLIGVFKHGYEKYNTMRADPALCFLEKVGG------PDEQAIAAEHHAQDFSELPDGGDFDRDIEDPEYKPLHAQKDPEDEVTRNTEKTMPSGMLWPPGSALTARLRRLITAYQRSYKREQLKLEAEERGDKRR-KRCEAAFKLKEIARRE----KQQRWTRREACDFFRVLSSFGVEYDPDTQLYDWQRFRGLARLDKKTDESLLKYFHGFVAMCRQVCRLPPAAGDEPPDPSLFIEPISEERASRALFRLDLLRRVREQVLCHPLLIPRLSLCRPDPELPEWWESGRHDNELLQGAARYGLSRTDLTILQDHAFSF 1892          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: chd8 (chromodomain helicase DNA binding protein 8 [Source:NCBI gene;Acc:100192376])

HSP 1 Score: 1145.95 bits (2963), Expect = 0.000e+0
Identity = 625/1446 (43.22%), Postives = 873/1446 (60.37%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE---SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSG---------------NNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD--------FPTNAELNIRLRKIIGSFQKLWRQK----ESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R+          +    EVEEY++KY+ +SY+HCEW + E +  D     KLKR+K    ++ +  ++DE  FNPDYVE+DR+L+                D  N E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ +R          + +P   +WK + + R Y+NGN LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSI FL E++N G +GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D +    P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E++FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FL+KG S +N PNL+NTMMELRKCCNHP+LI GAEE I++ F   T +      +Q            +MV SSGKLVLI KLLPKL+   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G +RQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +   S PI Q +KKEIEDLL+ GAY ++MD+D +G KFCEEDID+ILL R+T I + +  + S+FSKASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +        E S  ES+                                            +DD      QD      R D F+ EK LL +GWGRW   L    FK  ++ +++E +CR IL Y   HY GD+ I SFI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N +     E                                           +++H++   +K+L R++ LYFL  E+IG  +A  +L+      I  +     F  +D   +PS WW+   DK L++G+FKHG+EKY+ +  DP   F+    G               +  P   D ++++   ++P +  L +Q+  E  +  D+  ++  ++ S +D ++         +P  + L  RLR++I ++Q+ ++++    E+E    K   +  + A    E+        K  +W+RRE  +F+R ++SFG+E   +T    W  FR    L +K++ESL +YF  F  MC+++C+  P   D+  + +L +E IS ERA+R L +++++ ++R +++ HP +  R+ LC    + P WW +G HD  +L+G ++YG +RT++ I+ D    F
Sbjct:  582 EEDAAIVDKILSMRLAKKELPTGEYV----EVEEYFVKYKNYSYLHCEWATIEQLERDKRIHQKLKRFKTKMTQMQHFLQEDEESFNPDYVEVDRILDESH-----------STDKDNGEPVVYYLVKWCSLPYEDSTWELKEDVDDGKIEEF-KRIEARQPNLKRVARPAATSWKKLELSREYQNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSITFLQEVYNVGIRGPFLVIAPLSTITNWEREFGSWTQMNTIVYHGSLASRQMIQQYEMYCKDSKGRLIPGAYKFDALITTFEMVLSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPTQFSSEAEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLTKGASQSNTPNLLNTMMELRKCCNHPYLITGAEEKIISEFREATPVVPPDFHVQ------------AMVRSSGKLVLIDKLLPKLRAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNMRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDNHLSGPIQQFTKKEIEDLLRKGAYAAIMDEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFSKASFVASENRTDISLDDPNFWQKWAKKADLDLDLLSSKNTLVIDTPRIRKQTRHFTNKDDDMVEFSDLESD--------------------------------------------DDDRPKARRQDRKHGYGRTDCFRVEKHLLVYGWGRWRDILTHGRFKRGMNERDVEKICRAILVYCLLHYRGDENIKSFIWDLITPAENGKTKQLQNHSGLSIPVPRGRKGKKVKSQSSFDIHKADWIHKYNPDTLFQDE------------------------------------------GYKKHLKHQCNKVLLRVRMLYFLRQEVIG-NQAMKVLSGVEARQIDIW-----FPQVDQVEVPSRWWDREADKSLLIGVFKHGYEKYNTMRADPALCFLEKVGGPDEQAIAAEHHAQDFSELPDGGDFDRDI---EDPEYKPLHAQKDPE--DEIDSLMMD--EEISVVDGEEATAMPSGMLWPPGSALTARLRRLITAYQRSYKREQLKLEAEERGDKRR-KRCEAAFKLKEIARRE----KQQRWTRREACDFFRVLSSFGVEYDPDTQLYDWQRFRGLARLDKKTDESLLKYFHGFVAMCRQVCRLPPAAGDEPPDPSLFIEPISEERASRALFRLDLLRRVREQVLCHPLLIPRLSLCRPDPELPEWWESGRHDNELLQGAARYGLSRTDLTILQDHAFSF 1895          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: chd8 (chromodomain helicase DNA binding protein 8 [Source:NCBI gene;Acc:100192376])

HSP 1 Score: 1145.18 bits (2961), Expect = 0.000e+0
Identity = 625/1446 (43.22%), Postives = 873/1446 (60.37%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE---SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSG---------------NNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD--------FPTNAELNIRLRKIIGSFQKLWRQK----ESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R+          +    EVEEY++KY+ +SY+HCEW + E +  D     KLKR+K    ++ +  ++DE  FNPDYVE+DR+L+                D  N E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ +R          + +P   +WK + + R Y+NGN LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSI FL E++N G +GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D +    P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E++FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FL+KG S +N PNL+NTMMELRKCCNHP+LI GAEE I++ F   T +      +Q            +MV SSGKLVLI KLLPKL+   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G +RQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +   S PI Q +KKEIEDLL+ GAY ++MD+D +G KFCEEDID+ILL R+T I + +  + S+FSKASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +        E S  ES+                                            +DD      QD      R D F+ EK LL +GWGRW   L    FK  ++ +++E +CR IL Y   HY GD+ I SFI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N +     E                                           +++H++   +K+L R++ LYFL  E+IG  +A  +L+      I  +     F  +D   +PS WW+   DK L++G+FKHG+EKY+ +  DP   F+    G               +  P   D ++++   ++P +  L +Q+  E  +  D+  ++  ++ S +D ++         +P  + L  RLR++I ++Q+ ++++    E+E    K   +  + A    E+        K  +W+RRE  +F+R ++SFG+E   +T    W  FR    L +K++ESL +YF  F  MC+++C+  P   D+  + +L +E IS ERA+R L +++++ ++R +++ HP +  R+ LC    + P WW +G HD  +L+G ++YG +RT++ I+ D    F
Sbjct:  586 EEDAAIVDKILSMRLAKKELPTGEYV----EVEEYFVKYKNYSYLHCEWATIEQLERDKRIHQKLKRFKTKMTQMQHFLQEDEESFNPDYVEVDRILDESH-----------STDKDNGEPVVYYLVKWCSLPYEDSTWELKEDVDDGKIEEF-KRIEARQPNLKRVARPAATSWKKLELSREYQNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSITFLQEVYNVGIRGPFLVIAPLSTITNWEREFGSWTQMNTIVYHGSLASRQMIQQYEMYCKDSKGRLIPGAYKFDALITTFEMVLSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPTQFSSEAEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLTKGASQSNTPNLLNTMMELRKCCNHPYLITGAEEKIISEFREATPVVPPDFHVQ------------AMVRSSGKLVLIDKLLPKLRAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNMRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDNHLSGPIQQFTKKEIEDLLRKGAYAAIMDEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFSKASFVASENRTDISLDDPNFWQKWAKKADLDLDLLSSKNTLVIDTPRIRKQTRHFTNKDDDMVEFSDLESD--------------------------------------------DDDRPKARRQDRKHGYGRTDCFRVEKHLLVYGWGRWRDILTHGRFKRGMNERDVEKICRAILVYCLLHYRGDENIKSFIWDLITPAENGKTKQLQNHSGLSIPVPRGRKGKKVKSQSSFDIHKADWIHKYNPDTLFQDE------------------------------------------GYKKHLKHQCNKVLLRVRMLYFLRQEVIG-NQAMKVLSGVEARQIDIW-----FPQVDQVEVPSRWWDREADKSLLIGVFKHGYEKYNTMRADPALCFLEKVGGPDEQAIAAEHHAQDFSELPDGGDFDRDI---EDPEYKPLHAQKDPE--DEIDSLMMD--EEISVVDGEEATAMPSGMLWPPGSALTARLRRLITAYQRSYKREQLKLEAEERGDKRR-KRCEAAFKLKEIARRE----KQQRWTRREACDFFRVLSSFGVEYDPDTQLYDWQRFRGLARLDKKTDESLLKYFHGFVAMCRQVCRLPPAAGDEPPDPSLFIEPISEERASRALFRLDLLRRVREQVLCHPLLIPRLSLCRPDPELPEWWESGRHDNELLQGAARYGLSRTDLTILQDHAFSF 1899          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: chd8 (chromodomain helicase DNA binding protein 8 [Source:NCBI gene;Acc:100192376])

HSP 1 Score: 1144.8 bits (2960), Expect = 0.000e+0
Identity = 625/1446 (43.22%), Postives = 873/1446 (60.37%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE---SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSG---------------NNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD--------FPTNAELNIRLRKIIGSFQKLWRQK----ESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R+          +    EVEEY++KY+ +SY+HCEW + E +  D     KLKR+K    ++ +  ++DE  FNPDYVE+DR+L+                D  N E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ +R          + +P   +WK + + R Y+NGN LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSI FL E++N G +GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D +    P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E++FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FL+KG S +N PNL+NTMMELRKCCNHP+LI GAEE I++ F   T +      +Q            +MV SSGKLVLI KLLPKL+   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G +RQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +   S PI Q +KKEIEDLL+ GAY ++MD+D +G KFCEEDID+ILL R+T I + +  + S+FSKASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +        E S  ES+                                            +DD      QD      R D F+ EK LL +GWGRW   L    FK  ++ +++E +CR IL Y   HY GD+ I SFI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N +     E                                           +++H++   +K+L R++ LYFL  E+IG  +A  +L+      I  +     F  +D   +PS WW+   DK L++G+FKHG+EKY+ +  DP   F+    G               +  P   D ++++   ++P +  L +Q+  E  +  D+  ++  ++ S +D ++         +P  + L  RLR++I ++Q+ ++++    E+E    K   +  + A    E+        K  +W+RRE  +F+R ++SFG+E   +T    W  FR    L +K++ESL +YF  F  MC+++C+  P   D+  + +L +E IS ERA+R L +++++ ++R +++ HP +  R+ LC    + P WW +G HD  +L+G ++YG +RT++ I+ D    F
Sbjct:  586 EEDAAIVDKILSMRLAKKELPTGEYV----EVEEYFVKYKNYSYLHCEWATIEQLERDKRIHQKLKRFKTKMTQMQHFLQEDEESFNPDYVEVDRILDESH-----------STDKDNGEPVVYYLVKWCSLPYEDSTWELKEDVDDGKIEEF-KRIEARQPNLKRVARPAATSWKKLELSREYQNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSITFLQEVYNVGIRGPFLVIAPLSTITNWEREFGSWTQMNTIVYHGSLASRQMIQQYEMYCKDSKGRLIPGAYKFDALITTFEMVLSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPTQFSSEAEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLTKGASQSNTPNLLNTMMELRKCCNHPYLITGAEEKIISEFREATPVVPPDFHVQ------------AMVRSSGKLVLIDKLLPKLRAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNMRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDNHLSGPIQQFTKKEIEDLLRKGAYAAIMDEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFSKASFVASENRTDISLDDPNFWQKWAKKADLDLDLLSSKNTLVIDTPRIRKQTRHFTNKDDDMVEFSDLESD--------------------------------------------DDDRPKARRQDRKHGYGRTDCFRVEKHLLVYGWGRWRDILTHGRFKRGMNERDVEKICRAILVYCLLHYRGDENIKSFIWDLITPAENGKTKQLQNHSGLSIPVPRGRKGKKVKSQSSFDIHKADWIHKYNPDTLFQDE------------------------------------------GYKKHLKHQCNKVLLRVRMLYFLRQEVIG-NQAMKVLSGVEARQIDIW-----FPQVDQVEVPSRWWDREADKSLLIGVFKHGYEKYNTMRADPALCFLEKVGGPDEQAIAAEHHAQDFSELPDGGDFDRDI---EDPEYKPLHAQKDPE--DEIDSLMMD--EEISVVDGEEATAMPSGMLWPPGSALTARLRRLITAYQRSYKREQLKLEAEERGDKRR-KRCEAAFKLKEIARRE----KQQRWTRREACDFFRVLSSFGVEYDPDTQLYDWQRFRGLARLDKKTDESLLKYFHGFVAMCRQVCRLPPAAGDEPPDPSLFIEPISEERASRALFRLDLLRRVREQVLCHPLLIPRLSLCRPDPELPEWWESGRHDNELLQGAARYGLSRTDLTILQDHAFSF 1899          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Match: chd8 (chromodomain helicase DNA binding protein 8 [Source:NCBI gene;Acc:100192376])

HSP 1 Score: 1139.79 bits (2947), Expect = 0.000e+0
Identity = 625/1429 (43.74%), Postives = 865/1429 (60.53%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE---SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNMKKNKNPSFNKL-DSQETMEIAESTDTTQLNS-KDKNSEIDKKDD----FPTNAELNIRLRKIIGSFQKLWRQK----ESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R+          +    EVEEY++KY+ +SY+HCEW + E +  D     KLKR+K    ++ +  ++DE  FNPDYVE+DR+L+                D  N E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ +R          + +P   +WK + + R Y+NGN LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSI FL E++N G +GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D +    P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E++FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FL+KG S +N PNL+NTMMELRKCCNHP+LI GAEE I++ F   T +      +Q            +MV SSGKLVLI KLLPKL+   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G +RQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +   S PI Q +KKEIEDLL+ GAY ++MD+D +G KFCEEDID+ILL R+T I + +  + S+FSKASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +        E S  ES+                                            +DD      QD      R D F+ EK LL +GWGRW   L    FK  ++ +++E +CR IL Y   HY GD+ I SFI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N +     E                                           +++H++   +K+L R++ LYFL  E+IG  +A  +L+      I  +     F  +D   +PS WW+   DK L++G+FKHG+EKY+ +  DP   F+    G       D++    ++    F++L D  +     E  +   L++ KD   E+         +P  + L  RLR++I ++Q+ ++++    E+E    K   +  + A    E+        K  +W+RRE  +F+R ++SFG+E   +T    W  FR    L +K++ESL +YF  F  MC+++C+  P   D+  + +L +E IS ERA+R L +++++ ++R +++ HP +  R+ LC    + P WW +G HD  +L+G ++YG +RT++ I+ D    F
Sbjct:  131 EEDAAIVDKILSMRLAKKELPTGEYV----EVEEYFVKYKNYSYLHCEWATIEQLERDKRIHQKLKRFKTKMTQMQHFLQEDEESFNPDYVEVDRILDESH-----------STDKDNGEPVVYYLVKWCSLPYEDSTWELKEDVDDGKIEEF-KRIEARQPNLKRVARPAATSWKKLELSREYQNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSITFLQEVYNVGIRGPFLVIAPLSTITNWEREFGSWTQMNTIVYHGSLASRQMIQQYEMYCKDSKGRLIPGAYKFDALITTFEMVLSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPTQFSSEAEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLTKGASQSNTPNLLNTMMELRKCCNHPYLITGAEEKIISEFREATPVVPPDFHVQ------------AMVRSSGKLVLIDKLLPKLRAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNMRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDNHLSGPIQQFTKKEIEDLLRKGAYAAIMDEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFSKASFVASENRTDISLDDPNFWQKWAKKADLDLDLLSSKNTLVIDTPRIRKQTRHFTNKDDDMVEFSDLESD--------------------------------------------DDDRPKARRQDRKHGYGRTDCFRVEKHLLVYGWGRWRDILTHGRFKRGMNERDVEKICRAILVYCLLHYRGDENIKSFIWDLITPAENGKTKQLQNHSGLSIPVPRGRKGKKVKSQSSFDIHKADWIHKYNPDTLFQDE------------------------------------------GYKKHLKHQCNKVLLRVRMLYFLRQEVIG-NQAMKVLSGVEARQIDIW-----FPQVDQVEVPSRWWDREADKSLLIGVFKHGYEKYNTMRADPALCFLEKVGG------PDEQAIAAEHHAQDFSELPDGGDFDRDIEDPEYKPLHAQKDPEDEVTTAMPSGMLWPPGSALTARLRRLITAYQRSYKREQLKLEAEERGDKRR-KRCEAAFKLKEIARR----EKQQRWTRREACDFFRVLSSFGVEYDPDTQLYDWQRFRGLARLDKKTDESLLKYFHGFVAMCRQVCRLPPAAGDEPPDPSLFIEPISEERASRALFRLDLLRRVREQVLCHPLLIPRLSLCRPDPELPEWWESGRHDNELLQGAARYGLSRTDLTILQDHAFSF 1428          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd9 (chromodomain helicase DNA binding protein 9 [Source:MGI Symbol;Acc:MGI:1924001])

HSP 1 Score: 1142.87 bits (2955), Expect = 0.000e+0
Identity = 631/1440 (43.82%), Postives = 875/1440 (60.76%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESER---------NKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R V   VS G+        ++EE+++KY+ +SY+HCEW + + ++ D     K+KR+K     + + L + +E  FNPDYVE+DR+LE             F  D    E+++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +   W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F    D  N +                +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  +S    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D + I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +                  R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RGR                           +  ++    ++ D ++++     + P  +  D               +++H++   +K+L R++ LY+L  E+IG E +Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    + + +  E DK   +PT + L  RLR++I ++Q+  + +  ++         N ++  Y+    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K++ SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  685 EEDAAIVDKILACRTVKKEVSPGV------MLDIEEFFVKYKNYSYLHCEWATEQQLLKDKRIQQKIKRFKLRQAQRAHFLADMEEEPFNPDYVEVDRILEVS-----------FCEDKDTGESVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRHLDRPPSNIWKKIEQSREYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIDWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFR---DTYNPSA---------SDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRDSNVSGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAELDIDTISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGE---------------------------EKPKLRRPCDRSGG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEVICRALLAYCLIHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRGR---------------------------KGKKVKTQTSSFDIQKAEWLRKYN-PEQLLQDE-------------GYKKHVKHHCNKVLLRVRMLYYLKQEVIGNE-SQKVFDGVDASDIDVWVPEP------DHSEVPAAWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDDKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGEGQLMEGDKVY-WPTPSALTTRLRRLITAYQRTNKNRHIQQMQPTFSLPANAMQPLYEE---ATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRALARLHKKTDNSLEKYLCAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPIWWECGSHDRDLLIGAAKHGVSRTDYHILRDPELSF 1993          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd9 (chromodomain helicase DNA binding protein 9 [Source:MGI Symbol;Acc:MGI:1924001])

HSP 1 Score: 1142.87 bits (2955), Expect = 0.000e+0
Identity = 631/1440 (43.82%), Postives = 875/1440 (60.76%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESER---------NKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R V   VS G+        ++EE+++KY+ +SY+HCEW + + ++ D     K+KR+K     + + L + +E  FNPDYVE+DR+LE             F  D    E+++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +   W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F    D  N +                +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  +S    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D + I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +                  R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RGR                           +  ++    ++ D ++++     + P  +  D               +++H++   +K+L R++ LY+L  E+IG E +Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    + + +  E DK   +PT + L  RLR++I ++Q+  + +  ++         N ++  Y+    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K++ SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  685 EEDAAIVDKILACRTVKKEVSPGV------MLDIEEFFVKYKNYSYLHCEWATEQQLLKDKRIQQKIKRFKLRQAQRAHFLADMEEEPFNPDYVEVDRILEVS-----------FCEDKDTGESVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRHLDRPPSNIWKKIEQSREYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIDWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFR---DTYNPSA---------SDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRDSNVSGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAELDIDTISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGE---------------------------EKPKLRRPCDRSGG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEVICRALLAYCLIHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRGR---------------------------KGKKVKTQTSSFDIQKAEWLRKYN-PEQLLQDE-------------GYKKHVKHHCNKVLLRVRMLYYLKQEVIGNE-SQKVFDGVDASDIDVWVPEP------DHSEVPAAWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDDKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGEGQLMEGDKVY-WPTPSALTTRLRRLITAYQRTNKNRHIQQMQPTFSLPANAMQPLYEE---ATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRALARLHKKTDNSLEKYLCAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPIWWECGSHDRDLLIGAAKHGVSRTDYHILRDPELSF 1993          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd9 (chromodomain helicase DNA binding protein 9 [Source:MGI Symbol;Acc:MGI:1924001])

HSP 1 Score: 1142.87 bits (2955), Expect = 0.000e+0
Identity = 630/1439 (43.78%), Postives = 875/1439 (60.81%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESER---------NKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R V   VS G+        ++EE+++KY+ +SY+HCEW + + ++ D     K+KR+K     + + L + +E  FNPDYVE+DR+LE             F  D    E+++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +   W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F    D  N +                +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  +S    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D + I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +             +    R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RGR                           +  ++    ++ D ++++     + P  +  D               +++H++   +K+L R++ LY+L  E+IG E +Q + +  + +DI  + PE        S+   +WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    + + +  E DK   +PT + L  RLR++I ++Q+  + +  ++         N ++  Y+    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K++ SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  685 EEDAAIVDKILACRTVKKEVSPGV------MLDIEEFFVKYKNYSYLHCEWATEQQLLKDKRIQQKIKRFKLRQAQRAHFLADMEEEPFNPDYVEVDRILEVS-----------FCEDKDTGESVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRHLDRPPSNIWKKIEQSREYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIDWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFR---DTYNPSA---------SDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRDSNVSGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAELDIDTISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGE---------------------------EKPKLRRPCD------------RSGGYGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEVICRALLAYCLIHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRGR---------------------------KGKKVKTQTSSFDIQKAEWLRKYN-PEQLLQDE-------------GYKKHVKHHCNKVLLRVRMLYYLKQEVIGNE-SQKVFDGVDASDIDVWVPEPD-----HSEVPAAWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDDKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGEGQLMEGDKVY-WPTPSALTTRLRRLITAYQRTNKNRHIQQMQPTFSLPANAMQPLYEE---ATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRALARLHKKTDNSLEKYLCAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPIWWECGSHDRDLLIGAAKHGVSRTDYHILRDPELSF 1993          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd8 (chromodomain helicase DNA binding protein 8 [Source:MGI Symbol;Acc:MGI:1915022])

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 627/1470 (42.65%), Postives = 884/1470 (60.14%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKS-SESVIDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRY------DLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLP-SWWNTTVDKCLVLGIFKHGWEKYDDIYKDP--CF--------------------GFVNWFSGNNYPV-CSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKE-----SERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTN-DFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSL 6995
            E    IV K+L  R+V      +       E EE+++KY+ +SY+HCEW + S+   D     KLKR+K    ++ +   +DE  FNPDYVE+DR+L+               +D  N E ++YYLVKW SLPYE+ TWE  EDVD  K++E+ +R    + E   + +P    WK + +   YKN N LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSIAFL E++N G  GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D      P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE S+F  ES+FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LI GAEE IL  F                II ++     +MV S+GKLVLI KLLPKLK   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +     I Q SKKEIEDLL+ GAY ++M++D +G KFCEEDID+ILL R+T I + +  + S+F+KASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +   STL D+                                             E  D E++D     ++  DR+      D F+ EK LL +GWGRW   L    FK  ++ +++E++CR IL Y   HY GD+ I SFI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N                             P ++  D S             +++H++   +K+L R++ LY+L  E+IG ++A+ +L     ++I  +     F  +D   +P +WW++  DK L++G+FKHG+EKY+ +  DP  CF                     F +   G ++   C D E   K  + P  +  D  + + + +   +     + + ++      +P  + L  RLR+++ ++Q+ +++++     +ER       +  + A    E+        K  +W+RRE+T+FYR +++FG+E   +  +  W  FR    L +K++ESLT+YF  F  MC+++C+  P   D+  +  L +E I+ ERA+R L +I ++ ++R +++ HP +E R+ LC+    + P WW    HD  +L+G +++G ++T+  I+ D +  F    ++ + Q  QA + + SL
Sbjct:  640 EEDAAIVDKVLSMRVVKK----ELPSGQYTEAEEFFVKYKNYSYLHCEWATISQLEKDKRIHQKLKRFKTKMAQMRHFFHEDEEPFNPDYVEVDRILDESH-----------SVDKDNGEPVIYYLVKWCSLPYEDSTWELKEDVDEGKIREF-KRIQSRHPELRRVNRPQANAWKKLELSHEYKNRNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQEVYNVGIHGPFLVIAPLSTITNWEREFNTWTEMNTIVYHGSLASRQMIQQYEMYCKDSRGRLIPGAYKFDALITTFEMILSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSQFPSESEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLSKGAGHTNMPNLLNTMMELRKCCNHPYLINGAEEKILMEFREAC-----------HIIPQD-FHLQAMVRSAGKLVLIDKLLPKLKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDGNITGIQQFSKKEIEDLLRKGAYAAIMEEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFAKASFVASENRTDISLDDPNFWQKWAKKADLDMDLLNSKNNLVIDTPRVRKQTRHF---STLKDDDL------------------------------------------VEFSDLESEDDERPRSRRHDRHHTYGRTDCFRVEKHLLVYGWGRWRDILSHGRFKRRMTERDVETICRAILVYCLLHYRGDENIKSFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKVKSQSTFDIHKADWIRKYN-----------------------------PDTLFQDES-------------YKKHLKHQCNKVLLRVRMLYYLRQEVIG-DQAEKVLGGAIASEIDIW-----FPVVDQLEVPTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLEKAGRPDDKAIAAEHRVLDNFSDLVEGIDFDKDCEDPE--YKPLQGPPKDPDDEGDPLMMMDEEISVIDGEEAQVTQQPGHLFWPPGSALTARLRRLVTAYQRSYKREQMKMEAAERG--DRRRRRCEAAFKLKEIARRE----KQQRWTRREQTDFYRVVSTFGVEYDPDNMQFHWDRFRTFARLDKKTDESLTKYFHGFVAMCRQVCRLPPAAGDEPPDPNLFIEPITEERASRTLYRIELLRRLREQVLCHPLLEDRLALCQPPGLELPKWWEPVRHDGELLRGAARHGVSQTDCNIMQDPDFSFLAARMNYM-QNHQAGASAASL 1979          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Match: Chd8 (chromodomain helicase DNA binding protein 8 [Source:MGI Symbol;Acc:MGI:1915022])

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 627/1470 (42.65%), Postives = 884/1470 (60.14%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKS-SESVIDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRY------DLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLP-SWWNTTVDKCLVLGIFKHGWEKYDDIYKDP--CF--------------------GFVNWFSGNNYPV-CSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKE-----SERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTN-DFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSL 6995
            E    IV K+L  R+V      +       E EE+++KY+ +SY+HCEW + S+   D     KLKR+K    ++ +   +DE  FNPDYVE+DR+L+               +D  N E ++YYLVKW SLPYE+ TWE  EDVD  K++E+ +R    + E   + +P    WK + +   YKN N LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSIAFL E++N G  GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D      P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE S+F  ES+FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LI GAEE IL  F                II ++     +MV S+GKLVLI KLLPKLK   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +     I Q SKKEIEDLL+ GAY ++M++D +G KFCEEDID+ILL R+T I + +  + S+F+KASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +   STL D+                                             E  D E++D     ++  DR+      D F+ EK LL +GWGRW   L    FK  ++ +++E++CR IL Y   HY GD+ I SFI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N                             P ++  D S             +++H++   +K+L R++ LY+L  E+IG ++A+ +L     ++I  +     F  +D   +P +WW++  DK L++G+FKHG+EKY+ +  DP  CF                     F +   G ++   C D E   K  + P  +  D  + + + +   +     + + ++      +P  + L  RLR+++ ++Q+ +++++     +ER       +  + A    E+        K  +W+RRE+T+FYR +++FG+E   +  +  W  FR    L +K++ESLT+YF  F  MC+++C+  P   D+  +  L +E I+ ERA+R L +I ++ ++R +++ HP +E R+ LC+    + P WW    HD  +L+G +++G ++T+  I+ D +  F    ++ + Q  QA + + SL
Sbjct:  640 EEDAAIVDKVLSMRVVKK----ELPSGQYTEAEEFFVKYKNYSYLHCEWATISQLEKDKRIHQKLKRFKTKMAQMRHFFHEDEEPFNPDYVEVDRILDESH-----------SVDKDNGEPVIYYLVKWCSLPYEDSTWELKEDVDEGKIREF-KRIQSRHPELRRVNRPQANAWKKLELSHEYKNRNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQEVYNVGIHGPFLVIAPLSTITNWEREFNTWTEMNTIVYHGSLASRQMIQQYEMYCKDSRGRLIPGAYKFDALITTFEMILSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSQFPSESEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLSKGAGHTNMPNLLNTMMELRKCCNHPYLINGAEEKILMEFREAC-----------HIIPQD-FHLQAMVRSAGKLVLIDKLLPKLKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDGNITGIQQFSKKEIEDLLRKGAYAAIMEEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFAKASFVASENRTDISLDDPNFWQKWAKKADLDMDLLNSKNNLVIDTPRVRKQTRHF---STLKDDDL------------------------------------------VEFSDLESEDDERPRSRRHDRHHTYGRTDCFRVEKHLLVYGWGRWRDILSHGRFKRRMTERDVETICRAILVYCLLHYRGDENIKSFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKVKSQSTFDIHKADWIRKYN-----------------------------PDTLFQDES-------------YKKHLKHQCNKVLLRVRMLYYLRQEVIG-DQAEKVLGGAIASEIDIW-----FPVVDQLEVPTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLEKAGRPDDKAIAAEHRVLDNFSDLVEGIDFDKDCEDPE--YKPLQGPPKDPDDEGDPLMMMDEEISVIDGEEAQVTQQPGHLFWPPGSALTARLRRLVTAYQRSYKREQMKMEAAERG--DRRRRRCEAAFKLKEIARRE----KQQRWTRREQTDFYRVVSTFGVEYDPDNMQFHWDRFRTFARLDKKTDESLTKYFHGFVAMCRQVCRLPPAAGDEPPDPNLFIEPITEERASRTLYRIELLRRLREQVLCHPLLEDRLALCQPPGLELPKWWEPVRHDGELLRGAARHGVSQTDCNIMQDPDFSFLAARMNYM-QNHQAGASAASL 1979          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|Q3L8U1|CHD9_HUMAN (Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=2)

HSP 1 Score: 1147.11 bits (2966), Expect = 0.000e+0
Identity = 643/1437 (44.75%), Postives = 874/1437 (60.82%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLW--RQKESERNKIKTNYQSLDP----ALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL SR V   +S G+        + EE+++KY+ +SY+HCEW + E ++ D     K+KR+K     + +   + +E  FNPDYVE+DRVLE         CE     D    E ++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +  +W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F              N    +  LQ  +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  ES    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D   I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +  +               R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RG   RKG         KK      + +I++    +E +   + EQ                          L    +++HI+   +K+L R++ LY+L  E+IG E  Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    +   +  E DK   +PT + L  RLR++I ++Q+    RQ +  +         + P    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K+++SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  686 EEDAAIVDKILSSRTVKKEISPGV------MIDTEEFFVKYKNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLEVS------FCE-----DKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRRLDRPPSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRD----------TYNPAASDFHLQ--AMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGD---------------------------EKPKLRRPCDRSNG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRG---RKG---------KKVKTQTSSFDIQK----AEWLRKYNPEQ-------------------------LLQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNE-CQKVFDGVDASDIDVWVPEP------DHSEVPAEWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGDGQLMEGDKVY-WPTQSALTTRLRRLITAYQRTNKNRQIQQIQPTFSVPTSVMQPIYEEATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVSRTDYHILRDPELSF 1994          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|B5DE69|CHD8_XENTR (Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis OX=8364 GN=chd8 PE=2 SV=2)

HSP 1 Score: 1145.95 bits (2963), Expect = 0.000e+0
Identity = 625/1446 (43.22%), Postives = 873/1446 (60.37%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE---SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSG---------------NNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD--------FPTNAELNIRLRKIIGSFQKLWRQK----ESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R+          +    EVEEY++KY+ +SY+HCEW + E +  D     KLKR+K    ++ +  ++DE  FNPDYVE+DR+L+                D  N E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ +R          + +P   +WK + + R Y+NGN LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSI FL E++N G +GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D +    P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E++FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FL+KG S +N PNL+NTMMELRKCCNHP+LI GAEE I++ F   T +      +Q            +MV SSGKLVLI KLLPKL+   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G +RQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +   S PI Q +KKEIEDLL+ GAY ++MD+D +G KFCEEDID+ILL R+T I + +  + S+FSKASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +        E S  ES+                                            +DD      QD      R D F+ EK LL +GWGRW   L    FK  ++ +++E +CR IL Y   HY GD+ I SFI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N +     E                                           +++H++   +K+L R++ LYFL  E+IG  +A  +L+      I  +     F  +D   +PS WW+   DK L++G+FKHG+EKY+ +  DP   F+    G               +  P   D ++++   ++P +  L +Q+  E  +  D+  ++  ++ S +D ++         +P  + L  RLR++I ++Q+ ++++    E+E    K   +  + A    E+        K  +W+RRE  +F+R ++SFG+E   +T    W  FR    L +K++ESL +YF  F  MC+++C+  P   D+  + +L +E IS ERA+R L +++++ ++R +++ HP +  R+ LC    + P WW +G HD  +L+G ++YG +RT++ I+ D    F
Sbjct:  582 EEDAAIVDKILSMRLAKKELPTGEYV----EVEEYFVKYKNYSYLHCEWATIEQLERDKRIHQKLKRFKTKMTQMQHFLQEDEESFNPDYVEVDRILDESH-----------STDKDNGEPVVYYLVKWCSLPYEDSTWELKEDVDDGKIEEF-KRIEARQPNLKRVARPAATSWKKLELSREYQNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSITFLQEVYNVGIRGPFLVIAPLSTITNWEREFGSWTQMNTIVYHGSLASRQMIQQYEMYCKDSKGRLIPGAYKFDALITTFEMVLSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPTQFSSEAEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLTKGASQSNTPNLLNTMMELRKCCNHPYLITGAEEKIISEFREATPVVPPDFHVQ------------AMVRSSGKLVLIDKLLPKLRAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNMRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDNHLSGPIQQFTKKEIEDLLRKGAYAAIMDEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFSKASFVASENRTDISLDDPNFWQKWAKKADLDLDLLSSKNTLVIDTPRIRKQTRHFTNKDDDMVEFSDLESD--------------------------------------------DDDRPKARRQDRKHGYGRTDCFRVEKHLLVYGWGRWRDILTHGRFKRGMNERDVEKICRAILVYCLLHYRGDENIKSFIWDLITPAENGKTKQLQNHSGLSIPVPRGRKGKKVKSQSSFDIHKADWIHKYNPDTLFQDE------------------------------------------GYKKHLKHQCNKVLLRVRMLYFLRQEVIG-NQAMKVLSGVEARQIDIW-----FPQVDQVEVPSRWWDREADKSLLIGVFKHGYEKYNTMRADPALCFLEKVGGPDEQAIAAEHHAQDFSELPDGGDFDRDI---EDPEYKPLHAQKDPE--DEIDSLMMD--EEISVVDGEEATAMPSGMLWPPGSALTARLRRLITAYQRSYKREQLKLEAEERGDKRR-KRCEAAFKLKEIARRE----KQQRWTRREACDFFRVLSSFGVEYDPDTQLYDWQRFRGLARLDKKTDESLLKYFHGFVAMCRQVCRLPPAAGDEPPDPSLFIEPISEERASRALFRLDLLRRVREQVLCHPLLIPRLSLCRPDPELPEWWESGRHDNELLQGAARYGLSRTDLTILQDHAFSF 1895          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|Q8BYH8|CHD9_MOUSE (Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus OX=10090 GN=Chd9 PE=1 SV=2)

HSP 1 Score: 1142.87 bits (2955), Expect = 0.000e+0
Identity = 631/1440 (43.82%), Postives = 875/1440 (60.76%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI-DPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGF-PELKLFTYLDSDYLPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESER---------NKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPL---LYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    IV KIL  R V   VS G+        ++EE+++KY+ +SY+HCEW + + ++ D     K+KR+K     + + L + +E  FNPDYVE+DR+LE             F  D    E+++YYLVKW SLPYE+ TWE  EDVD AK++E+ Q  + +  +   L +P    WK I   R YKNGN LR+YQLEG+NWL F W   RNCILADEMGLGKTIQSI FL E+   G +GPFLII PLST+ NW+REF  W+++N+++YHGS  SR++IQ+YE +  D +         F AIITT+E++L      +   W   IIDEAHRLKNK CKL+EGL++++L+ +VLLTGTPLQN V+ELF+LL+FLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL  F    D  N +                +M+ S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI+++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  +S    I QLSKKEIEDLL+ GAYG++M+++ +G KFCEEDID+ILL R+  I + +  R S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D + I   NSL++D PR+R+QT  +        E+S  ES G                            + P    P +                  R + F+ EK LL +GWGRW   L    FK  ++  ++E +CR +L Y   HY GD++I  FI DL+ P  D  T  ++ HLG SAPV RGR                           +  ++    ++ D ++++     + P  +  D               +++H++   +K+L R++ LY+L  E+IG E +Q + +  + +DI  + PE       D   +P+ WW+   DK L++G+FKHG+EKY+ I  DP   F+                 N+Y     D ++ +    P+  K D ++  +++   D    + + +  E DK   +PT + L  RLR++I ++Q+  + +  ++         N ++  Y+    A L P+M + +    +  +W+RREE +FYR +++FG+    +  +  WT FR    L +K++ SL +Y  AF +MC+++C R P    L D N  + ++ I+ ERA+R L +I ++ K+R + + HP++ +R+KLC    D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  685 EEDAAIVDKILACRTVKKEVSPGV------MLDIEEFFVKYKNYSYLHCEWATEQQLLKDKRIQQKIKRFKLRQAQRAHFLADMEEEPFNPDYVEVDRILEVS-----------FCEDKDTGESVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQA-SRPDTRHLDRPPSNIWKKIEQSREYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIDWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFR---DTYNPSA---------SDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRDSNVSGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAELDIDTISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGE---------------------------EKPKLRRPCDRSGG------------YGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEVICRALLAYCLIHYRGDEKIKGFIWDLITPTEDGQTRELQNHLGLSAPVPRGR---------------------------KGKKVKTQTSSFDIQKAEWLRKYN-PEQLLQDE-------------GYKKHVKHHCNKVLLRVRMLYYLKQEVIGNE-SQKVFDGVDASDIDVWVPEP------DHSEVPAAWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDDKAVAAEQRANDY--MDGDVEDPEYKPAPAIFKDDIED--DVSSPGDLVIADGEGQLMEGDKVY-WPTPSALTTRLRRLITAYQRTNKNRHIQQMQPTFSLPANAMQPLYEE---ATLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPDRGQFDWTKFRALARLHKKTDNSLEKYLCAFMSMCRRVC-RLPSKEELVDPN--IFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPIWWECGSHDRDLLIGAAKHGVSRTDYHILRDPELSF 1993          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|Q9HCK8|CHD8_HUMAN (Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=5)

HSP 1 Score: 1136.32 bits (2938), Expect = 0.000e+0
Identity = 629/1468 (42.85%), Postives = 883/1468 (60.15%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKS-SESVIDPAFPSKLKRYKN--LKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES--KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRY------DLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLP-SWWNTTVDKCLVLGIFKHGWEKYDDIYKDP--CF--------------------GFVNWFSGNNYPV-CSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDG---KTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTN-DFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSL 6995
            E    IV K+L  RIV      +       E EE+++KY+ +SY+HCEW + S+   D     KLKR+K    ++ +   +DE  FNPDYVE+DR+L+               +D  N E ++YYLVKW SLPYE+ TWE  EDVD  K++E+ +R    + E   + +P    WK + +   YKN N LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSIAFL E++N G  GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D      P    F+A+ITT+E++LSD     + +W   IIDEAHRLKN+ CKL++ L+ +DL+ +VLLTGTPLQN V+ELF+LL+FLE S+F  ES+FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILE+NF+FLSKG    N+PNL+NTMMELRKCCNHP+LI GAEE IL  F                II  +     +MV S+GKLVLI KLLPKLK   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  +     I Q SKKEIEDLL+ GAY ++M++D +G KFCEEDID+ILL R+T I + +  + S+F+KASF  ++NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT  +   STL D+                                             E  D E++D     ++  DR+      D F+ EK LL +GWGRW   L    FK  ++ +++E++CR IL Y   HY GD+ I  FI DL+ P  +  T  ++ H G S PV RGR+G+K   +    I K D I   N                             P ++  D S             +++H++   +K+L R++ LY+L  E+IG ++A+ +L     ++I  +     F  +D   +P +WW++  DK L++G+FKHG+EKY+ +  DP  CF                     F +   G ++   C D E   K  + P  ++ D  + + + +   +     + + ++      +P  + L  RLR+++ ++Q+ +++   E+ KI+   +  D      E    +       K  +W+RRE+T+FYR +++FG+E   +T +  W  FR    L +K++ESLT+YF  F  MC+++C+  P   D+  +  L +E I+ ERA+R L +I ++ ++R +++ HP +E R+ LC+    + P WW    HD  +L+G +++G ++T+  I+ D +  F    ++ + Q  QA + + SL
Sbjct:  638 EEDAAIVDKVLSMRIVKK----ELPSGQYTEAEEFFVKYKNYSYLHCEWATISQLEKDKRIHQKLKRFKTKMAQMRHFFHEDEEPFNPDYVEVDRILDESH-----------SIDKDNGEPVIYYLVKWCSLPYEDSTWELKEDVDEGKIREF-KRIQSRHPELKRVNRPQASAWKKLELSHEYKNRNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQEVYNVGIHGPFLVIAPLSTITNWEREFNTWTEMNTIVYHGSLASRQMIQQYEMYCKDSRGRLIPGAYKFDALITTFEMILSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSQFPSESEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLSKGAGHTNMPNLLNTMMELRKCCNHPYLINGAEEKILTEFREAC-----------HIIPHD-FHLQAMVRSAGKLVLIDKLLPKLKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDGNITGIQQFSKKEIEDLLRKGAYAAIMEEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFAKASFVASENRTDISLDDPNFWQKWAKKADLDMDLLNSKNNLVIDTPRVRKQTRHF---STLKDDDL------------------------------------------VEFSDLESEDDERPRSRRHDRHHAYGRTDCFRVEKHLLVYGWGRWRDILSHGRFKRRMTERDVETICRAILVYCLLHYRGDENIKGFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKVKSQSTFDIHKADWIRKYN-----------------------------PDTLFQDES-------------YKKHLKHQCNKVLLRVRMLYYLRQEVIG-DQAEKVLGGAIASEIDIW-----FPVVDQLEVPTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLEKAGRPDDKAIAAEHRVLDNFSDIVEGVDFDKDCEDPE--YKPLQGPPKDQDDEGDPLMMMDEEISVIDGDEAQVTQQPGHLFWPPGSALTARLRRLVTAYQRSYKR---EQMKIEAAERG-DRRRRRCEAAFKLKEIARREKQQRWTRREQTDFYRVVSTFGVEYDPDTMQFHWDRFRTFARLDKKTDESLTKYFHGFVAMCRQVCRLPPAAGDEPPDPNLFIEPITEERASRTLYRIELLRRLREQVLCHPLLEDRLALCQPPGPELPKWWEPVRHDGELLRGAARHGVSQTDCNIMQDPDFSFLAARMNYM-QNHQAGAPAPSL 1977          
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Match: sp|Q06A37|CHD7_CHICK (Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus OX=9031 GN=CHD7 PE=2 SV=1)

HSP 1 Score: 1134.4 bits (2933), Expect = 0.000e+0
Identity = 630/1461 (43.12%), Postives = 883/1461 (60.44%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKNLKINN--LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE--SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCS---------------------DDEKNMKKNKNPSFNKLD---SQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLW-RQKESERNKIKTNYQSLDPALLTPEMNSHMNN--DGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNN---TLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVS 6992
            +++  +V+KI+ SR V              E+EE+Y+KY+ FSY+HC+W S E +  D     K+KR+K  +  N  L E D+ LFNPDYVEIDR+L+      ++  ++       N E + +YLVKW SLPYE+ TWE  +D+D AK++E+ +  S    E   + +P   +WK     R YKN N LR+YQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E++  G  GPFL+I PLST+ NW+REF  W+ LN+++YHGS  SR+ IQ YE +  D +         F+AIITT+E++L+D        W   +IDEAHRLKN+ CKL+EGL+M+DL+ +VLLTGTPLQN V+ELF+LL+FLE  +F  E+ F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPKEE ++EVELTNIQKKYYRAILE+NF FLSKG    N+PNL+NTMMELRKCCNHP+LI GAEE IL  F             +    D    Q  +M+ ++GKLVLI KLLPKLK   H+VLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  E  +  + QLSKKEIEDLL+ GAYG+LMD++ +G KFCEEDID+ILL R+  I + +  + S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D + +   N+L++D PR+R+QT        LY  +  DE    + + S                              SE K +         +Q   R + F+ EK LL +GWGRW   L    +K  ++ +++E++CRTIL Y   HY GD+ I SFI DL+ P +D  T  +  H G SAPV RGR+G+K     + A + + M+                      + +D  T  +  V    D              ++R+H++   +K+L R++ LY+L  E+IG ++A  IL   + +++    ++ +     ++    WW+   DK L++G+FKHG+EKY+ +  D    F+      +    +                     D++   K  + P  +++D   +    +  ES +       + NSE+ +   +P  + L  RLR++I ++Q+ + RQ+  +   +KT+ +   P      + +        K  KW+RREE +FYR +++FGI       +  W  FR    L +KS+ESL +YF  F  MC+++C R P+  DD     +  +E I+ ERA+R L +I ++ KIR +++ HP++ +R+KLC+ + D P WW  G HD  +L G +K+G +RT+  I++D  L F +   +  + +   N+ +VS
Sbjct:  797 DAEGPVVEKIMSSRSVKKK----MENGEEVEIEEFYVKYKNFSYLHCQWASVEELDKDKRIQQKIKRFKAKQGQNKFLSEIDDELFNPDYVEIDRILD-----FSRSTDD-------NGEPVTHYLVKWCSLPYEDSTWELKQDIDQAKIEEFEKLMSRE-PEMERVERPPADDWKKSESSREYKNNNKLREYQLEGVNWLLFNWYNTRNCILADEMGLGKTIQSITFLYEIYLKGIHGPFLVIAPLSTIPNWEREFRTWTELNVVVYHGSQASRRTIQLYEMYFKDPQGRVIKGSYKFHAIITTFEMILTDCPELRNIPWRCVVIDEAHRLKNRNCKLLEGLKMMDLEHKVLLTGTPLQNTVEELFSLLHFLEPGRFPSETTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKEETIIEVELTNIQKKYYRAILEKNFAFLSKGGGQANVPNLLNTMMELRKCCNHPYLINGAEEKILEEFK------------ETHNADSPDFQLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQMVRCLDILEDYLIQRRYPYERIDGRVRGNLRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKSVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRENATNGVQQLSKKEIEDLLRKGAYGALMDEEDEGSKFCEEDIDQILLRRTHTITIESEGKGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAELDIDALNGRNNLVIDTPRVRKQTR-------LYSAVKEDE----LMEFSDLESD-------------------------SEEKPSTKPRRPQDKSQGYARSECFRVEKNLLVYGWGRWTDILSHGRYKRQLTEQDVETICRTILVYCLNHYKGDENIKSFIWDLITPTADGQTRALVNHSGLSAPVPRGRKGKK-----VKAQSSQPML----------------------QDADWLTTCNPDVLFQED--------------SYRKHLKHHCNKVLLRVRMLYYLRQEVIG-DQADRILEGADSSEV----DVWIPEPFHAEVPADWWDKEADKSLLIGVFKHGYEKYNSMRADSTLCFLERVGMPDAKAIAAEQRGTDMLADGGDGGEFDREDEDPEYKPTRTPFKDEIDEFANSPPEDKEESIEIHPNKHSESNSELGQL-YWPNTSTLTTRLRRLITAYQRSYKRQQMRQEALMKTDRRRRRPREEVRALEAEREAIITEKRQKWTRREEADFYRVVSTFGIIFDPIKHQFDWNQFRAFARLDKKSDESLEKYFNGFVNMCRRVC-RMPVKPDDEPPDLSTMIEPITEERASRTLYRIELLRKIREQVLHHPQLGERLKLCQPSLDLPEWWECGKHDKDLLIGAAKHGVSRTDYHILNDPELSFLEAHKNFAQNRGTGNANTVS 2144          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A0R3SA09 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1145 PE=4 SV=2)

HSP 1 Score: 1285.78 bits (3326), Expect = 0.000e+0
Identity = 715/1552 (46.07%), Postives = 946/1552 (60.95%), Query Frame = 3
Query: 2835 YYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRY--KNLKINNLEEQDE---CLFNPDYVEIDRVLESK---------------------------QIEVNKK---------CENEFDLDFVNKE----------------TIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQ-----RNSYAYTE-NSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQP-------------HKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEI-CNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSI-FDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKH----------TQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHR-----HYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAP--VARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFT-NISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNT-NYTDIPGFPE-LKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGN---NYPVCSDDEKNMKKNKNPSFNKLDSQET-MEIAESTDTTQLNSKDKNSEIDKKDD-------------------------------FPTNAELNIRLRKIIGSFQKLWRQKESER-NKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEK-----HSETDEII----------WTNFRNACNLPRKSNESLTEYFKAFYTMCQKIC-----QRYPLLYDD------------NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSV 6989
            +Y+KY+GFSY+HCEWK+ + + DP F +KLK++  KN   ++  ++DE    LFNPDYVE++RVL+ +                           Q + NKK          E + + D  N                  T+ YYLVKWRSLPYE  TWE +EDVDP KVKEY++     +NS    + N  +I+P    W+ IT+D VY+N N LR+YQ+EGVNWL++CW   RNCILADEMGLGKT+QSIAFL+E+   G  GPFLIIVPLST+GNWQREFE WS+LN I+YHGS+ SRK+IQ YE F    + S               H +  FNAIITT+EVL+SD+ FFSK  WA +IIDEAHRLKNK+CKL EGLR LD   RVLLTGTPLQNNV+ELF LLNFL+  +F C + FL+++G L++EEQV  LK LL+PMMLRRLKEDVEKSLAPKEE ++EVELTN+QKKYYRAI+ERNF FL KG +G+N+PNL+N MMELRKCCNHPFLIKGAEEAIL    S  +         +K  +EE   F +M+ +SGKLVLIHKLLPKLK   HKVL+FSQM+RVLDILEDYL+Y+ + YERIDGRIHGLLRQEAIDRF +D EKF+FLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQK+V VYRLITRNTYEREMFDRASLKLGLDKA+LQS      +  +QLSKKE+E+LLK GAYG+LMDDDK G+ FCEEDID+IL SRS V++L   E+NS+FSKA+FSI+D R+DI LDDP+FWQKWAKKAGV++  +    LIM  PR RRQTNRY        E++   +N S+   +S +   +       N +       S   +   +     N    SKH           ++ +R DLF+ EKCL  + WGRW +AL+ I +K   +  EL+ + R IL YA +     + SGD RI + I + M+  SD NT+K     + P  V   +     +    S++ ++       R     +  S           DV T     P SV  ++ D G     +   +F+RH+ R   +LL R+  LYFL+ EI+G+E+A  + + T ++T      E L     LD+D    WW++  DKCL+LG+FKHGWEKY  I  DP F F     G    N P+ S            +   L + ET  E +E+  T +L  KD + E    ++                               FPT  +LN R+RK+I  FQ++  Q E E  + ++T +       +TP+  S+++   +  KWSRREE +FYR ++SFG+E+     H     ++          WTNF+   NL +K+++++TEY+ AF+TMC ++C     +  PL                N  + V  IS ERA R L +I ++++IRN I+ H  +E+R+ LC+ ++D P WW+ G HD  +L+ ++++G +RT++ I+ D    F + +  L+R+Q   N  ++
Sbjct:  766 FYVKYKGFSYMHCEWKALDEIEDPRFGTKLKKFLAKNGGNDSQPDEDEGTTVLFNPDYVEVERVLDIRIYDKTTGEIVTDEVLNPDGTIKRQPRSQKKTNKKRGRPPKSATKEEDTEDDITNTPETVESDAQEEEDEQPTTVTYYLVKWRSLPYEHCTWELAEDVDPTKVKEYMRIRNPPKNSPVIRDSNHRIIRPDPSEWRSITIDEVYRNDNRLREYQVEGVNWLSYCWYNKRNCILADEMGLGKTVQSIAFLLEVLKAGVNGPFLIIVPLSTVGNWQREFENWSDLNAIVYHGSSVSRKMIQDYELFYFKKKPSGSSSSLSTLSSALYRHDVYKFNAIITTFEVLMSDIEFFSKMHWAVAIIDEAHRLKNKKCKLGEGLRYLDFDHRVLLTGTPLQNNVEELFGLLNFLDPQRFGCATTFLTEFGELKTEEQVEDLKKLLKPMMLRRLKEDVEKSLAPKEETIIEVELTNLQKKYYRAIMERNFNFLCKGTTGSNMPNLINVMMELRKCCNHPFLIKGAEEAILAEQRSQAEED------PSKPYNEEQQMFNAMLNASGKLVLIHKLLPKLKAGGHKVLVFSQMIRVLDILEDYLVYQGFSYERIDGRIHGLLRQEAIDRFCNDKEKFIFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKMVKVYRLITRNTYEREMFDRASLKLGLDKAVLQSTGANARQ--AQLSKKEVEELLKKGAYGALMDDDKAGDDFCEEDIDQILQSRSHVVQLEQGEKNSTFSKATFSISDTRNDIALDDPDFWQKWAKKAGVEQVGLEYEDLIMTTPRQRRQTNRYT------AELNEQAANNSLSHAASSSRLQNGKNGAGSNGESSDGQSSSDESSGGDDDGGEGNGTGKSKHKKSKRNQRGDAENTNRVDLFRVEKCLFTWSWGRWAYALDNIPYKQIFTELELQRVARCILGYALKGPQVLNASGDGRIRAVIME-MVNSSDPNTLK-----TIPDIVQALKNSNNAVAGGGSSVIRRSRKPGGPRETDSPNAPSTPTTPNTNITFDVDTPKQEDPESVKREDDDYG-----IASDSFKRHLARAGGRLLVRVYILYFLHTEIVGLEQADRLCDGTLDHTAFSQLAESLPPLRALDADVPAEWWDSCCDKCLLLGVFKHGWEKYAAIRDDPAFCFYKRVYGQDAPNIPIPS------------TVGSLKTVETKTEQSEAGSTVKLEEKDNDEEKSLTNEVEKTLAEDSMKESSAKVMGEGDIELPQPLLLFPTAVDLNSRMRKLIAYFQRIRAQVEMEALHSLRTEFA----PTITPQ--SYLD---QRIKWSRREEADFYRVVSSFGVEQIMRSPHQSPTSLVSRARVFAGYNWTNFKGLANLSKKNDQAITEYYNAFFTMCHRVCKEPLPESTPLPVASQPTTTTFGSCAVNEVIPVAPISEERATRTLSRIKLLNRIRNVILTHEHLEERLALCQRSSDLPEWWVPGQHDRELLEAVARHGLSRTDLNILPDKKFSFSR-VAALVRRQLMKNPSAL 2270          

HSP 2 Score: 92.0485 bits (227), Expect = 3.068e-14
Identity = 51/134 (38.06%), Postives = 79/134 (58.96%), Query Frame = 3
Query: 8052 IPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMS-----TMLASQSPLNIYNSFLLSGEGSKNSLPDEQMNN--ASSFYM--QQYQDCLLSMLG 8426
            +P++++ NG LI+ + APKR++LE++L  N  YMPYSVE+EDQ IF +VA++RGQ T  +EA+ +  YM+ M+S     T  ++Q P    ++        +     +QM N  A+S Y     Y   L SM+G
Sbjct: 2612 VPLVSLTNGNLIHGDKAPKRRHLEAWLKANPEYMPYSVEQEDQIIFKRVAQSRGQNTSAMEALAYRHYMSTMLSKVVNYTASSTQRPTPSTSTATSDAAAEQQ----KQMMNLIAASMYSGNPAYATLLASMMG 2741          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A564YVD8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10016 PE=4 SV=1)

HSP 1 Score: 1284.24 bits (3322), Expect = 0.000e+0
Identity = 715/1552 (46.07%), Postives = 946/1552 (60.95%), Query Frame = 3
Query: 2835 YYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRY--KNLKINNLEEQDE---CLFNPDYVEIDRVLESK---------------------------QIEVNKK---------CENEFDLDFVNKE----------------TIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQ-----RNSYAYTE-NSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQP-------------HKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEI-CNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSI-FDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKH----------TQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHR-----HYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAP--VARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFT-NISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNT-NYTDIPGFPE-LKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGN---NYPVCSDDEKNMKKNKNPSFNKLDSQET-MEIAESTDTTQLNSKDKNSEIDKKDD-------------------------------FPTNAELNIRLRKIIGSFQKLWRQKESER-NKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEK-----HSETDEII----------WTNFRNACNLPRKSNESLTEYFKAFYTMCQKIC-----QRYPLLYDD------------NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSV 6989
            +Y+KY+GFSY+HCEWK+ + + DP F +KLK++  KN   ++  ++DE    LFNPDYVE++RVL+ +                           Q + NKK          E + + D  N                  T+ YYLVKWRSLPYE  TWE +EDVDP KVKEY++     +NS    + N  +I+P    W+ IT+D VY+N N LR+YQ+EGVNWL++CW   RNCILADEMGLGKT+QSIAFL+E+   G  GPFLIIVPLST+GNWQREFE WS+LN I+YHGS+ SRK+IQ YE F    + S               H +  FNAIITT+EVL+SD+ FFSK  WA +IIDEAHRLKNK+CKL EGLR LD   RVLLTGTPLQNNV+ELF LLNFL+  +F C + FL+++G L++EEQV  LK LL+PMMLRRLKEDVEKSLAPKEE ++EVELTN+QKKYYRAI+ERNF FL KG +G+N+PNL+N MMELRKCCNHPFLIKGAEEAIL    S  +         +K  +EE   F +M+ +SGKLVLIHKLLPKLK   HKVL+FSQM+RVLDILEDYL+Y+ + YERIDGRIHGLLRQEAIDRF +D EKF+FLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQK+V VYRLITRNTYEREMFDRASLKLGLDKA+LQS      +  +QLSKKE+E+LLK GAYG+LMDDDK G+ FCEEDID+IL SRS V++L   E+NS+FSKA+FSI+D R+DI LDDP+FWQKWAKKAGV++  +    LIM  PR RRQTNRY        E++   +N S+   +S +   +       N +       S   +   +     N    SKH           ++ +R DLF+ EKCL  + WGRW +AL+ I +K   +  EL+ + R IL YA +     + SGD RI + I + M+  SD NT+K     + P  V   +     +    S++ ++       R     +  S           DV T     P SV  ++ D G     +   +F+RH+ R   +LL R+  LYFL+ EI+G+E+A  + + T ++T      E L     LD+D    WW++  DKCL+LG+FKHGWEKY  I  DP F F     G    N P+ S            +   L + ET  E +E+  T +L  KD + E    ++                               FPT  +LN R+RK+I  FQ++  Q E E  + ++T +       +TP+  S+++   +  KWSRREE +FYR ++SFG+E+     H     ++          WTNF+   NL +K+++++TEY+ AF+TMC ++C     +  PL                N  + V  IS ERA R L +I ++++IRN I+ H  +E+R+ LC+ ++D P WW+ G HD  +L+ ++++G +RT++ I+ D    F + +  L+R+Q   N  ++
Sbjct:  766 FYVKYKGFSYMHCEWKALDEIEDPRFGTKLKKFLAKNGGNDSQPDEDEGTTVLFNPDYVEVERVLDIRIYDKTTGEIVTDEVLNPDGTIKRQPRSQKKTNKKRGRPPKSATKEEDTEDDITNTPETVESDAQEEEDEQPTTVTYYLVKWRSLPYEHCTWELAEDVDPTKVKEYMRIRNPPKNSPVIRDSNHRIIRPDPSEWRSITIDEVYRNDNRLREYQVEGVNWLSYCWYNKRNCILADEMGLGKTVQSIAFLLEVLKAGVNGPFLIIVPLSTVGNWQREFENWSDLNAIVYHGSSVSRKMIQDYELFYFKKKPSGSSSSLSTLSSALYRHDVYKFNAIITTFEVLMSDIEFFSKMHWAVAIIDEAHRLKNKKCKLGEGLRYLDFDHRVLLTGTPLQNNVEELFGLLNFLDPQRFGCATTFLTEFGELKTEEQVEDLKKLLKPMMLRRLKEDVEKSLAPKEETIIEVELTNLQKKYYRAIMERNFNFLCKGTTGSNMPNLINVMMELRKCCNHPFLIKGAEEAILAEQRSQAEED------PSKPYNEEQQMFNAMLNASGKLVLIHKLLPKLKAGGHKVLVFSQMIRVLDILEDYLVYQGFSYERIDGRIHGLLRQEAIDRFCNDKEKFIFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKMVKVYRLITRNTYEREMFDRASLKLGLDKAVLQSTGANARQ--AQLSKKEVEELLKKGAYGALMDDDKAGDDFCEEDIDQILQSRSHVVQLEQGEKNSTFSKATFSISDTRNDIALDDPDFWQKWAKKAGVEQVGLEYEDLIMTTPRQRRQTNRYT------AELNEQAANNSLSHAASSSRLQNGKNGAGSNGESSDGQSSSDESSGGDDDGGEGNGTGKSKHKKSKRNQRGDAENTNRVDLFRVEKCLFTWSWGRWAYALDNIPYKQIFTELELQRVARCILGYALKGPQVLNASGDGRIRAVIME-MVNSSDPNTLK-----TIPDIVQALKNSNNAVAGGGSSVIRRSRKPGGPRETDSPNAPSTPTTPNTNITFDVDTPKQEDPESVKREDDDYG-----IASDSFKRHLARAGGRLLVRVYILYFLHTEIVGLEQADRLCDGTLDHTAFSQLAESLPPLRALDADVPAEWWDSCCDKCLLLGVFKHGWEKYAAIRDDPAFCFYKRVYGQDAPNIPIPS------------TVGSLKTVETKTEQSEAGSTVKLEEKDNDEEKSLTNEVEKTLAEDSMKESSAKVMGEGDIELPQPLLLFPTAVDLNSRMRKLIAYFQRIRAQVEMEALHSLRTEFA----PTITPQ--SYLD---QRIKWSRREEADFYRVVSSFGVEQIMRSPHQSPTSLVSRARVFAGYNWTNFKGLANLSKKNDQAITEYYNAFFTMCHRVCKEPLPESTPLPVASQPTTTTFGSCAVNEVIPVAPISEERATRTLSRIKLLNRIRNVILTHEHLEERLALCQRSSDLPEWWVPGQHDRELLEAVARHGLSRTDLNILPDKKFSFSR-VAALVRRQLMKNPSAL 2270          

HSP 2 Score: 92.4337 bits (228), Expect = 2.822e-14
Identity = 51/134 (38.06%), Postives = 79/134 (58.96%), Query Frame = 3
Query: 8052 IPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMS-----TMLASQSPLNIYNSFLLSGEGSKNSLPDEQMNN--ASSFYM--QQYQDCLLSMLG 8426
            +P++++ NG LI+ + APKR++LE++L  N  YMPYSVE+EDQ IF +VA++RGQ T  +EA+ +  YM+ M+S     T  ++Q P    ++        +     +QM N  A+S Y     Y   L SM+G
Sbjct: 2612 VPLVSLTNGNLIHGDKAPKRRHLEAWLKANPEYMPYSVEQEDQIIFKRVAQSRGQNTSAMEALAYRHYMSTMLSKVVNYTASSTQRPTPSTSTATSDAAAEQQ----KQMMNLIAASMYSGNPAYATLLASMMG 2741          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A0R3WBE1 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7954 PE=4 SV=2)

HSP 1 Score: 1222.99 bits (3163), Expect = 0.000e+0
Identity = 707/1638 (43.16%), Postives = 956/1638 (58.36%), Query Frame = 3
Query: 3063 LDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQ-RNS-----YAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQP------------------HKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEI-CNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHT-----------------------------QDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHR-----HYSGDDRIYSFIEDLMLPESDSNTMK--RHLGYSAPVARGR---RGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGD-----------NSDNGSEFS-----------ALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLI----LNNTNYTDIP-GFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSD-----------------DEKNMKKNKNPSFNKLDSQ------ETMEIAESTDTTQ------LNSKDKNSEIDKKDDFPTN-------AELNIRLRKIIGSFQKLWRQKESER-NKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEK------HSET-------DEII----WTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQR-------YPLLYDDNNT----------LEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIENCLDESDASSNFMLEKADELIYEDTFNNLIVQIINEFIDQLD------SVKKETDT---------------DYCENIS----NNDDITFDISVLS--------------KIGWPKERILFSRLELIVQTIEKGEWPFSK 7370
            LD     T+ YYLVKWRSLPYE+ TWE +EDVDPAKVKEY++ RN           N ++I+P    W+PIT D VY+N N LR+YQ+EGVNWL+FCW   RNCILADEMGLGKT+QSIAFL+E+   G  GPFLIIVPLST+GNWQREFE WS+LN I+YHGSA SR +IQ+YE F    ++S                    H +  FN +ITT+EVL+SD+ FF K  WA +IIDEAHRLKNK+CKL EGLR LDL  RVLLTGTPLQNNV+ELF LLNFLE  +F C S FL+++G L++E+QV  LK LL+PMMLRRLKEDVEKSLAPKEE ++EVELTN+QKKYYRAI+ERNFTFL KG +G+N+PNLMN MMELRKCCNHPFLIKGAEEAIL      ++   + +   +K  +EE   F +M+ +SGKLVLIHKLLPKLK   HKVL+FSQM+RVLDILEDYL+Y+ + +ERIDGRIHGL+RQEAIDRF +DP+KFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQK+V VYRLITRNTYEREMFDRASLKLGLDKA+LQS      +  +QLSKKE+E+LLK GAYG+LMDDDK G+ FCEEDID+IL SRS V++L   E+NS+FSKA+FSI+DNR+DI LDDP+FWQKWAKKAGV+E  +    LIM  P  R++   ++  + L ++ S          SS  H    ++    N+        S       ES  A++D   S+ +                             + +DR DLF+ EKCL  + WGRW HA++   FK  IS  E++ + R IL YA +        GD R+ + + + M+   D N+++    + +S  V+ G    RG  G    IS+IT    +V      +R       V ++  +  +  +  +TP ++N D             D+  + S            +   +F+RH+ R   +LL R+  LYFL+ EI+G+E A  +    L+++ +T +    P LK    LD+D    WW++  DKCL+LG+FKHGWEKY  I  DP F F     G+N P                     +E+      +P+    +++      +T+ IA    TT         ++ +  E++ +   P          +LN R+RK+I  FQ++  Q E E  + +++           P + +    + +  KWSRREE +FYR ++SFG+E+      HS T       D +     WTNF+   NL +KS++++TEY+ +F TMC ++C          P+      T          + V  IS ERA R L +I ++++IRN I+ H  +E+R+ LC+ ++D P WW+ G HD  +L+ ++++G  RT++ I+ D    F + +  L+R+Q   N  +    ++ ++P       D       I+   L  S+  +   L  A  +        L  +I    + + +      S KKE++T               D    ++    N D  +FD    S               +GWPK+R + +RLE++ Q IE G WP  +
Sbjct: 1007 LDDEQPATVTYYLVKWRSLPYEDATWELAEDVDPAKVKEYMRIRNPPKNPPVIRDSNHKIIRPDPSVWRPITEDEVYRNDNRLREYQVEGVNWLSFCWYNKRNCILADEMGLGKTVQSIAFLLEVVKAGVVGPFLIIVPLSTVGNWQREFENWSDLNAIVYHGSAVSRSMIQEYELFYHRKKASGGSVVALSVSSNNLFSSQYRHDIYKFNVLITTFEVLMSDIEFFGKMHWAVAIIDEAHRLKNKKCKLGEGLRYLDLDHRVLLTGTPLQNNVEELFGLLNFLEPERFACASTFLAEFGELKTEQQVEDLKTLLKPMMLRRLKEDVEKSLAPKEETIIEVELTNLQKKYYRAIMERNFTFLCKGTTGSNMPNLMNVMMELRKCCNHPFLIKGAEEAIL------SEQRVLAEADPSKPYNEEQQMFNAMLNASGKLVLIHKLLPKLKAGGHKVLVFSQMIRVLDILEDYLVYQGFSFERIDGRIHGLMRQEAIDRFCNDPDKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKMVKVYRLITRNTYEREMFDRASLKLGLDKAVLQSTGAHARQ--AQLSKKEVEELLKKGAYGALMDDDKAGDDFCEEDIDQILQSRSHVVQLEQGEKNSTFSKATFSISDNRNDIALDDPDFWQKWAKKAGVEEVGLEFEDLIMTTP--RQRRQTHRYTAELNEQQS---------SSSLTHSQCASRLPNGNNGGGSNAESSDGENSSGESSGADDDGGDSRASGATIGNTASSSKMKHKKSKKSRRNEEGIGESIDRVDLFRVEKCLFTWSWGRWAHAIDCFPFKRAISELEMQRIARCILGYALKVTPALTSGGDARVRAVVME-MINSVDVNSLRTIADVAHSLKVSSGEVPWRGSGG----ISSITSGCGVV-----ARRGRRAGLRVGSLGTDSPNGPSTPTTPTALNFDMDPASTADTPKQEDHSHDISKREEDLDQVDFGITSDSFKRHLVRAGGRLLARVYTLYFLHTEIVGLEHADGLCDGSLDHSVFTQLAESLPPLKA---LDADVPADWWDSCCDKCLLLGVFKHGWEKYFAIRDDPAFCFYRRVYGSNAPSIPIPSTIGTLKGIAGIKVKFEEQEESGEADPTMRPEETEEEDDDEKTLTIAADDITTVTLRPKCAETRPETGEVETETQLPPPLLLFPAVVDLNSRMRKLIAYFQRVRAQVELEAVHNLRSE--------CIPSVTAQPYLEQRIIKWSRREEADFYRVVSSFGVEQVLRSPPHSPTPLRRSGGDRMFVGYNWTNFKVLANLSKKSDQAITEYYNSFLTMCHRVCNEPLPEGMPAPVCSLPTTTTYGSCPADEVIPVAPISEERATRTLSRIKLLNRIRNNILTHEHLEERLALCQRSSDLPEWWVPGRHDRELLQAVARHGLARTDLNILPDKKFSFSR-VSALVRRQLLKNPSA----LHGVSPPTASTSTDA------IVGGSLSVSEVEARASLAAAASVAARAVAAELEAKIDAANVSRTEGSVPFGSAKKESETQGNPVENQPENGGFEDRTNTVASSEPNPDSPSFDAKSTSNEHFKWSLQFATSLAVGWPKDRAIHNRLEMVCQCIETGHWPLPR 2593          

HSP 2 Score: 95.5153 bits (236), Expect = 3.115e-15
Identity = 41/77 (53.25%), Postives = 60/77 (77.92%), Query Frame = 3
Query: 8043 ETIIPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMS 8273
            E  +P+I++ NG LI+ E APKR++LE++L  + +YMPYSVE EDQ IFN+VAKARGQ+T  +EA+ +  YM+ ++S
Sbjct: 2789 EVNVPLISLVNGNLIHGEKAPKRRHLEAWLEAHPDYMPYSVEPEDQVIFNRVAKARGQDTSAMEALAYRHYMSSVLS 2865          

HSP 3 Score: 71.633 bits (174), Expect = 4.972e-8
Identity = 32/69 (46.38%), Postives = 47/69 (68.12%), Query Frame = 3
Query: 2835 YYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRY------KNLKINNLEEQD--ECLFNPDYVEIDRVLE 3017
            +YLKY+GFSY+HCEWK+ + + DP   +KLK++      + L   + ++ D    LFNPDYVE+DRVL+
Sbjct:  864 FYLKYKGFSYMHCEWKALDEIADPRIATKLKKFLAKNGTEPLPPPSADDDDGTTVLFNPDYVEVDRVLD 932          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A0R3T3N5 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS1629 PE=4 SV=1)

HSP 1 Score: 1208.36 bits (3125), Expect = 0.000e+0
Identity = 681/1419 (47.99%), Postives = 879/1419 (61.95%), Query Frame = 3
Query: 2835 YYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRY--KNLKINNLEEQDE---CLFNPDYVEIDRVLESK---------------------------QIEVNKK---------CENEFDLDFVNKE----------------TIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQ-RNS-----YAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQP-------------HKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEI-CNSLIMDKPRLRRQTNRY-------KPNSTLYDEISGDE-SNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHR-----HYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAP--VARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFT-NISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLI----LNNTNYTDIP-GFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGN---NYPVCSD-------DEKNMKKNKNPSFNKLDSQET------------MEIAESTDTTQLNSKDKNSEIDKKDD---------FPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEK------HSETDEII------------WTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQ 6647
            +Y+KY+GFSY+HCEWK+ + + DP F +KLK++  KN   ++  + DE    LFNPDYVE++RVL+ +                           Q +V+KK          E + + D  N                  T+ YYLVKWRSLPYE  TWE +EDVDPAKVKE+++ RN           N  +I+P    W+ IT+D VY+N N LR+YQ+EGVNWL++CW   RNCILADEMGLGKT+QSIAFL+E+   G  GPFLIIVPLST+GNWQREFE WS+LN I+YHGS+ SRK+IQ YE F    + S               H +  FNA+ITT+EVL+SD+ FFSK  WA +IIDEAHRLKNK+CKL EGLR LD   RVLLTGTPLQNNV+ELF LLNFL+  +F C + FL+++G L++EEQV  LK LL+PMMLRRLKEDVEKSLAPKEE ++EVELTN+QKKYYRAI+ERNF FL KG +G+N+PNL+N MMELRKCCNHPFLIKGAEEAIL    S  +         +K  +EE   F +M+ +SGKLVLIHKLLPKLK   HKVL+FSQM+RVLDILEDYL+Y+ + YERIDGRIHGLLRQEAIDRF +D +KFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQK+V VYRLITRNTYEREMFDRASLKLGLDKA+LQS      +  +QLSKKE+E+LLK GAYG+LMDDDK G+ FCEEDID+IL SRS V++L   E+NS+FSKA+FSI+D R+DI LDDP+FWQKWAKKAGV++  +    LIM  PR RRQT+RY         N++L    SG    NG     S         +   +S      ++          K   N  S +++T   +R DLF+ EKCL  + WGRW +AL+ I FK   +  EL+ + R IL+Y  +     + SGD RI + I + M+  SD NT+K     + P  V   +     +  + S++T++   +   R     +  S           DV T     P SV  ++ D G     +   +F+RH+ R   +LL R+  LYFL+ EI+G+E+A  +    L++T +  +    P+L+    LD+D    WW++  DKCL+LG+FKHGWEKY  I  DP F F     G    N P+ S        + K  ++ K P  + L  +E              E+ E+ D      K+  S++  ++D         FPT  +LN R+RK+I  FQ++  Q E E         SL  A  TP +      D +  KWSRREE +FYR ++SFG+E+       S T                WTNF+   NL +K+++++TEY+ AF+TMC ++C+
Sbjct:  767 FYIKYKGFSYMHCEWKALDEIEDPRFGTKLKKFLAKNGGNDSQPDDDEGTTVLFNPDYVEVERVLDIRIYDKATGAIVTDDVLNPDGTTKRQPRSQKKVSKKRGRPPKSTTKEEDIEDDTTNTPETVESDAQEEEDEQPTTVTYYLVKWRSLPYEHCTWELAEDVDPAKVKEFMRIRNPPKNPPVIRDSNHRIIRPDPSEWQSITIDEVYRNDNRLREYQVEGVNWLSYCWYNKRNCILADEMGLGKTVQSIAFLLEVVKSGVNGPFLIIVPLSTVGNWQREFENWSDLNAIVYHGSSVSRKMIQDYELFYFKKKPSGSNSSLSILSSANYRHDVYKFNALITTFEVLMSDIEFFSKMHWAVAIIDEAHRLKNKKCKLGEGLRYLDFDHRVLLTGTPLQNNVEELFGLLNFLDPQRFGCATTFLTEFGELKTEEQVEDLKKLLKPMMLRRLKEDVEKSLAPKEETIIEVELTNLQKKYYRAIMERNFNFLCKGTTGSNMPNLINVMMELRKCCNHPFLIKGAEEAILAEQRSQANED------PSKPYNEEQQMFNAMLNASGKLVLIHKLLPKLKAGGHKVLVFSQMIRVLDILEDYLVYQGFSYERIDGRIHGLLRQEAIDRFCNDKQKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKMVKVYRLITRNTYEREMFDRASLKLGLDKAVLQSTGANARQ--AQLSKKEVEELLKKGAYGALMDDDKAGDDFCEEDIDQILQSRSHVVQLEQGEKNSTFSKATFSISDTRNDIALDDPDFWQKWAKKAGVEQVGLEYEDLIMTTPRQRRQTSRYTAELNEQAANNSLSHAASGSRLQNGKNGAGSNGESSDGQSSSDESSGGDDDGVEGNASGKSRHKKGKRNQRSDAENT---NRVDLFRVEKCLFTWSWGRWAYALDNIPFKQIFTELELQRVARCILRYILKGSQVLNASGDGRIRAVIME-MINSSDPNTLK-----TIPDIVQALKNSNNAVTGVGSSVTRRSRKLGGPRETDSPNAPSTPTTPNTNMTFDVDTPRQEDPESVKREDDDFG-----IASDSFKRHLARAGGRLLVRVYILYFLHTEIVGLEQADGLCDGTLDHTAFVQLAESLPQLRA---LDADVPAEWWDSCCDKCLLLGVFKHGWEKYAAIRDDPAFCFYRRVYGQDAPNIPIPSTVGSLKMVETKTTEQPKKPESSLLKPEEKEDNDKETPLAIDCELKEAQDEDL--KKEPPSKVMGEEDVELPQPLLLFPTAVDLNSRMRKLIAYFQRIRAQVEME------ALHSLR-AEFTPTITPQSYLDQRI-KWSRREEADFYRVVSSFGVEQVMRSPHQSPTSSTTRGQLGRVFAGYNWTNFKGLANLSKKNDQAITEYYNAFFTMCHRVCK 2150          
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Match: A0A2C9K581 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106051881 PE=4 SV=1)

HSP 1 Score: 1202.19 bits (3109), Expect = 0.000e+0
Identity = 681/1562 (43.60%), Postives = 939/1562 (60.12%), Query Frame = 3
Query: 2727 NLESKNQIVQKILGSRIVSVSDGIDASIKATEE---------------------VEEYYLKYRGFSYIHCEWKSSESV--IDPAFPSKLKRYKNLKINN-LEEQDECLFNPDYVEIDRVLE---SKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQ-RNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPIS-QLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEICN---SLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFV-------------------------------------NWFSGNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD--FPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEVN--KIAPKNCCK--------KIDKNENQNEII---ENC-------LDESDASSNFMLEKADELI 7133
            N E    IV K+LG RI       DA   A+EE                     VEE+Y+KY+ +SY+HCEW++ E +   D    SK+KRY+  K  +  EE DE LFNPDYVE+DRVL+   SK  E N              E I +YLVKWR+L YEE TWE ++DVDP KV  +L+ R      +     +P    W+ +     YKN N LR+YQLEGVNWLTFC+   +NCILADEMGLGKTIQSI FL E++ YG KGPFL+IVPLST+GNWQREFE W+++N++++HG++ SR +I++YE F  D    + P    F A+ITT+E++L+D    +  +W  ++IDEAHRLKNK C+L+EGLR+ DL+ RVLLTGTPLQNN +EL++LLNFL  +KF     F+ ++G+L++EEQV SLK +L+PMMLRRLKEDVEK+LAPKEE ++EVELTNIQKKYYRAILERNF FL+KG S  ++P+LMNTMMELRKCCNHP+LI GAE+ IL+               + K  D+  L   +M+ SSGK+VL+ KLLP+LK + HKVLIFSQM+RVLDI+EDYL+ +KY YER+DGRI G +RQEAIDRF+  D ++F FLLCT+AGGLGINLTAAD V+IYDSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLDKA+LQSM   ++   S QL+KKEIEDLLK GAYG+LM+DD  G+ FCEEDID+IL  R+ VI++ +  + S+F+KASF++++NR+DI ++DPNFWQKWAKKA +D  E+ N    LI+ +PR RRQTNRY  +    +    D S+GS  D     F    K  +                   E  D  N+ +  K+    DR + FK EK LL +GWGRW   ++   FK  ++  ++  + R IL ++ + Y GD++I +FI DL+  E +   +K H G SAPV RGR+G+K          +KD I          S I +    +D +   V               DNG          ++RH+ R S+K+L R++ LY++  E+IG E A+ +  N  +T+I   P+      L+ +    WW+   DK L++G+FK+G+EKY+ I  D    F+                                     N  S  N    + D K+  K+KN   NK   ++ +E +  T +TQ  S    + +++ D   FP  + LN+RLRK I ++Q+  +++  +  +++   +  +      +       + +  +W+RREE +FYR +++FG+E         W  FR    L RK +ESLTEYF AFY MCQ++C +        N + VE I+ ERA+RCL +I++++KIR +I++HP +E+RIKLC+ + D PSWWI G HD  +L G +++G  +T+  I+ D  L F   + + LR  +   S    L  +    AP N  K         +D+ E + ++I   ENC       +D        + E+ADE +
Sbjct:  359 NTEEDTLIVDKVLGERIRRADS--DAEKSASEEPKKEGEENKESENSVKKQETGVEEFYVKYKNYSYLHCEWRTLEELERGDKRVLSKIKRYRMKKAQSYFEEDDEELFNPDYVEVDRVLDMMVSKDPETN--------------EEIKHYLVKWRALAYEEATWELAQDVDPTKVDMFLKFREPPPEDQRKVFARPRPGQWRKLETTPEYKNENTLREYQLEGVNWLTFCYYNGQNCILADEMGLGKTIQSITFLNEIYKYGIKGPFLVIVPLSTVGNWQREFETWTDMNVVVFHGTSISRNMIKEYELFYKDENGQRIPDIYKFEALITTFEIILTDFDLLADIEWRCAVIDEAHRLKNKNCRLLEGLRLFDLEHRVLLTGTPLQNNTEELYSLLNFLSPNKFNSSESFVKEFGDLKTEEQVDSLKEILKPMMLRRLKEDVEKNLAPKEETIIEVELTNIQKKYYRAILERNFQFLAKGAS--SVPSLMNTMMELRKCCNHPYLINGAEDKILDE-------------AREKKSDDPDLMLNAMIQSSGKMVLMDKLLPRLKSSGHKVLIFSQMIRVLDIIEDYLMQKKYLYERLDGRIRGTVRQEAIDRFSKPDSDRFAFLLCTRAGGLGINLTAADTVVIYDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQSMGGEKNVNTSTQLTKKEIEDLLKKGAYGALMEDDNTGDTFCEEDIDQILQRRTKVIQIESEGKGSTFAKASFTMSENRTDIDINDPNFWQKWAKKADID-TELHNKKSELIIAEPRQRRQTNRYGNDEGALEISDLDSSSGSEDDKGNRSFKKMRKTRSQRRNQ-------------DEDLDYANETAGEKY----DRSECFKVEKLLLVYGWGRWSDLIKHAHFKRKLTEDDVIMIARAILAHSLKFYKGDEKIKNFIWDLISKEKEGE-LKNHSGLSAPVPRGRKGKK----------RKDNI----------SFIEDQERPLDFDPEMVL--------------DNG----------YKRHLHRHSNKVLLRVRLLYYIKQELIG-EEAEKVFQNVPHTEI-NIPQ----PILEGEVPVPWWDEEADKSLIIGVFKYGYEKYNCIRSDGALCFLSKCGPPDGAALLAEQEDDKDDDEKEDEMAKDELDDEENSQSSANDNKATCDNKSSDKDKNSPENK--PEKVLEASTETPSTQAGS----NTVEEGDKLLFPDASSLNVRLRKCITNYQRHHKKRMLKHEQLQRRMERRERTDFNLKEREFKRKELQHNRWTRREEADFYRTVSTFGVEFSRAAGRFRWDRFREQARLDRKPDESLTEYFHAFYFMCQRVCGKLKPGDIPPNMIFVEPITEERASRCLARIDLLNKIRQDILMHPHLEERIKLCQHSYDMPSWWICGQHDKELLIGAARHGVAKTDFNILRDKTLSFHLVLENSLRTLRGHPSPMAPLPGHNRPDAPGNSPKLEQLVKSPPLDQQEVRKDLIKFEENCQALVKSEIDSKTIKQESLKEEADEHV 1814          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:NCBI gene;Acc:103046352])

HSP 1 Score: 1152.5 bits (2980), Expect = 0.000e+0
Identity = 639/1462 (43.71%), Postives = 877/1462 (59.99%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVS--VSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFY--SMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESK------PISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRK-GLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDY--LPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD-------------FPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPAL--LTPEMNSHMNND-----GKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    +V KI+ SRIV   VS G+        EVEE+Y+KY+ +SY+HCEW + + +  D     K+KR+K     + +   + DE  FNPDYVE+DRVLE    E           D    E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ ++   A  ++  + +P   +WK +   R Y+NGN LRDYQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E+   G KGPFLII PLST+ NW+REF  W++LN+I+YHGS  SR+++Q+YE +  D +         F A+ITT+E++L      +  +W   IIDEAHRLKNK CKL+EG ++++L+ +VLLTGTPLQN V+ELF+LL+FLE S+F  E+ F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FL+KGV   N+PNL+NTMMELRKCCNHP+LIKGAEE IL +F               ++       F+  +MV S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFDRASLKLGLDKA+LQSM+  ++          QLSKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  R S+F+KASF  + NR+DI LDDPNFW KWAKKA +D + +   NSL++D PR+R+QT  +        E+S  ES+G                                           +D    + T D      R + F+ EK LL +GWGRW   L+   FK  ++ K++E +CR +L Y   HY GDD+I SF+ DL+ P  D  T  ++ HLG S PV RGR+G+K   +     I K + I       K N E                             SD+G          +++H++   +K+L R++ LY+L  E+IG +  Q +L+    ++I         +  D D+  LP+ WW+   DKCL++GIFKHG+EKY+ I  DP   F++               GN++     D  + +    P+  K D ++     +++    L   D   E     D             +P+ + L  RLR++I + Q+  + ++    +I    Q + P+L  L P +   +N        +  +W+RREE +FYR +++FG+    +     WT FR    L +K++ESL +Y  +F  MC+++C R P    D  + +L ++ I+ ERA+R L +I ++ ++R +++ HP++ +R+ LC++  D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  741 EEDAAVVDKIMASRIVKNEVSPGV------MVEVEEFYVKYKNYSYLHCEWATEQHLEKDKRIQQKIKRFKIKQAQRAHFFADMDEDPFNPDYVEVDRVLEVSYCE-----------DKDTGEPVVYYLVKWCSLPYEDSTWELKEDVDQTKIEEF-EKLQAARVDSRRVERPPASHWKKLEQSREYRNGNSLRDYQLEGVNWLLFNWYNRRNCILADEMGLGKTIQSITFLKEIHRKGIKGPFLIIAPLSTIANWEREFRTWTHLNVIVYHGSVLSRQMLQQYEMYFRDAQGRVVKGAYRFQAVITTFEMILGGCPELNAIEWRCVIIDEAHRLKNKNCKLLEGFKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPSRFPSENTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLAKGVGQANVPNLVNTMMELRKCCNHPYLIKGAEEKILEDF--------------REVCSPSAPDFHLQAMVQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLITRNSYEREMFDRASLKLGLDKAVLQSMSGRDNSLGGGGQIQQQLSKKEIEDLLRRGAYGAIMDEEDEGAKFCEEDIDQILQRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWDKWAKKAEIDLDSVNGRNSLVIDTPRVRKQTRPFSATKDELAELSEGESSG-------------------------------------------DDKPKLRRTHDRLNSYGRTECFRVEKNLLVYGWGRWRDILQHGRFKKQLTEKDVEWICRALLAYCLVHYRGDDKIKSFMWDLIAPSEDGRTKELQNHLGLSTPVPRGRKGKKMKTQSSTFDIQKAEWIR------KHNPEHML--------------------------SDDG----------YKKHLKHHCNKVLLRVRMLYYLKQEVIGAQN-QRVLDGAEASEID-------ISIPDPDHSELPALWWDAVADKCLLIGIFKHGYEKYNTIRADPTLCFLDRVGRPDEKAIAAEQRGNDF--MDGDVDDPEYKPAPAMIKDDMED-----DASSPGDLVIADTGGEGGSVLDGGGGTLGAGMGAYWPSQSALTARLRRLITASQRFTKSRQIL--QIHKTQQIMAPSLCPLPPTVTETLNPKMVAKIERQQRWTRREEADFYRVVSTFGVVFDPDLGRFDWTKFRAMARLHKKTDESLQKYLCSFNAMCRRVC-RLPAREGDIVDPSLSIQPITEERASRTLYRIELLRQVREQVLRHPQLYERLSLCQTGPDLPVWWEPGTHDRDLLIGAAKHGVSRTDYHILRDPELCF 2067          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:NCBI gene;Acc:103046352])

HSP 1 Score: 1151.73 bits (2978), Expect = 0.000e+0
Identity = 638/1461 (43.67%), Postives = 875/1461 (59.89%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVS--VSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFY--SMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESK------PISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDY--LPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD-------------FPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPAL--LTPEMNSHMNND-----GKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    +V KI+ SRIV   VS G+        EVEE+Y+KY+ +SY+HCEW + + +  D     K+KR+K     + +   + DE  FNPDYVE+DRVLE    E           D    E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ ++   A  ++  + +P   +WK +   R Y+NGN LRDYQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E+   G KGPFLII PLST+ NW+REF  W++LN+I+YHGS  SR+++Q+YE +  D +         F A+ITT+E++L      +  +W   IIDEAHRLKNK CKL+EG ++++L+ +VLLTGTPLQN V+ELF+LL+FLE S+F  E+ F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FL+KGV   N+PNL+NTMMELRKCCNHP+LIKGAEE IL +F               ++       F+  +MV S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFDRASLKLGLDKA+LQSM+  ++          QLSKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  R S+F+KASF  + NR+DI LDDPNFW KWAKKA +D + +   NSL++D PR+R+QT  +        E+S  ES+G                                           +D    + T D      R + F+ EK LL +GWGRW   L+   FK  ++ K++E +CR +L Y   HY GDD+I SF+ DL+ P  D  T  ++ HLG S PV RGR+G+K                                    + QS  F +I     +   N ++      L    +++H++   +K+L R++ LY+L  E+IG +  Q +L+    ++I         +  D D+  LP+ WW+   DKCL++GIFKHG+EKY+ I  DP   F++               GN++     D+   K    P+  K D ++     +++    L   D   E     D             +P+ + L  RLR++I + Q+    K  +  +I    Q + P+L  L P +   +N        +  +W+RREE +FYR +++FG+    +     WT FR    L +K++ESL +Y  +F  MC+++C R P    D  + +L ++ I+ ERA+R L +I ++ ++R +++ HP++ +R+ LC++  D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  191 EEDAAVVDKIMASRIVKNEVSPGV------MVEVEEFYVKYKNYSYLHCEWATEQHLEKDKRIQQKIKRFKIKQAQRAHFFADMDEDPFNPDYVEVDRVLEVSYCE-----------DKDTGEPVVYYLVKWCSLPYEDSTWELKEDVDQTKIEEF-EKLQAARVDSRRVERPPASHWKKLEQSREYRNGNSLRDYQLEGVNWLLFNWYNRRNCILADEMGLGKTIQSITFLKEIHRKGIKGPFLIIAPLSTIANWEREFRTWTHLNVIVYHGSVLSRQMLQQYEMYFRDAQGRVVKGAYRFQAVITTFEMILGGCPELNAIEWRCVIIDEAHRLKNKNCKLLEGFKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPSRFPSENTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLAKGVGQANVPNLVNTMMELRKCCNHPYLIKGAEEKILEDF--------------REVCSPSAPDFHLQAMVQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLITRNSYEREMFDRASLKLGLDKAVLQSMSGRDNSLGGGGQIQQQLSKKEIEDLLRRGAYGAIMDEEDEGAKFCEEDIDQILQRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWDKWAKKAEIDLDSVNGRNSLVIDTPRVRKQTRPFSATKDELAELSEGESSG-------------------------------------------DDKPKLRRTHDRLNSYGRTECFRVEKNLLVYGWGRWRDILQHGRFKKQLTEKDVEWICRALLAYCLVHYRGDDKIKSFMWDLIAPSEDGRTKELQNHLGLSTPVPRGRKGKKM-----------------------------------KTQSSTF-DIQKAEWIRKHNPEH-----MLSDDGYKKHLKHHCNKVLLRVRMLYYLKQEVIGAQN-QRVLDGAEASEID-------ISIPDPDHSELPALWWDAVADKCLLIGIFKHGYEKYNTIRADPTLCFLDRVGRPDEKAIAAEQRGNDFMDGDVDDPEYK--PAPAMIKDDMED-----DASSPGDLVIADTGGEGGSVLDGGGGTLGAGMGAYWPSQSALTARLRRLITASQRF--TKSRQILQIHKTQQIMAPSLCPLPPTVTETLNPKMVAKIERQQRWTRREEADFYRVVSTFGVVFDPDLGRFDWTKFRAMARLHKKTDESLQKYLCSFNAMCRRVC-RLPAREGDIVDPSLSIQPITEERASRTLYRIELLRQVREQVLRHPQLYERLSLCQTGPDLPVWWEPGTHDRDLLIGAAKHGVSRTDYHILRDPELCF 1517          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:NCBI gene;Acc:103046352])

HSP 1 Score: 1151.73 bits (2978), Expect = 0.000e+0
Identity = 638/1461 (43.67%), Postives = 875/1461 (59.89%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVS--VSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYK---NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFY--SMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESK------PISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQD----MDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDY--LPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS------------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD-------------FPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPAL--LTPEMNSHMNND-----GKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    +V KI+ SRIV   VS G+        EVEE+Y+KY+ +SY+HCEW + + +  D     K+KR+K     + +   + DE  FNPDYVE+DRVLE    E           D    E +VYYLVKW SLPYE+ TWE  EDVD  K++E+ ++   A  ++  + +P   +WK +   R Y+NGN LRDYQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E+   G KGPFLII PLST+ NW+REF  W++LN+I+YHGS  SR+++Q+YE +  D +         F A+ITT+E++L      +  +W   IIDEAHRLKNK CKL+EG ++++L+ +VLLTGTPLQN V+ELF+LL+FLE S+F  E+ F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FL+KGV   N+PNL+NTMMELRKCCNHP+LIKGAEE IL +F               ++       F+  +MV S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFDRASLKLGLDKA+LQSM+  ++          QLSKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  R S+F+KASF  + NR+DI LDDPNFW KWAKKA +D + +   NSL++D PR+R+QT  +        E+S  ES+G                                           +D    + T D      R + F+ EK LL +GWGRW   L+   FK  ++ K++E +CR +L Y   HY GDD+I SF+ DL+ P  D  T  ++ HLG S PV RGR+G+K                                    + QS  F +I     +   N ++      L    +++H++   +K+L R++ LY+L  E+IG +  Q +L+    ++I         +  D D+  LP+ WW+   DKCL++GIFKHG+EKY+ I  DP   F++               GN++     D+   K    P+  K D ++     +++    L   D   E     D             +P+ + L  RLR++I + Q+    K  +  +I    Q + P+L  L P +   +N        +  +W+RREE +FYR +++FG+    +     WT FR    L +K++ESL +Y  +F  MC+++C R P    D  + +L ++ I+ ERA+R L +I ++ ++R +++ HP++ +R+ LC++  D P WW  G HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  219 EEDAAVVDKIMASRIVKNEVSPGV------MVEVEEFYVKYKNYSYLHCEWATEQHLEKDKRIQQKIKRFKIKQAQRAHFFADMDEDPFNPDYVEVDRVLEVSYCE-----------DKDTGEPVVYYLVKWCSLPYEDSTWELKEDVDQTKIEEF-EKLQAARVDSRRVERPPASHWKKLEQSREYRNGNSLRDYQLEGVNWLLFNWYNRRNCILADEMGLGKTIQSITFLKEIHRKGIKGPFLIIAPLSTIANWEREFRTWTHLNVIVYHGSVLSRQMLQQYEMYFRDAQGRVVKGAYRFQAVITTFEMILGGCPELNAIEWRCVIIDEAHRLKNKNCKLLEGFKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPSRFPSENTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLAKGVGQANVPNLVNTMMELRKCCNHPYLIKGAEEKILEDF--------------REVCSPSAPDFHLQAMVQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLITRNSYEREMFDRASLKLGLDKAVLQSMSGRDNSLGGGGQIQQQLSKKEIEDLLRRGAYGAIMDEEDEGAKFCEEDIDQILQRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWDKWAKKAEIDLDSVNGRNSLVIDTPRVRKQTRPFSATKDELAELSEGESSG-------------------------------------------DDKPKLRRTHDRLNSYGRTECFRVEKNLLVYGWGRWRDILQHGRFKKQLTEKDVEWICRALLAYCLVHYRGDDKIKSFMWDLIAPSEDGRTKELQNHLGLSTPVPRGRKGKKM-----------------------------------KTQSSTF-DIQKAEWIRKHNPEH-----MLSDDGYKKHLKHHCNKVLLRVRMLYYLKQEVIGAQN-QRVLDGAEASEID-------ISIPDPDHSELPALWWDAVADKCLLIGIFKHGYEKYNTIRADPTLCFLDRVGRPDEKAIAAEQRGNDFMDGDVDDPEYK--PAPAMIKDDMED-----DASSPGDLVIADTGGEGGSVLDGGGGTLGAGMGAYWPSQSALTARLRRLITASQRF--TKSRQILQIHKTQQIMAPSLCPLPPTVTETLNPKMVAKIERQQRWTRREEADFYRVVSTFGVVFDPDLGRFDWTKFRAMARLHKKTDESLQKYLCSFNAMCRRVC-RLPAREGDIVDPSLSIQPITEERASRTLYRIELLRQVREQVLRHPQLYERLSLCQTGPDLPVWWEPGTHDRDLLIGAAKHGVSRTDYHILRDPELCF 1545          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd7 (chromodomain helicase DNA binding protein 7 [Source:ZFIN;Acc:ZDB-GENE-070912-179])

HSP 1 Score: 1118.61 bits (2892), Expect = 0.000e+0
Identity = 627/1483 (42.28%), Postives = 889/1483 (59.95%), Query Frame = 3
Query: 2823 EVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKNLK-INN-LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL----FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSK-------GVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE--SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRY---KPNSTL-YDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESD--SNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFT--YLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNM--------KKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEID------------KKDDFPTNAELNIRLRKIIGSFQKLWRQKE------SERNKIKTNYQS-----LDPALLTPEMNSHMNNDG------KTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYD---DNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIE 7070
            EVEE+Y+K++ FSY+HC W   E +  D     K+KR+K  + +NN L E D+  FNPDYVE+DRVL+     V++  +        N ET+  YLVKW SLPYE+ TWE   D+D +K++++ +R      E   + +P   +W+     R YKNGN LR+YQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E++  G  GPFL+I PLST+ NW+REF  W+ LN+++YHGS  SR+ IQ YE   +++  +Q   +     F+AIITT+E++L+D        W   IIDEAHRLKN+ CKL+EGL+M+D++ +VLLTGTPLQN V+ELF+LLNFLE  +F  ES F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPKEE ++EVELTN+QKKYYRAILE+NF FLSK       G  G+++PNL+NTMMELRKCCNHP+LI GAEE I+  F             +    +       +M+ ++GKLVLI KLLPKLK   H+VL+FSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  E  +  + QLSKKEIEDLL+ GAYG+LMD++ +G KFCEEDID+IL  R+  I + +  + S+F+KASF  + NR+DI L+DP+FWQKWAKKA +D + I   N+L++D PR+R+QT  Y   K +  + Y E+  D                                        SE K  +             R + F+ EK LL +GWGRW   L    FK P+  +++E +CR +L Y   HY GD+ I SFI DL+ P  D  S T+  H G SAPV RGR+G+KG              +P              V+     Q+D   + +  V +  D              +++RH++   +K+L R++ LY+L  E+IG + A  IL  T+  +     EL ++      +D    WW+   DK L++G+FKHG+EKY+ +  DP   F+      +    + +++           + ++P +  L      ++ + T++  L+ K+++ +ID             K  +P  + L  RLR++I ++Q+  ++++      S+ +   T Y +     +  +   PE ++ +  DG      +  +W+RREE +FYR +++FG+          W+ FR    L +KS+ESL +Y+ AF  MC+++C R  +  D    + TL ++ I+ ERA+R L +I ++ +IR +++ HP++E+R++LC+ + D P+WW  G HD  +L G +K+G +RT+  I++D  L F    L+  R+  Q      +   N + P    K  +  E Q + IE
Sbjct:  143 EVEEFYVKFKSFSYLHCRWADLEELEKDKRIHQKIKRFKAKQALNNFLSEMDDEPFNPDYVEVDRVLD-----VSESTDE-------NGETVTLYLVKWCSLPYEDSTWELKADIDQSKIEDF-ERVMAREPETKRVERPPTSDWQKSESSREYKNGNALREYQLEGVNWLLFNWYNTRNCILADEMGLGKTIQSITFLYEIYLKGIHGPFLVIAPLSTIPNWEREFRTWTELNVVVYHGSQASRRTIQAYE---MNYRDAQGRVIKGAYKFHAIITTFEMILTDCPELRSVPWRCVIIDEAHRLKNRNCKLLEGLKMMDMEHKVLLTGTPLQNTVEELFSLLNFLEPDRFPSESTFMQEFGDLKTEEQVQKLQGILKPMMLRRLKEDVEKNLAPKEETIIEVELTNVQKKYYRAILEKNFAFLSKSGGGSSGGGGGSSVPNLLNTMMELRKCCNHPYLINGAEEKIMEEFR------------ETHPPEHPEFHLQAMIQAAGKLVLIDKLLPKLKAGGHRVLVFSQMVRCLDILEDYLIQRRYPYERIDGRVRGNLRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRENAANGVQQLSKKEIEDLLRKGAYGALMDEEDEGSKFCEEDIDQILQRRTQTITIESEGKGSTFAKASFVSSGNRTDISLEDPDFWQKWAKKAELDFDAINGRNTLVIDTPRVRKQTRHYSSMKEDELMEYSELESD----------------------------------------SEDKPVQKPRRPQDKAVGYPRSECFRVEKNLLVYGWGRWRDILAHGRFKRPLREQDVEIICRALLAYCLLHYRGDENIKSFIWDLITPTEDGQSRTLSNHSGLSAPVPRGRKGKKG-------------KLP--------------VSQPHMPQADWLADCNPDVLLQED--------------SYKRHLKHHCNKVLLRVRMLYYLRQEVIG-DLADRILEGTDSRN-----ELDVWIPQPFHADVPVDWWDLEADKSLLIGVFKHGYEKYNSMRADPSLCFLERVGMPDAKAIAAEQRGADMVADGGEGEEEDPEYKPLRMPFKDDLDDFTNSP-LDDKEESMDIDVVIPKSGENGKPGKLYWPPASALTARLRRLITAYQRSHKREQMRQEALSKPDGPATAYLAESGPFMKSSPFLPE-SAALLADGAAYFKERRQRWTRREEADFYRVVSTFGVVYDVHRQCFDWSQFRAFARLDKKSDESLEKYYYAFVAMCKRVC-RMQIKGDADLADPTLIIDPITEERASRTLYRIELLRRIREQVLPHPQLEERLRLCQPSQDLPAWWEPGRHDRDLLCGAAKHGVSRTDYHILNDPELGF----LEAHRKFTQGKGAEAAPASNPLTPLALVKGEEMKEEQGDCIE 1503          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Match: chd6 (chromodomain helicase DNA binding protein 6 [Source:ZFIN;Acc:ZDB-GENE-130530-559])

HSP 1 Score: 1029.62 bits (2661), Expect = 0.000e+0
Identity = 589/1428 (41.25%), Postives = 826/1428 (57.84%), Query Frame = 3
Query: 2811 KATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKNLKINN---LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEY--LQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESS-QPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES-KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKA--GVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMD----RYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSN--TMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYL-DSDYL---PSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYP----------VCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDD-----FPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNS---HMNNDGK--TA-----------KWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD---NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            ++ EE+EE+Y+KYR FSY+HC+W + E +  DP    K+KR++N +        E DE LFNPDY+E+DRVLE   I +    E          E + +YLVKW SL YEE TWE  EDVDP K++E+  L+R      EN    +P  + W+ +   R Y+NGN LR+YQLEG+NWL F W   +NCILADEMGLGKTIQSI FL E+F  G +GPFLII PLST+ NW+REF  W+ +N+I+YHGS  SR++I +YE +  D + +    +  F+ +ITT+E++++D     K  W   +IDEAHRLKN+ CKL+EGL++++L+ +VLLTGTPLQN+V+ELF+LLNFLE  +F  ES FL ++G+L++EEQV  L+ +L+PMMLRRLK+DVEK+LAPKEE ++EVELTNIQKKYYRAILE+NF FL+KG + +N+PNL+NTMMELRKCCNHP+LI GAEE IL +F             +N   D    Q  +M+ ++GKLVLI KLLPKL    HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF                                         +AQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLDKA+LQ +    S   + QLSK E+EDLL+ GAYG+LMD++ +G KFCEEDID+IL  R+  I + +  + S+F+KASF  + NR+DI LDDPNFWQKWAK A   +D     +SL++D PR+R+QT  Y  NS   DE+       S  DS                                   D+E     S+   D      R + F+ EK LL FGWGRW+  L    FK  ++ +++E LCR +L Y  RHY GDD+I SFI DL+ P  D +   ++ H G SAPV RGR+G+K          K  +  PE +N                  +D   + +  V +  D              ++++H+++  +K+L R++ LY+L  E++G    Q +            P  KL   L D DY+    SWW+   DK L++G+ KHG+E+Y+ +  DP   F+      +            V +D   ++ K+ +    ++D++      +      L     + ++ +  D     +P    L  RLR++I ++Q+  R     R  ++ ++      L+   M S    + +D +  TA           +W+RRE+ +FYR ++SFG+    E     W  FR    L RK+++SL  YF +F +MC+  C R P   D+   + ++ V+ ++ ERA R L +I ++ K+R +++ HP + +R+KLC  +   P WW  G HD  +L G++K+G +RT+  I++DSNL F
Sbjct:  275 ESPEELEEFYVKYRNFSYLHCKWATLEELEKDPRIHQKIKRFRNKQAQMKHIFTEPDEDLFNPDYIEVDRVLE---IAITTDTET--------GEEVTHYLVKWCSLSYEESTWELQEDVDPVKIREFEELKR----IPENKHAERPLPEQWQKLEKSREYRNGNQLREYQLEGMNWLLFNWYNRKNCILADEMGLGKTIQSITFLYEMFLMGLRGPFLIIAPLSTITNWEREFRTWTQINVIVYHGSQISRQMILQYEMYHRDQQGNIVAGQFKFHGVITTFEMIMADCPELKKINWRCVVIDEAHRLKNRNCKLLEGLKLMNLEHKVLLTGTPLQNSVEELFSLLNFLEPMQFPSESTFLEEFGDLKTEEQVKKLQAILKPMMLRRLKDDVEKNLAPKEETIIEVELTNIQKKYYRAILEKNFAFLAKGANQHNMPNLINTMMELRKCCNHPYLITGAEEKILESFR------------KNHNPDAPDFQLQAMIQAAGKLVLIDKLLPKLIAGGHKVLIFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFC----------------------------------------KAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQDINRKGSLNGVQQLSKMEVEDLLRKGAYGALMDEEDEGSKFCEEDIDQILQRRTQTITIQSEGKGSTFAKASFVSSGNRTDISLDDPNFWQKWAKIAELEIDSKAEKDSLVIDTPRVRKQTRHY--NSFEDDEL----MEFSELDS-----------------------------------DSEERPCRSRRFGDRSRRYLRAECFRVEKNLLIFGWGRWKDILNHGRFKWHLTERDMEVLCRALLAYCVRHYKGDDKIKSFIWDLITPTKDGHNQALQNHSGLSAPVPRGRKGKK---------MKNQLSPPEMKN------------------ADWLVHCNPEVVLQDD--------------SYKKHLKQHCNKVLLRVRMLYYLKAEVLGEAAGQALEE---------IPASKLEVALPDIDYIEIPTSWWDADADKSLLVGVHKHGYERYNAMRADPQLCFLERVGMPDVTALTAEQAGAEVVTDAPDSVSKSDDLK-EEVDAKPEELEEKEERKVMLKQCFPDGQVQEVVDQGRALWPAGPALTARLRRLITAYQRYTR-----REPLRHDF------LMHEGMGSVAWQLGDDLRRCTAEPDPLFLEWQRRWTRREQADFYRTVSSFGVVYDPEKKTFDWNQFRVFARLERKTDDSLERYFWSFVSMCRTAC-RLPPRKDEGPVDPSIIVDPVTEERAARTLYRIELLRKVREQVLRHPHLSERLKLCRPSLYLPVWWECGKHDRDLLIGVAKHGLSRTDFYILNDSNLSF 1531          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006707.1 (pep scaffold:Pmarinus_7.0:GL476370:281119:459539:-1 gene:ENSPMAG00000006035.1 transcript:ENSPMAT00000006707.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 926.006 bits (2392), Expect = 0.000e+0
Identity = 514/1243 (41.35%), Postives = 747/1243 (60.10%), Query Frame = 3
Query: 3372 MGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQ----WAASIIDEAHRLKNKRCKLIEGLRMLDLQ-FRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNS--GTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE--SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRY-KPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESD--SNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIP-GFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFS----------GNNYPVCSDDEKNMKKNKNPSFNKLDSQETME-IAESTDTTQLN-SKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQK------ESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDN--NTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVS 6992
            MGLGKTIQSIAFL ++   G  GPFL+I PLST+ NW+REF  W+++N +++HGS  SR++IQ+YE ++ D +  +   +    +    ++L+  +L+ S       ++ SI+ E H+     C L+  + + +++  +VLLTGTPLQN V+ELF+LLNFLE ++F  ES FL ++G L+SEEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILERNF+FL+KG    N+PNLMNTMMELRKCCNHP+LI GAEE IL++F    G D+ +   ++Q            +MV ++GKLVLI KLLP+L++  HKVLIFSQMVR LDILEDYL+ ++Y YERIDGR+ G +RQ AIDRF   D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLD+A+LQSM+  E  +  + Q+SKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  + S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D   +   NSL++D PR+R+Q  +Y         E+SG ES     D  + H                                        +  Q   R + F+ EK LL +GWGRW   L    FK  +  +++E +CR  + Y   HY GD+RI  F+ DL+ P  D  + T++ H G SAPV RGR+G+K                           +   ++ +D  ++D     + P S+  D+              +++H++   +K+L R++ LY+L  E+IG + A  + +  + ++I    PE +       +   SWW+   DK L++G+ KHG+EKY+ +  DP   F+                NY   +D E+       P      +   +E  + S  + Q++ S+ K SE+ K   +P+ + L  RLR+++ ++Q+ ++Q+      ++ R    T      P+L   E         K  +W+RREE +FYR +++FG+E   +     WT FR+   L +K+++SLT YF+AF  MC+K+C+  P   +D+    L VE I+ ERA+R L +I ++ K+R +++ HP + +R++LC+ + + PSWW  G HD  +L   +K+G +RT+  +++D    F       LR Q +  + + +
Sbjct:    1 MGLGKTIQSIAFLQDVALAGVHGPFLVIAPLSTIANWEREFRTWTDMNAVVFHGSVASRQMIQQYEMYTRDAQGRRGRIIRSAVVWAACQILVKIILWGSGRLIHELFSLSILPELHKDSYFDCNLVHSVTIYNIEEHKVLLTGTPLQNTVEELFSLLNFLEPARFPSESSFLQEFGQLKSEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILERNFSFLAKGAGQANLPNLMNTMMELRKCCNHPYLINGAEEKILSDFREAHGADVPDF--YLQ------------AMVQAAGKLVLIDKLLPRLREGGHKVLIFSQMVRCLDILEDYLVQKRYPYERIDGRVRGNMRQVAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDRAVLQSMSGRENTTNGVQQMSKKEIEDLLRKGAYGAIMDEEDEGSKFCEEDIDQILQRRTHTITIESEGKGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDLESMHGKNSLVIDTPRIRKQVRQYTAAKGEDLAELSGLES-----DDERPH----------------------------------KGRRPHERAQGYQRTECFRVEKNLLIYGWGRWPDILRHGRFKRQLVERDVELICRVSMAYCLLHYRGDERIKGFMWDLITPSHDGQARTLQNHSGLSAPVPRGRKGKK---------------------------VKSQISTLDPAKTDWLAKYN-PESLLLDD-------------GYKKHLKHHCNKVLLRVRMLYYLRQEVIG-DNADRVFDGVDASEIDIWIPEAEA-----GEQPVSWWDADADKSLLIGVCKHGYEKYNSMRADPSLCFLERVGMPDQMAIAAEQRNYDFLADGEEFEDPEYKPGRTIFKNDMDLEDDSMSPGSLQIDISEGKKSEMGKL-YWPSASALTARLRRLVTTYQRCYKQQQQRLEAQASRPPSDTAPPPPRPSLWAREFARLE----KRQRWTRREEADFYRVVSTFGVEFDPQRRRFDWTRFRSFARLDKKTDDSLTRYFQAFVAMCRKVCRLPPSDAEDSLEPGLLVEPITEERASRTLYRIELLRKVRQQVLRHPHLTERLRLCQPSVELPSWWQCGAHDRELLLSAAKHGVSRTDYHMLNDPEFSF-------LRMQHECMTAAAA 1131          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006729.1 (pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-1 gene:ENSPMAG00000006035.1 transcript:ENSPMAT00000006729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 426/780 (54.62%), Postives = 548/780 (70.26%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRY--KNLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEY-LQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFN-AIITTYEVLLSDLLFFSKFQWAASIIDE-AHRLKNKRCKLIEGLRMLDLQ-FRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNS--GTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE--SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVD 5036
            E    IV KIL  ++V        S +   +VEEYY+KY+ +SY+HCEW S + +  D     K+KR+  K  ++N   + DE  FNPDYVE+DR+L+                D    E + YYLVKW SLPYE+ TWE  ED+D  ++ E+   R      + +E  +P  K WK +   R YKNGN LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSIAFL ++   G  GPFL+I PLST+ NW+REF  W+++N +++HGS  SR++IQ+YE ++ D +S       F    +TT    L  L    K  ++   + E + R+  +R  L+  L +  ++  +VLLTGTPLQN V+ELF+LLNFLE ++F  ES FL ++G L+SEEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELTNIQKKYYRAILERNF+FL+KG    N+PNLMNTMMELRKCCNHP+LI GAEE IL++F    G D+ +   ++Q            +MV ++GKLVLI KLLP+L++  HKVLIFSQMVR LDILEDYL+ ++Y YERIDGR+ G +RQ AIDRF   D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREMFD+ASLKLGLD+A+LQSM+  E  +  + Q+SKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  + S+F+KASF  + NR+DI LDDPNFWQKWAKKA +D
Sbjct:   57 EEDAAIVDKILAVKMVKKEV---VSGQGLIDVEEYYVKYKNYSYLHCEWASMQQLERDKRIHQKIKRFWIKRAQMNIFAQLDEEAFNPDYVEVDRILDVSHCS-----------DPDTGEPVTYYLVKWCSLPYEDSTWELKEDIDQTRIDEFEALRARKHVCKRAE--RPPPKAWKKLEDSREYKNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQDVALAGVHGPFLVIAPLSTIANWEREFRTWTDMNAVVFHGSVASRQMIQQYEMYTRDAQSKNIVGFCFYYEKVTTVHSHLKVLPELHKGLFSCIYLSEHSTRVITRRVLLMHLLELYGVEEHKVLLTGTPLQNTVEELFSLLNFLEPARFPSESSFLQEFGQLKSEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILERNFSFLAKGAGQANLPNLMNTMMELRKCCNHPYLINGAEEKILSDFREAHGADVPDF--YLQ------------AMVQAAGKLVLIDKLLPRLREGGHKVLIFSQMVRCLDILEDYLVQKRYPYERIDGRVRGNMRQVAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDRAVLQSMSGRENTTNGVQQMSKKEIEDLLRKGAYGAIMDEEDEGSKFCEEDIDQILQRRTHTITIESEGKGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEID 806          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004254.1 (pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 gene:ENSPMAG00000003871.1 transcript:ENSPMAT00000004254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 424.476 bits (1090), Expect = 7.106e-132
Identity = 238/501 (47.50%), Postives = 326/501 (65.07%), Query Frame = 3
Query: 3351 NCILADEMGLGKTIQSIAFLIELFN-YGFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSD-PEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYT-------ESKPISQ--LSKKEIEDLLKLGA 4817
            + ILADEMGLGKTIQ+I+FL  +F+ +   GPFL++VPLST+ +WQREF  W+  +N+++Y G   SR +I++YE     H+  Q  KL FNA++TTYE+LL D        WA   +DEAHRLKN    L + L       R+L+TGTPLQN+++EL++LL+F+   KF    DF + +G+  S+    SL   L+P +LRR+K+DVE+SL  K E ++ VE+T  QK YY+ IL RNF  LSKG  G+     +N MMEL+KCCNH +LIK  E+             N+ K         + LQ  S+V SSGKL+L+ KLL +L++  H+VLIFSQMVR+LDIL DYL  + + ++R+DG I    R++A+D F ++  E F FLL T+AGGLGINL +AD V+I+DSDWNPQNDLQAQAR HRIGQ+K VN+YRL+TR T E ++ +RA  K+ LD  ++Q M  T        S P S    +K+E+  +LK GA
Sbjct:    5 SVILADEMGLGKTIQTISFLSYMFHSHQVYGPFLLVVPLSTVTSWQREFATWAPEMNVVVYLGDMSSRNVIREYEWI---HQ--QTKKLKFNALVTTYEILLKDKTVLGAVNWAFLGVDEAHRLKNDDSLLYKSLIEFKTNVRLLITGTPLQNSLKELWSLLHFIMPDKFSAWEDFDAVHGS-GSDNGYVSLHKELEPFLLRRVKKDVERSLPAKVEQILRVEMTPQQKHYYKWILTRNFKALSKGTRGST-SGFLNIMMELKKCCNHCYLIKLPEDE------------NVDK--------HDALQ--SLVRSSGKLILLDKLLCRLRETGHRVLIFSQMVRMLDILADYLAMKHFPFQRLDGSIKNEQRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTTGKTVLQKGSAPSSSTPFNKEELASILKFGA 476          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 388.267 bits (996), Expect = 9.815e-118
Identity = 224/547 (40.95%), Postives = 324/547 (59.23%), Query Frame = 3
Query: 3273 YKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNY-GFKGPFLIIVPLSTLGNWQREFEQW-SNLNIILYHGSAKSRKLIQKYEAFSLDHESSQP--HKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQY--GNLRSEEQ-VASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIED-LLKLGAYGSLMDDDKDGEKFCEEDIDKIL 4886
            Y     +RDYQ+ G+NWL   +    N ILADEMGLGKT+Q+I+ L  + +Y    GP +++VP STL NW  EFE+W  +L  +   G    R              +SQP    + ++  +T+YE+++ +   F KF W   +IDEAHR+KN++ KL E +R      R+LLTGTPLQNN+ EL++LLNFL    F     F S +   N   ++Q V  L ++L+P +LRR+K DVEKSL PK+E  + + L+ +Q+++Y  IL ++   L+     + +  L+N +M+LRKCCNHP+L  GAE      + + T                       +V +SGK+V++ KLLPKL +   +VLIFSQM R++DILEDY ++  Y+Y R+DG+     RQ +I  F + D  KFVF+L T+AGGLGINL  ADVVI+YDSDWNPQ DLQA  R HRIGQ+K+V V+R IT +T E  + +RA +KL LD  ++Q       + + Q++ K  +D +L++  YG+         +  +EDID IL
Sbjct:  106 YVKCGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRV------------SASQPIVPPIEWDVCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWFDTNNCFGDQQLVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKM-RLLNILMQLRKCCNHPYLFDGAEPG--PPYTTDT----------------------HIVINSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQ---GPGRLVDQVANKLGKDEMLQMIRYGATQVFSSKESQITDEDIDVIL 612          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 390.963 bits (1003), Expect = 7.302e-115
Identity = 220/547 (40.22%), Postives = 326/547 (59.60%), Query Frame = 3
Query: 3270 VYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNY-GFKGPFLIIVPLSTLGNWQREFEQW-SNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGN---LRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE--SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKIL 4886
             Y  G  +RDYQ+ G+NWL   +    N ILADEMGLGKT+Q+I+ L  + ++   +GP +++VP STL NW  EFE+W  +L  +   G+ K +++      ++         K  ++  +T+YE+++ +   F KF W   +IDEAHR+KN++ KL + +R      R+LLTGTPLQNN+ EL++LLNFL    F    DF S +     L  +E V  L ++L+P +LRR+K DVEKSL PK+E+ + + L+ +Q+++Y  IL ++   L+     + +  L+N +M+LRKCCNHP+L  GAE         G      T  + N                SGK+V++ KLLPKL++   +VL+FSQM R+LDILEDY +++ Y Y R+DG+     RQEAI  + + +  KF+F+L T+AGGLGINL  ADVVI+YDSDWNPQ DLQA  R HRIGQ K V V+R +T NT E  + +RA +KL LD  ++Q +       +  ++L K E+  +++ GA       D +     +E+ID +L
Sbjct:  130 TYVKGGTMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIGN-KDQRVATDENVYT---------KREWDVCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSDIVREFKSTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSEDFDSWFDTNNCLGDQELVERLHMVLRPFLLRRIKADVEKSLQPKKEVKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKL-RLLNILMQLRKCCNHPYLFDGAE--------PGPPYTTDTHLVNN----------------SGKMVVLDKLLPKLQEQGSRVLLFSQMTRMLDILEDYCMWKGYGYCRLDGQTPHEDRQEAIAAYNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKRVRVFRFLTENTVEERIVERAEMKLRLDSIVIQQVCAGRLIDQQANKLGKDEMLQMIRHGATHVFASRDSE---ITDEEIDVVL 638          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 469.544 bits (1207), Expect = 1.916e-137
Identity = 285/751 (37.95%), Postives = 426/751 (56.72%), Query Frame = 3
Query: 2832 EYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEID-----------RVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDV---DPAKVKEYLQRNSYAYTENSELIKPTHKNW---KP----ITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIEL-FNYGFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKK---EIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKIL---LSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDD 4994
            E+ +K+   S++H  W++ ES+        LKR  N     + E  +   +P YV  +           R+ E ++  V ++  +       +  + + YLVKWR L Y+E TWE + D+    P +VK +  R      ENS+++     N+   +P    +++   +  G  LRD+QL G+NW+ F W    N ILADEMGLGKT+Q++AF+  L F     GP +I+VPLST+  W   FE+W+ +LN I Y G+ KSR  I++YE F  +  +     + FN ++TTYE +L D       +W    +DEAHRLKN    L E L    +  R+L+TGTPLQNN++EL  L+NFL   +F  + +   +  +   EE +  L   +QP +LRRLK+DVEKSL  K E ++ VEL+++Q +YY+ IL +N++ L+ G  G +  +L+N M EL+K  NHP+L   AEE +L  F  G            K+  E  L+   ++ SSGK+VL+ +LL +LK+  H+VLIFSQMVR+LDIL DYL  +   ++R+DG +    R+ +ID F S D   FVFLL T+AGGLGINL  AD V+I+DSDWNPQ DLQA AR HRIGQ+  V VYRL++++T E E+ +RA  K+ L+ AI+ S+  T+    ++ ++    E+  +LK GA G++     + +K  + ++D +L       T   L  S          F +TD ++DI  DD
Sbjct:  212 EFLIKWTDESHLHNTWETYESI---GQVRGLKRLDNYCKQFIIEDQQVRLDP-YVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNR------ENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYE-FYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHF-SLLNIMNELKKASNHPYLFDNAEERVLQKFGDG------------KMTRENVLR--GLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII-SLGVTDGNKYTKKNEPNAGELSAILKFGA-GNMFTATDNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDD 934          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 393.275 bits (1009), Expect = 1.003e-114
Identity = 224/541 (41.40%), Postives = 330/541 (61.00%), Query Frame = 3
Query: 3291 LRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIEL-FNYGFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQ-----VASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGN-NIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKIL 4886
            LRDYQ++G+NWL        + ILADEMGLGKT+Q+I+FL  L +    +GPFLIIVP STL NW+REF +W+ N+N+++ HG   +R  I +              +  F+ +IT+YE+++ +     +  W   +IDEAHR+KN++  L + +R+   + R+L+TGTPLQNN+ EL+ LLNFL     F +S+   ++    + EQ     +  L  +L P +LRR+K DVEKSL PK E  V V +T++Q ++Y+++LE++   ++  V        L+N +M+LRKCCNHP+L +GAE                         DE       ++++SGK++++ KLL +LK+   +VLIFSQM R+LDILEDY  +  ++Y RIDG      R EAID +   + EKFVFLL T+AGGLGINL  AD VI++DSDWNPQ DLQA  R HRIGQ+K V+VYR +T N  E ++ +RA+ KL LD+ ++Q  T  ++  +   SK ++ D+++ GA    M + K  +   + DID IL
Sbjct:  184 LRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL----------EARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFL-LPDIFGDSELFDEWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPG------------------PPYTTDEH------LIFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQGTGKKTASLGN-SKDDLLDMIQFGAKN--MFEKKASKVTVDADIDDIL 686          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 370.548 bits (950), Expect = 5.352e-107
Identity = 226/503 (44.93%), Postives = 309/503 (61.43%), Query Frame = 3
Query: 3270 VYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIEL-FNYGFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSR-KLIQKYEAFSLDHESSQPHKLL---FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQ----VASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGN--NIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQ 4739
             Y NG  LR YQ++GVNWL          ILADEMGLGKT+Q+I+FL  L +     GPFL+I P STL NW RE  +W+ ++N  +  G  + R +LIQK              KLL   F+ +I +YE+++ +     K  W   IIDEAHR+KN+   L + LR    + R+L+TGTPLQNN+ EL+ LLNFL    F    DF   + +  +EE     V  L  +LQP +LRR+K DVE SL PK+E+ + V ++++QKK+Y+ ILE++   ++ G +G+  +   L+N MM+LRKCCNHP+L  GAE                         DE       +VY++ KL ++ KLL KLK+   +VLIFSQM R+LDILEDY  +  Y+Y RIDG      R +AID + + D +KFVFLL T+AGGLGINLT+ADVV++YDSDWNPQ DLQA  R HRIGQ+K V V+RL+T N+ E ++ +RA+ KL LD+ ++Q
Sbjct:  190 AYVNGQ-LRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQK--------------KLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWFSSESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAVN-GSNGSKESKTRLLNIMMQLRKCCNHPYLFDGAEPG------------------PPYTTDEH------LVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQ 652          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 342.813 bits (878), Expect = 2.059e-96
Identity = 202/513 (39.38%), Postives = 298/513 (58.09%), Query Frame = 3
Query: 3282 GNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFK-GPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGL-RMLDLQFRVLLTGTPLQNNVQELFNLLNFL-----ESSKFFCESDFLSQYGNLRSEEQ-----------VASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSG---NNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTY 4751
            G  L++YQL G+ W+   +  + N ILADEMGLGKTIQSI+ +  L+      GPFL+IVPLST+ NW  EFE+W+ +LN I+Y G+   R         SL H+    +   F+ ++TTYE ++ D    SK  WA  IIDE HR+KN + KL   +      + R++LTGTPLQNN+ EL+ LLNF+      S+K F E  F + + N  ++E+           +  L  +L+P +LRRLK++VEK L  K E V++ +L+ +Q++ Y+ +L+ N  F+  G  G     I  L N +M+LRK CNHPF+    E  ++N     +D+                     +   +GK  L+ ++LPK K + H+VL+F QM +V+DI+ED+L  +  +Y R+DG      R E ++ F + D + F FLL T+AGGLG+NL  AD VII+D+DWNP  DLQAQ R HRIGQ+  V + RLIT ++ E  + +RA  KL +D  ++Q+  +
Sbjct:  467 GGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQR--------HSLQHQIRVGN---FDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTF-EDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVE-GVVNPSRGNSDL---------------------LFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKF 945          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 337.421 bits (864), Expect = 1.175e-93
Identity = 210/558 (37.63%), Postives = 310/558 (55.56%), Query Frame = 3
Query: 3282 GNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNY-GFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQ-KYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRM-LDLQFRVLLTGTPLQNNVQELFNLLNFL-----ESSKFFCE---SDFLSQYGNLR---SEEQ----VASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSK-------GVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDI 4874
            G  L+DYQ++G+ W+   +  + N ILADEMGLGKTIQ+I+ L  L+     +GP+L+IVPLSTL NW  EF +W+  L  I + GS   RK  Q K  A              F+ ++TT+E ++ +    SK +W   IIDE HR+KN + KL   L       +R++LTGTPLQNN+ EL+ LLNF+      S K F E   + F +  G  +   SEE+    +  L  +L+P +LRRLK+DVEK L  K E VV+ +++ +Q+  Y+ +L+    F+         G+ G N     N +M+L+K CNHPF+ +  E+ I     +  D+  +                      +GK  L+ ++LPKLK   H+VLIF QM +++DI+ED+L Y   +Y R+DG      R E +  F + D E   F+L T+AGGLG+NL  AD VII+D+DWNP  DLQAQ R HRIGQ+  V + RLIT N+ E  + +RA  KL +D  ++Q+  +      ++ + +E E LL+     SL+D +++  K  E  +
Sbjct:  764 GGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGE------------FDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFN-----NQIMQLKKICNHPFVFEEVEDQINPTRETNDDIWRV----------------------AGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFD-----NKSTSEEQEALLR-----SLLDAEEERRKKRESGV 1272          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO47298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN4])

HSP 1 Score: 942.569 bits (2435), Expect = 0.000e+0
Identity = 537/1143 (46.98%), Postives = 705/1143 (61.68%), Query Frame = 3
Query: 2748 IVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVI--DPAFPSKLKRYKNLKINN---LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQ-RNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLD-HESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGN-NIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKP-ISQLSKKEIEDLLKLGAYGSLMDDDK-DGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEICN--SLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARGRRGRKGLEEMISAI---------TKKDMIVPENRNIKRNS--EISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVN 6104
            IV+KIL SR+  V DG         +VEE+++K++ +SY+H EW ++E +   D     K+KRYK  ++N      E +E  FNPDYVE+DRVL+               +D    E I ++LVKWRSLPYEE TWE   DV+ +K++++ + R      +     +P    W  +    VYK+ N LR+YQLEGVNWL FCW   +N ILADEMGLGKTIQSIAFL E+  YG +GP L+I PLST+ NWQREFE W+++N ++YHGSA SR LIQ+YE +  D H    P+   F  +ITTYE++++D +  S   W A IIDEAHRLKN+ CKL+EGL  L ++ R+LLTGTPLQNNV+ELF+LLNFLE S+F  +  FL ++G+L++E QV  LK LL+PMMLRRLKEDVEK++APKEE ++EVELT +QKK+YRAILERNF FL+KG S   N+PNLMNTMMELRKCCNHPFLI GAEE IL  +               + +D  T   ++M+ +SGKLVLIHKLLPKLK   HKVL+FSQMVR LDILEDYL++ KY YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD VII+DSDWNPQNDLQAQARCHRIGQ + V VYRLITRN+YEREMFDRAS+KLGLDKA+LQSM   E+     Q+SK+EIEDLLK GAYG++M++D  D  KFCEEDID+IL  R+ VI++ +  + S+F+KASF       DI +DDP+FW+KWAKKA +D + + N    I+D PR R+QT RY           G+E                                   F L     D E  D    H     R + F+ EK LL +GWGR++  L    FK  I  +++ES+ RTIL Y   HY GDD++ SFI D++                A V R R      +   S I          K+    P+  N    +  E+ +D   ID            P S+  DN              +++H+Q   +K+L R++ LY+L  E+IG    Q+       +D+    ++ +++  + D    WW+   DK L++G+FKHG+E+Y+ I  DP   F++
Sbjct:   59 IVEKILSSRLRDVEDG------TITKVEEFHVKFKNYSYLHAEWATAEKLAKGDKRVQMKIKRYKAKQLNTAAFFSEMEEDSFNPDYVEVDRVLDMST-----------GMDHNTGEPITHFLVKWRSLPYEESTWEVKADVEESKIQQFYKLREPPPLPQRQFRPRPYPHEWHKLETSPVYKDENTLREYQLEGVNWLMFCWCNRQNSILADEMGLGKTIQSIAFLFEMQRYGIRGPNLVIAPLSTISNWQREFESWNDINAVVYHGSASSRHLIQEYEFYYRDEHGQPIPNIFKFQVLITTYEIIIADNMQLSTVPWRAVIIDEAHRLKNRNCKLLEGLNNLQMEHRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAFLMEFGDLKTESQVDKLKQLLKPMMLRRLKEDVEKNIAPKEETIIEVELTTVQKKFYRAILERNFAFLAKGTSSTANVPNLMNTMMELRKCCNHPFLITGAEEKILQEYG-------------REHVDRHT---HAMIEASGKLVLIHKLLPKLKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQSRSVKVYRLITRNSYEREMFDRASMKLGLDKAVLQSMNTKENAGNNGQMSKREIEDLLKRGAYGAIMEEDNDDASKFCEEDIDQILERRTQVIQVESEGKGSTFAKASFVSAKGDDDIDVDDPDFWEKWAKKADLDVDYLNNKDERILDAPRQRKQTRRY-----------GNEDG--------------------------------DFELSDIEMDEE--DVKVPHRSSWTRVECFRVEKNLLIYGWGRFKEILTHGRFKTKIGERDVESISRTILVYCLSHYHGDDKVKSFIRDII---------------KASVLRDRISHDDRDSTYSPIPTPTKGRGRGKRGKGAPKKSNKSAVALLEVGQDWKTID------------PESIVLDNG-------------YKKHLQHHCNKILLRVRLLYYLKTEVIGNLALQIREGKCRASDL----DIAIYS-PEGDPPCDWWDVDADKSLLVGVFKHGYERYNLIRADPTLCFLS 1078          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 459.144 bits (1180), Expect = 1.181e-139
Identity = 276/728 (37.91%), Postives = 400/728 (54.95%), Query Frame = 3
Query: 2817 TEEVEEYYLKYRGFSYIHCEWKSSESV------IDPAF----------------------------PSKLKRYKNLKINNLEEQ-DECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGF-KGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHES----------SQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSD-PEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDD-KDGE 4853
            T    E+++K+R  SY HC W +   +      +  AF                            P+   + K    NNLE +      NP++++I+R++  +   V K    EF              VKWR +PY + TWE  +D    ++     +  Y                +P  +D   + G  L +YQ EG+NWL F W    N ILADEMGLGKTIQ+I+FL  L   G  +GPFL+  PLSTL NW+REFE W+ ++ ++ Y G  +SR  I+ ++ FS D ++           +   + F+ ++T+YE++  D        WA  ++DEAHRLKN + K    L   ++ +++LLTGTPLQNN++EL+NLL FL+  +F  +++FL+++ N+  E+Q+  L  +L P MLRRLK DV K +  K E++V VEL+ +QKKYY+ IL RNF  L+    G    +L+N MMEL+KCCNHP+L   A        + G +  ++T+                   +SGKL+L+ K+L KL++  H+VLIFSQM R+LD+LED+L    Y+YERIDG ++G  RQEAIDRF +   + F FLL T+AGGLGINL  AD V IYDSDWNP ND+QA +R HRIGQ   V +YR +TR++ E  +   A  K+ L   +++    +    I  +SK E++D+LK G      DDD KDGE
Sbjct:   98 TYTTREFFVKWREKSYWHCSWITELQIEIQHPEMFRAFSRKNDMDEPPPLSDDDDEDSIEDGQHPSPTAKSKAKEQDENNLEARFYRYGVNPEWLQINRIMNHR---VLKDGSEEF-------------FVKWRDVPYSQSTWESPDDPINHQISYINCKERYEK--------------QPAYLD---ETGGKLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFD-FSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIGYKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFDNVAKEDQIKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTRNFEALN--TKGAQQVSLLNVMMELKKCCNHPYLFHAAALEAKRTQSGGYEPNSLTE-------------------ASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVRPGLGSNKATI--MSKSELDDILKFGTSELFKDDDTKDGE 768          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 380.178 bits (975), Expect = 1.039e-110
Identity = 220/521 (42.23%), Postives = 309/521 (59.31%), Query Frame = 3
Query: 3273 YKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNY-GFKGPFLIIVPLSTLGNWQREFEQW-SNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQY--GNLRSEEQ-VASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGA 4817
            Y  G  +RDYQ+ G+NWL   +    N ILADEMGLGKT+Q+I+ L  + N+    GP ++I P STL NW  EFE+W  ++  +   G+ + R       AF  D  +  P +  ++  +T+YE+++ +   F KF W   +IDEAHR+KN++ KL E +R L    R+LLTGTPLQNN+ EL+ LLNFL    F    DF + +   NL  E+Q V  L  +L+P +LRRLK DVEK L PK+E  V   LT +Q+ +Y  IL ++   ++ G    +   L+N +M+LRKCCNHP+L  GAE         G         I+N                SGK+ ++ KLL +LKQ   +VLIFSQM R+LDILEDY ++ +Y Y R+DG+     RQ  I+ F      KF+F+L T+AGGLGINL  AD+VI+YDSDWNPQ DLQA  R HRIGQ+K V V+R I+ +T E  + +RA +KL LD  ++Q     +  P  ++ K+E+  +++ GA
Sbjct:  138 YIKGGEMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRT------AFIRD--TMLPGE--WDVCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWFNSNNLVEEKQLVERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKILMKDIDVVN-GAGKTDKMRLLNILMQLRKCCNHPYLFDGAE--------PGPPYTTDVHLIEN----------------SGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQGRLVD--PNLKVGKEEMLSMIRHGA 621          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO46669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD7])

HSP 1 Score: 372.089 bits (954), Expect = 5.720e-109
Identity = 229/602 (38.04%), Postives = 324/602 (53.82%), Query Frame = 3
Query: 3270 VYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKF---------FCESDFLSQYGNLR-----SEEQV-ASLKILLQPMMLRRLKEDVEKSLAPKEEIV-----------------------------------VEVELTNIQKKYYR----------------------AILE---RNFTFLSKGVSGNNIP-NLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDK 4844
            V   G  LR YQLEGV WL   +    N ILADEMGLGKTIQ I  +  L   G +GPFL+  PLSTL NW  EF ++S  + +ILYHGS + R  +++        + + P + +   ++T+YE+ ++D     +  W   I+DE HR+KN  C+LI  L+  +   R+LLTGTPLQNN+ EL++LLNFL    F         F  S    + GN +      E QV   L  +L P +LRRLK DVE SL PK+E++                                   VE+  T  +K+  R                      A LE   R     S+  S  +I   + N +M LRKCCNHP+L++   + +   +                 IDEE      +V  SGK++L+ +++P LK+  HK+LIFSQM ++LDIL+DY     YQY R+DG +    R+E ID F SDPEKF+FLL T+AGGLG+NL+AAD VIIYDSDWNPQ+DLQAQ RCHRIGQ K + VYRL+T NT ++++ +RA+ K  L+K ++    +      + L+  ++++LL+   +  ++  D+
Sbjct:  291 VLLTGGALRSYQLEGVEWLKGLYENGVNGILADEMGLGKTIQCIGLVSYLIEMGVRGPFLVAAPLSTLPNWVSEFRRFSPQIPVILYHGSIQERTSLRRK---ITKLKKAGPFETM-PVVVTSYEIAMNDQKHLFQLMWKHMIVDEGHRIKNLNCRLIRELKSYNSANRLLLTGTPLQNNLAELWSLLNFLLPDIFDDLNSFQRWFDFSAINDEGGNEKIIAQEKEHQVLERLHSILTPFLLRRLKTDVELSLPPKKEVLVRAPLTSKQTEFYRAALDKTILDIVGDNKDKKEDKVEISSTGRKKRKGRRNINYKIFDDENGSIEELAEELATLEKSRREICTPSQKSSTYDISIKITNILMLLRKCCNHPYLLEYPLDPVTQQYK----------------IDEE------LVRCSGKMLLLDQMVPALKRRGHKILIFSQMTKMLDILQDYCYLRGYQYSRLDGSMKVEDRREEIDAFASDPEKFIFLLSTRAGGLGLNLSAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPILVYRLVTSNTVDQKIVERAASKRKLEKMVIYKGKFKGKVDGTTLNALQLKELLESSHHDEIISKDE 866          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Match: EDO31943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF7])

HSP 1 Score: 346.665 bits (888), Expect = 8.156e-101
Identity = 205/519 (39.50%), Postives = 299/519 (57.61%), Query Frame = 3
Query: 3282 GNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIEL-FNYGFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCE--SDFLSQYGNLRS--EEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNF-TFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQ-SMTYTESKPISQLSKKEIEDLLKLG 4814
            G  LR YQLEGV W+  C +T   CIL DEMGLGKTIQ+I+ L+ L       G FL++ PLS + NW+ E ++++ +L ++   GS + R+ I K + F  D ++        + ++T+YE+ L +  F  +F W+A  +DEAHRLKN +  L   L      F +LLTGTP+QNN++EL++LL+F+  S F  E   +F + + NL +  +   + L  LL P +LRR+K +V   L  K E+++   ++ +QKKYY+AIL +++  F + G S N + +++     LRKC NHP+L  G E      F  G                        ++ +SGKL  I +LL  L +  HKVL+FSQM R+LDI++DYL Y  Y YER+DG + G  R  AI  F  + + F+FLL TKAGG G+NL +AD VI  DSD+NPQNDLQA AR HRIGQ + V + RL+ RNT E  +   A  K+ L   +++    Y  SK ++      + ++LK G
Sbjct:   13 GITLRPYQLEGVGWMRDCALTGHGCILGDEMGLGKTIQTISVLLLLKRTIKHTGLFLVLSPLSVMANWKNEIKRFTKSLKVLSLIGSKEERE-ITKNKLFQ-DIKN-------IDVLLTSYEICLRETSFLQRFHWSAVAVDEAHRLKNSQSLLYTELIQFKYDFSILLTGTPVQNNLKELYSLLSFIAPSIFDLEYVEEFETAFKNLATGRDNTNSDLPQLLSPFLLRRVKSEVMVDLPEKSEVILYAGMSELQKKYYKAILMKDYDIFSTDGPSRNKLNSILTN---LRKCVNHPYLFDGVEP---EPFALGE----------------------HLITASGKLHAIDQLLSYLYKRGHKVLMFSQMTRMLDIVQDYLGYRGYAYERLDGSVRGEERYIAIKNFNEEQDNFIFLLSTKAGGQGLNLMSADTVIFVDSDYNPQNDLQAAARAHRIGQTRPVKIIRLVGRNTVEEIILKHADDKMRLTNNVIEGGQVYDSSKIVASYRTLLLANILKFG 494          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:NCBI gene;Acc:101162589])

HSP 1 Score: 1145.57 bits (2962), Expect = 0.000e+0
Identity = 635/1461 (43.46%), Postives = 884/1461 (60.51%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIV--SVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKNLKINN---LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPI---------SQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDY--LPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNMKKNK-----------NPSFNKLDS--QETMEIAESTDTTQL---NSKDKNSEIDKKDDF-PTNAELNIRLRKIIGSFQKLWRQKE---------------SERNKIKTNYQSLDPAL---LTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    +V KI+ SR+V   VS G+        EVEE+++KY+ +SY+HCEW + + +  D     K+KR+K  +        + +E  FNPDYVE+DRVLE    E           D    + +VYYLVKW SLPYE+ TWE  +DVD +K++E+ Q  +    ++  + +P    WK     R Y+NGN+LRDYQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E++  G KGPFLII PLST+ NW+REF  W++LN+I+YHGS  SR+++Q+YE +  D +         F A+ITT+E++L      +  +W   IIDEAHRLKNK CKL+EG ++++L+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E+ F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FL+KG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL +F          + + N    +  LQ  +MV S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  ++             QLSKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  R S+F+KASF  + NR+DI LDDPNFW KWAKKA +D   +   NSL++D PR+R+QT  +        E+S  ES+G   D +K                                    ND           R + F+ EK LL +GWGRW+  L    FK  ++  ++ES+CR +L Y   HY GDD+I SF+ DL+ P  D  T  ++ HLG SAPV RGR+G+K                     +K  S  S D++  +      +     P  +  D+              +++H++   +K+L R++ LY+L  E+IG   AQ +L+  + +      E+K++   D D+  LP+ WW+   DKCL+LGIFKHG+EKY+ I  DP   F+         V   DEK +   +           +P +    +  ++ ME   S+    +   N+ D    ++ +  + P+ + L  RLR++I + Q+  + ++                +   + T +  L P L   L P+M + +    +  +W+RREE +FYR +++FG+          WT FR    L +K++ESL +Y  AF  MC+++C+  P   D   + +L ++ I+ ERA+R L ++ ++ ++R +++ HP + +R+ LC+ ++D P WW AG HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  738 EEDAAVVDKIMSSRVVKKEVSPGV------MVEVEEFFVKYKNYSYLHCEWATEQQLEKDKRIQQKIKRFKMKQAQRALFFADIEEDPFNPDYVEVDRVLEVSYCE-----------DKDTGQEVVYYLVKWCSLPYEDSTWELKDDVDQSKIEEFEQLQAVK-PDSRRVERPPANLWKKREHSREYRNGNMLRDYQLEGVNWLLFNWYNRRNCILADEMGLGKTIQSITFLEEIYRIGIKGPFLIIAPLSTIANWEREFHTWTHLNVIVYHGSVVSRQMLQQYEMYFRDAQGRAIRGAYRFQAVITTFEMILGGCPELNAIEWRCVIIDEAHRLKNKNCKLLEGFKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPTRFPSENTFMQEFGDLKTEEQVQKLQGILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLAKGAGQANMPNLVNTMMELRKCCNHPYLIKGAEEKILEDF----------REVHNPSAPDYHLQ--AMVQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRDNSLGGGSGGGAVQQQLSKKEIEDLLRRGAYGAIMDEEDEGAKFCEEDIDQILQRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWDKWAKKADIDMEMVNGRNSLVIDTPRVRKQTRPFSATKDELAELSEGESDG---DETKPKLR-------------------------------RND-----RLNSYGRTECFRVEKNLLVYGWGRWKDILNHGRFKKQLTEWDVESICRALLAYCLVHYRGDDKIKSFMWDLIAPTEDGRTKELQNHLGLSAPVPRGRKGKK---------------------MKTQSS-SFDIHKAE------WLRKHNPEHILQDD-------------GYKKHLKHHCNKVLLRVRMLYYLKQEVIG-SLAQKVLDGADSS------EIKIWVP-DPDHSELPALWWDAIADKCLLLGIFKHGYEKYNTIRADPTLCFLER-------VGRPDEKAIAAEQRANDLMDGDVDDPEYKPAPALLKDDMEDDASSPGDLVVSDNAGDAAPVMEGQSAYWPSPSVLTARLRRLITASQRFTKTRQIMHIHQAQSQFQTQSQQPMLLPTAFCPLPPMLNDTLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPSLGRFDWTKFRAMARLHKKTDESLQKYLCAFTAMCRRVCRLPPKEGDSAVDPSLTIQPITEERASRTLYRVELLRQVREQVLRHPLLYERLSLCQMSSDLPVWWEAGAHDHDLLIGAAKHGVSRTDYHILRDPELSF 2070          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:NCBI gene;Acc:101162589])

HSP 1 Score: 1118.61 bits (2892), Expect = 0.000e+0
Identity = 628/1455 (43.16%), Postives = 872/1455 (59.93%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVS--VSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYKNLKINN---LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTES------KPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNT--MKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDY--LPS-WWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNMKKNK-----------NPSFNKLDS--QETMEIAESTDTTQLNSKDKNS-EIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKE---------------SERNKIKTNYQSLDPAL---LTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDD--NNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEF 6932
            E    +V KI+ SR+V   VS G+        EVEE+++KY+ +SY+HCEW + + +  D     K+KR+K  +        + +E  FNPDYVE+DRVLE    E           D    + +VYYLVKW SLPYE+ TWE  +DVD +K++E+ Q  +    ++  + +P    WK     R Y+NGN+LRDYQLEGVNWL F W   RNCILADEMGLGKTIQSI FL E++  G KGPFLII PLST+ NW+REF  W++LN+I+YHGS  SR+++Q+YE +  D +         F A+ITT+E++L      +  +W   IIDEAHRLKNK CKL+EG ++++L+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E+ F+ ++G+L++EEQV  L+ +L+PMMLRRLKEDVEK LAPKEE ++EVELTNIQKKYYRAILE+NF+FL+KG    N+PNL+NTMMELRKCCNHP+LIKGAEE IL +F            + N    +  LQ  +MV S+GKLVLI KLLPK+K   HKVLIFSQMVR LDILEDYLI  +Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V VYRL+TRN+YEREMFDRASLKLGLDKA+LQSM+  ++          QLSKKEIEDLL+ GAYG++MD++ +G KFCEEDID+IL  R+  I + +  R S+F+K  F       DI LDDPNFW KWAKKA +D   +   NSL++D PR+R+QT  +        E+S  ES+G   D +K                                    ND           R + F+ EK LL +GWGRW+  L    FK  ++  ++ES+CR +L Y   HY GDD+I SF+ DL+ P  D  T  ++ HLG SAPV RGR+G+K                       +    S D++  +      +     P  +  D+              +++H++   +K+L R++ LY+L  E+IG   AQ +L+  + +      E+K++   D D+  LP+ WW+   DKCL+LGIFKHG+EKY+ I  DP   F+         V   DEK +   +           +P +    +  ++ ME   S+    + S +     +     +P+ + L  RLR++I + Q+  + ++                +   + T +  L P L   L P+M + +    +  +W+RREE +FYR +++FG+          WT FR    L +K++ESL +Y  AF  MC+++C+  P   D   + +L ++ I+ ERA+R L ++ ++ ++R +++ HP + +R+ LC+ ++D P WW AG HD  +L G +K+G +RT+  I+ D  L F
Sbjct:  240 EEDAAVVDKIMSSRVVKKEVSPGV------MVEVEEFFVKYKNYSYLHCEWATEQQLEKDKRIQQKIKRFKMKQAQRALFFADIEEDPFNPDYVEVDRVLEVSYCE-----------DKDTGQEVVYYLVKWCSLPYEDSTWELKDDVDQSKIEEFEQLQAVK-PDSRRVERPPANLWKKREHSREYRNGNMLRDYQLEGVNWLLFNWYNRRNCILADEMGLGKTIQSITFLEEIYRIGIKGPFLIIAPLSTIANWEREFHTWTHLNVIVYHGSVVSRQMLQQYEMYFRDAQGRAIRGAYRFQAVITTFEMILGGCPELNAIEWRCVIIDEAHRLKNKNCKLLEGFKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPTRFPSENTFMQEFGDLKTEEQVQKLQGILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLAKGAGQANMPNLVNTMMELRKCCNHPYLIKGAEEKILEDFRE----------VHNPSAPDYHLQ--AMVQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRDNSLGGGSGGGQQLSKKEIEDLLRRGAYGAIMDEEDEGAKFCEEDIDQILQRRTKTITIESEGRGSTFAK--FVHFKPPHDISLDDPNFWDKWAKKADIDMEMVNGRNSLVIDTPRVRKQTRPFSATKDELAELSEGESDG---DETKPKLR-------------------------------RND-----RLNSYGRTECFRVEKNLLVYGWGRWKDILNHGRFKKQLTEWDVESICRALLAYCLVHYRGDDKIKSFMWDLIAPTEDGRTKELQNHLGLSAPVPRGRKGKK----------------------MKTQSSSFDIHKAE------WLRKHNPEHILQDD-------------GYKKHLKHHCNKVLLRVRMLYYLKQEVIG-SLAQKVLDGADSS------EIKIWVP-DPDHSELPALWWDAIADKCLLLGIFKHGYEKYNTIRADPTLCFLER-------VGRPDEKAIAAEQRANDLMDGDVDDPEYKPAPALLKDDMEDDASSPGDLVVSDNAGGWSLLFSAYWPSPSVLTARLRRLITASQRFTKTRQIMHIHQAQSQFQTQSQQPMLLPTAFCPLPPMLNDTLNPKMAAKIE---RQQRWTRREEADFYRVVSTFGVVFDPSLGRFDWTKFRAMARLHKKTDESLQKYLCAFTAMCRRVCRLPPKEGDSAVDPSLTIQPITEERASRTLYRVELLRQVREQVLRHPLLYERLSLCQMSSDLPVWWEAGAHDHDLLIGAAKHGVSRTDYHILRDPELSF 1564          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd8 (chromodomain helicase DNA binding protein 8 [Source:NCBI gene;Acc:101165425])

HSP 1 Score: 1105.89 bits (2859), Expect = 0.000e+0
Identity = 618/1471 (42.01%), Postives = 884/1471 (60.10%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYK--NLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQ-RNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQ-PHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGN-NIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFY--SMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTE----SKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDS---NTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIP-GFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNM------------KKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKD--------------DFPTNAELNIRLRKIIGSFQKLWRQK----ESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEK--------HSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLE--VENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQ 6968
            E    IV K+L  RI       +         EE+++KY+ +SY+HCEW + E +  D     K+KR+K  + ++ +  ++DE  FNPDYVE+DR+L+               +D  N E ++YYLVKW SLPYE+ TWE  EDVD  KVKE+ +  N     + +   +P   +WK +   R YKNGN+LR+YQLEGVNWL F W   +NCILADEMGLGKTIQSIA L E++  G +GPFL+I PLST+ NW+REF  W+ +N I+YHGS  SR++IQ+YE +  D +    P    F+A+ITT+E++LSD     +  W   IIDEAHRLKN+ CKL++ L+MLDL+ +VLLTGTPLQN V+ELF+LL+FLE ++F  E +FL  +G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPK+E ++EVELT++QKKYYRAILERNF+FLS G + N N+PNL+NTMMELRKCCNHP+LI GAEE I+                  ++ D     F+  +++ S+GKLVL+ KLLP+LK   HKVLIFSQMVR LDILEDYLI ++Y YERIDGR+ G LRQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  +I+DSDWNPQNDLQAQARCHRIGQ K V VYRLITRN+YEREM D+ASLKLGLD+A+LQSM+  +    +  I Q SKKEIEDLL+ GAY ++MD++ +G +FCEEDID+IL  R+T I + +  + S+FSKASF  ++NR+DI LDDP FWQKWAK+A +D + I   N+L++D PR+R+QT +Y   S+L  E  GD S+    DS +                         +   +      +  +         R D F+ EK LL +GWGRW   L     K  +S +++E++CR IL +   HY GD+ I SFI +L+ P  +     T+  H G S PV RGR+G++                     +K  S    D+  ++      +     P ++  D+S             +R+H++   +K+L R++ LY+L  E+IG E A+ +L   +  D+    PE++       +   +WW++  D+ L+ G+FKHG+E Y  +  DP   FV    G       D E++             K +++P F K  S+ T E+ E  D+  +N +D+ S  DK                D+P+++ L  RLR++I ++Q+ +RQ+    E+E    +   +    + L       +    +  +W+RREE +FYR +++FG+EK         S   E  WT FR    L +K++ESL+ YF++F  MC+++C   P   +D +     V  I+ ERA+R L +I+++ ++R  ++ HP +E+R++L   +++ P+WW    HD  ++   S +G +RTE++I  D    F     + ++ QQ
Sbjct:  717 EEDAAIVDKVLSMRITKK----EVVPGQYTNAEEFFVKYKNYSYLHCEWATLEQLEKDKRIHQKIKRFKAKHAQMRHFFQEDEEPFNPDYVEVDRILDVSH-----------SVDKDNGEPVIYYLVKWCSLPYEDATWELKEDVDEGKVKEFSRIHNRQPCLKRTP--RPPASSWKKLEETREYKNGNILREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIALLSEVYTAGIQGPFLVIAPLSTITNWEREFCTWTQMNAIVYHGSLASRQMIQQYEMYCKDDKGHLIPGAYKFDALITTFEMVLSDCPELREISWRCVIIDEAHRLKNRNCKLLDSLKMLDLEHKVLLTGTPLQNTVEELFSLLHFLEPAQFPSEIEFLRDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTDVQKKYYRAILERNFSFLSLGANSNSNVPNLLNTMMELRKCCNHPYLINGAEEKIVAEL--------------REVYDPLAPDFHLQALIRSAGKLVLLDKLLPRLKAGGHKVLIFSQMVRCLDILEDYLINKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCVIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMLDKASLKLGLDRAVLQSMSGNKESNNNGQIQQFSKKEIEDLLRKGAYAAIMDENDEGSRFCEEDIDQILQRRATTITIESEGKGSTFSKASFVASENRNDIALDDPEFWQKWAKRADIDMDSINQKNTLVIDTPRIRKQTRQY---SSLRGE-GGDLSD---LDSDE------------------------EYPPANSRHSRSSRRADRHSGGGYGRTDCFRVEKHLLVYGWGRWRDILLHARCKRRLSERDVETICRVILVFCLIHYRGDENIKSFIWELITPPENGREPQTLLNHSGLSIPVPRGRKGKR---------------------VKAQSTF--DIQKVE------WIRKYNPDTLLLDDS-------------YRKHLKHQCNKVLLRVRMLYYLKQEVIG-EHAEAVLKGADIRDVDIWMPEME-----QQEVPAAWWDSDADRSLLAGVFKHGYEMYTTMRADPQLCFVERV-GRPDDKAIDAEQHTGDTEMGDEADFDKYSEDPEF-KPASRHTKELFEEADS--MNVEDEISVEDKIGPPVIESAPSQSGACDWPSSSSLTARLRRLITAYQRSYRQEQLKMEAEAKGDRRRRRCEQASKL-----KEIARQERQQRWTRREECDFYRVVSTFGVEKIKKEPGLPESSDAEFDWTRFRTFARLDKKTDESLSRYFRSFVAMCRRVCHLRPAHGEDQSQPPQTVAPITEERASRTLYRISLLRRLRERVLPHPCLEERLRLARPSSELPAWWKIPEHDHQLMFAASVHGVSRTELSIFPDPQFTFSSAREEFIQSQQ 2068          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd7 (chromodomain helicase DNA binding protein 7 [Source:NCBI gene;Acc:101165345])

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 535/1149 (46.56%), Postives = 730/1149 (63.53%), Query Frame = 3
Query: 2733 ESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESV-IDPAFPSKLKRYK-NLKINN-LEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLL-----FNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSK-------GVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFT-SDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESK--PISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEIC--NSLIMDKPRLRRQTNRY---KPNSTL-YDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESD--SNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFV 6101
            E +  +V+KI+G R    S           E+EE+Y+K++GFSY+HC W   E +  D     K+KR+K   ++NN + E D+  FNPDYVE+DRVL+     +++  +        N E +  YLVKW SLPYE+ TWE   D++ +K++EY +R +      + + +P   +WK +   R Y NGN LR+YQLEG+NWLTF W  +RNCILADEMGLGKTIQSI FL E++  G +GPFL+I PLST+ NW+REF  W+ LN+++YHGS  SRK+IQ YE +  D +     K++     F+A+ITT+E++L+D        W   +IDEAHRLKN+ CKL+EGL+M+D++ +VLLTGTPLQN V+ELF+LLNFLE  +F  E  F++++G+L++EEQV  L+ +L+PMMLRRLKEDVEK+LAPKEE ++EVELTNIQKKYYRAILE+NF+FLSK       G    ++PNL+NTMMELRKCCNHP+LI GAEE I+  F      G  T       + E  LQ  +M+ ++GKLVLI KLLPKLK   H+VL+FSQMVR LDILEDYLI  +Y YERIDGR+ G +RQ AIDRF+  D ++FVFLLCT+AGGLGINLTAAD  II+DSDWNPQNDLQAQARCHRIGQ K V +YRLITRN+YEREMFD+ASLKLGLDKA+LQSM+  E+    + QLSKKEIEDLLK GAYG+LMD++ +G KFCEEDID+IL  R+  I + +  + S+F+KASF    NR+DI L+DP+FWQKWAKKA +D + I   N+L++D PR+R+QT  Y   K +  L + E+  D+   S   +SK                                            TQ   R + F+ EK LL +GWGRW   L    FK P+   ++E++CR +L Y   HY GD+ I SFI DL+ P  D  + T+  H G S PV RGR+G+KG               P  +  + +   + + +++ +E S                              ++RH++   +K+L R++ LY+L  E+IG ++A+ IL+  + + +    ++ +     ++    WW++  DK L++G+FKHG+EKY+ +  DP   F+
Sbjct:  848 EVEGPVVEKIMGMR----SSKKQLESGEEVEMEEFYVKFKGFSYLHCRWAELEELERDKRIHQKIKRFKAKQQLNNFITEMDDEPFNPDYVEVDRVLD-----ISESTDE-------NGEMVTLYLVKWCSLPYEDCTWELKADIELSKIEEY-ERVASRTPNTNRVDRPPAADWKKLESSREYGNGNALREYQLEGLNWLTFNWYNSRNCILADEMGLGKTIQSITFLYEMYLMGIEGPFLVIAPLSTIPNWEREFRTWTELNVVVYHGSQASRKIIQAYEMYFRDGQG----KIIKGVYRFHAVITTFEMILADCPELRNIPWRCVVIDEAHRLKNRNCKLLEGLKMMDMEHKVLLTGTPLQNTVEELFSLLNFLEPERFPSEQTFMTEFGDLKTEEQVQKLQGILKPMMLRRLKEDVEKNLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGGAGGGGGSGAASVPNLLNTMMELRKCCNHPYLINGAEEKIIEEFRE--SHGGRTD------VPEMALQ--AMIQAAGKLVLIDKLLPKLKAGGHRVLVFSQMVRCLDILEDYLIQRRYPYERIDGRVRGNMRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKSVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRENANSGVQQLSKKEIEDLLKKGAYGALMDEEDEGSKFCEEDIDQILQRRTHTITIESEGKGSTFAKASFVAAGNRTDISLEDPDFWQKWAKKAELDMDAINGRNTLVIDTPRVRKQTRHYSSVKEDEMLEFSELESDDEEPSSRPTSKQR-------------------------------------RPQDKTQGYPRSECFRVEKNLLVYGWGRWSEILAHGRFKRPLKEADVETICRALLAYCLLHYRGDENIKSFIWDLITPSEDGTTRTLTNHSGLSTPVPRGRKGKKGKPS-----------APPPQTPRADWLATCNPDHLLQEDS------------------------------YKRHLKHHCNKVLLRVRMLYYLRQEVIG-DQAERILDGADSSML----DVWIPQPFHAEVPADWWDSEADKSLLVGVFKHGYEKYNSMRADPTLCFL 1882          

HSP 2 Score: 123.635 bits (309), Expect = 3.129e-27
Identity = 65/188 (34.57%), Postives = 112/188 (59.57%), Query Frame = 3
Query: 6459 KWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYD---DNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEVNKIA 7013
            +W+RREE +FYR I++FG+   ++  +  WT FR    L +K++ESL +Y+ +F  MC+++C R  +  +    + TL ++ I+ ERA+R L +I ++ +IR +++ HP + +R+KLC+ + D P WW  G HD  +L G SK+G +RT+  I++D +L F +       Q+    S     E+ K  
Sbjct: 2084 RWTRREEADFYRVISTFGVVFDTQRQKFDWTQFRAFARLDKKTDESLEKYYYSFIAMCKRVC-RMQIKNEAELPDPTLIIDPITEERASRTLYRIELLRRIREQVLPHPLLAERLKLCQPSQDLPEWWECGRHDRDLLVGASKHGVSRTDYHILNDPSLAFLEAHQRYTSQRGAGASVGAQGELAKAG 2270          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Match: chd2 (chromodomain helicase DNA binding protein 2 [Source:NCBI gene;Acc:101160654])

HSP 1 Score: 483.411 bits (1243), Expect = 3.417e-139
Identity = 301/777 (38.74%), Postives = 444/777 (57.14%), Query Frame = 3
Query: 2742 NQIVQKILGSRIVSVSD-GIDASIKATEE---------------VEEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLK-------------------INNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETI---VYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYT-ENSELIKPTHKNWKPITMDRVY----------KNGNV-LRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFN-YGFKGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSD-PEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPI---------SQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKIL 4886
            ++ ++KIL +RI      G   ++ A EE                 +Y +K++G+SYIH  W+S +S+        LK+  N K                    +N +++     N  +  ++RV+ +K      K     D    + +T      YL KW  LPY E +WE     D A V +  QR   ++T  NS    P+ K+ K +     +           + N+ LRDYQL+G+NWL   W    + ILADEMGLGKTIQ+I+FL  LF+ +   GPFL++VPLSTL +WQREFE W+ ++N+++Y G   SRK I+ YE   ++H++    ++ FNA+ITTYE+LL D        WA   +DEAHRLKN    L + L       R+L+TGTPLQN+++EL++LL+FL   KF    DF  ++G  R +    SL  +L+P +LRR+K+DVEKSL  K E ++ V++T  QK++Y+ IL RN+  LSKG  G++    +N +MEL+KCCNH FLIK  E+                    +  + ++ LQ   +V  SGKLVL+ KLL +L++  ++VLIFSQMVR+LDIL  YL  +++ ++R+DG I G +R++A+D F ++  E F FLL T+AGGLGINL +AD V+I+DSDWNPQNDLQAQAR HRIGQ+K VN+YRL+T+ T E ++ +RA  K+ LD  ++Q M  T    +         +  +K+E+  +LK GA     + + +  +  E DID+IL
Sbjct:  240 SETIEKILDTRIGKKGAIGAATTVYAVEENGDPAEGFDPEKEEGETQYLIKWKGWSYIHSTWESMDSLTQQKVKG-LKKMDNFKKKSEEMNAWLRRACPEDIEFHNCQQELMADLNKQFQIVERVIATK----TGKTAGTSDFPSHSHKTSSDEPEYLCKWMGLPYSECSWE-----DGALVMKKFQRCIDSFTSRNSSKTVPS-KDCKVLKQRPRFVALKKQPTYIGDENLELRDYQLDGLNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLLVVPLSTLTSWQREFETWAPDMNVVVYIGDVMSRKTIRDYEW--VNHQTK---RIRFNALITTYEILLKDKGVLGNINWAFLGVDEAHRLKNDDSLLYKTLMEFRSNHRLLITGTPLQNSLKELWSLLHFLMPDKFDSWEDFEDEHGKGR-DNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMTAQQKQFYKWILTRNYKALSKGTRGSSS-GFLNIVMELKKCCNHCFLIKQPEDG-------------------DGEVQQDVLQ--GVVRGSGKLVLLDKLLTRLRERGNRVLIFSQMVRMLDILAKYLTKKRFPFQRLDGSIKGEIRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDSNSGNTNSNPFNKEELTAILKFGAEDLFKEAEGEESEPQEMDIDEIL 977          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000000092.1 (SMESG000000092.1)

HSP 1 Score: 5713.27 bits (14820), Expect = 0.000e+0
Identity = 3058/3078 (99.35%), Postives = 3066/3078 (99.61%), Query Frame = 3
Query:   36 MDHDIFSCNVTSSFLDDLSEISQEPLNICNYNQTNRLQNSNIYNRELCASQSTMNYYPVASTLSSHPNYQRSNMYNYNFPNYEYNSNIPDQRMNMPYIQSTNSDHRMMDMQYDSMKIIENDRMNLPPNNYIPVKNNIPNNYIDNKYQNFQKYYSINKNNFQHNQMYRSSEIPSSGHNESHCMNYQYPQYFPNGSQSVYYDHGVSHFDEHQKAERINFQNIASIDQNIYNFETKLHFLSQNLSNNPNCIHEINEIKEKLVYFNQLKEKCLLSRNKMNFNFKGDINENKDVTAIKQINNYNSAPRQDVYNSTNSNMSPFYSRNINKPYDGXXXXXXXXXXXXSEKFVQIESSEVDKTFPNNIIDNSSHKSFISELTSGEFPQTSTSNTKQQNNRDELFTPPISEFTDLTSVMPLKDSQTKPNITQTNDTNKNNPLKTDPSELEIHIQSVYQNSEIDKPNTNEIDNNLSVKSELESQINFSKSLDNELKTDSMGIIADNNEETEETSKSPGKPESICDSIEKKPIDEIECEIXXXXXXXXXETVNEAISTVVGNDLNTTNSCLTEINEIVQSIDNDNPVSTEALIDTEKEANNENGTVINNLSNLRENFEKFDIITNTNTDEDNIGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSLSIKNAELNSKEIIVEGSVENCCELILFHGEKLLPRIDKKPDATTTSPLPFNENNSSIADAEKSISKVPFQKSNMKMLMLKKPRNKFKSIKTSKWCXXXXXXXXXXXXXXXNQQHYINKKLKSCQSQSVSNDDSKQSEEINTKKRILNNACKTARRMKNVASFLKKKNSKGSYFNNFDLEEKNISKKSLRNSTEFHITTRLKKETSFXXXXXXXXXXXXXXXXXXXFELNLESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIENCLDESDASSNFMLEKADELIYEDTFNNLIVQIINEFIDQLDSVKKETDTDYCENISNNDDITFDISVLSKIGWPKERILFSRLELIVQTIEKGEWPFSKNQNIPIFEESEVLSGSLKTNKEEVVSLFQASENIKTEPQLTSFKSKRRGRKRTVTQFMPTQQINDISKTDQIKLEEHCLQEETNIQXXXXXXXXXXXXXXXXXXXXMQKMLQMTPETNSGHASSSAPGSENRIXXXXXXXXXXXXFKVKXXXXXXXXXXXXXXXXXXXGIKTSKNNVRRGRRPKHTGPYEVSRDSKRESVSGLXXXXXXXXXXXXXXXXXXXXPETIIPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMSTMLASQSPLNIYNSFLLSGEGSKNSLPDEQMNNASSFYMQQYQDCLLSMLGTSGHSMPPGLDFKSLINHEELTKGNKRRSISPIKNTGIPTKVKSYSISHLTDDDNSGSPEENRTPAHSNLASIVGLVEKSEDKLGFLNSNYKISNSKLSTPEAVGKLHISNSNSDMLASYQAYLYSAMLYSDYISSMQQYSLANNKINNNIPEIFSNFKXXXXXXXXNKAIDIMQSNSNNNQVNITPTPNIPIELT-XXXXXXXXXXXXXXXXXXXXXXXXXKANKRNKVTNFSVESMGIAATEPFPNIKVGSVEQSATSHISSSQDNNDDDYAVLDLSNR 9266
            MDHDIFSCNVTSSFLDDLSEISQEPLNICNYNQTNRLQNSNIYNRELCASQSTMNYYPVASTLSSHPNYQRSNMYNYNFPNYEYNSNIPDQRMNMPYIQSTNSDHRMMDMQYDSMKIIENDRMNLPPNNYIPVKNNIPNNYIDNKYQNFQKYYSINKNNFQHNQMYRSSEIPSSGHNESHCMNYQYPQYFPNGSQSVYYDHGVSHFDEHQKAERINFQNIASIDQNIYNFETKLHFLSQNLSNNPNCIHEINEIKEKLVYFNQLKEKCLLSRNKMNFNFKGDINENKDVTAIKQINNYNSAPRQDVYNSTNSNMSPFYSRNINKPYDGYMYNYMPNNQQYSEKFVQIESSEVDKTFPNNIIDNSSHKSFISELTSGEFPQTSTSNTKQQNNRDELFTPPISEFTDLTSVMPLKDSQTKPNITQTNDTNK NPLKTDPSELEIHIQSVYQNSEIDKPNTNEIDNNLSVKSELESQINFSKSLDNELKTDSMGIIADNNEETEETSKSPGKPESICDSIEK PIDEIECEIPSQSSSPSPETVNEAISTVVGNDLNTTNSCLTEINEIVQSIDNDNPVS+EALIDTE EANNENGTVINNLSNLRENFEKFDIITNT+TDEDNIGTNIDDVDEADENNDNNDNNNNIDDDDND+DDDDNNNNDSQDDDKSLSIKNAE NSKEIIVEGSVENCCELILFHGEKLLPRIDKKPDATTTSPLPFNENNSSIAD EKSISKVPF+KSNMKM MLKKPRNKFKSIKTSKWCYKIKKYYFYLKLKHLNQQHYINKKLKSCQSQSVSNDDSKQSEEINTKKRILNNACKTARRMKNVASFLKKKNSKGSYFNNFDLEEKNISKKSLRNSTEFHITTRLKKETSFEIDSNEENSSNSDDEIHSIFELNLESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCEN+FDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAH HSNNKNLTLNSKVKKKNLKSPTF+LPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFV+WFSGNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMKINIISKIRNEIIVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLR QQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIENCLDESDASSNFMLEKADELIYEDTFNNLIVQIINEFIDQLDSVKKETDTDYCENISNNDDITFDISVLSKIGWPKERILFSRLELIVQTIEKGEWPFSKNQN+PIFEESEVLS SLKTNKEEVVSLFQASENIKTEPQLTSFKSKRRGRKRTVTQFMP QQINDISKTDQIKLEEHCLQEETNIQAAYSWNAALSLSLSSDPTLLMQKMLQMTPETNSGHASSSAPGSENRISNPNNGLNLSNLFKVKSTTNGSSTDSSSWNVSQTSGIKTSKNNVRRGRRPKHTGPYEVSRDSKRESVSGLNIFNNRSLNSNSSIENSNSNPETIIPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMSTMLASQSPLNIYNSFLLSGEGSKNSLPDEQMNNASSFYMQQYQDCLLSMLGTSGHSMPPGLDFKSLINHEELTKGNKRRSISPIKNTGIPTKVKSYSISHLTDDDNSGSPEENRTPAHSNLASIVGLVEKSEDKLGFLNSNYKISNSKLSTPEAVGKLHISNSNSDMLASYQAYLYSAMLYSDYISSMQQYSLANNKINNNIPEIFSNFKQPPPQQQQNKAIDIMQSNSNNNQVNITPTPNIPIELT SS LLSSSSSLLSALSSSSSSSFSSKANKRNKVTNFSVESMGIAATEPFPNIKVGSVEQSATSHISSSQDNNDDDYAVLDLSNR
Sbjct:    1 MDHDIFSCNVTSSFLDDLSEISQEPLNICNYNQTNRLQNSNIYNRELCASQSTMNYYPVASTLSSHPNYQRSNMYNYNFPNYEYNSNIPDQRMNMPYIQSTNSDHRMMDMQYDSMKIIENDRMNLPPNNYIPVKNNIPNNYIDNKYQNFQKYYSINKNNFQHNQMYRSSEIPSSGHNESHCMNYQYPQYFPNGSQSVYYDHGVSHFDEHQKAERINFQNIASIDQNIYNFETKLHFLSQNLSNNPNCIHEINEIKEKLVYFNQLKEKCLLSRNKMNFNFKGDINENKDVTAIKQINNYNSAPRQDVYNSTNSNMSPFYSRNINKPYDGYMYNYMPNNQQYSEKFVQIESSEVDKTFPNNIIDNSSHKSFISELTSGEFPQTSTSNTKQQNNRDELFTPPISEFTDLTSVMPLKDSQTKPNITQTNDTNKKNPLKTDPSELEIHIQSVYQNSEIDKPNTNEIDNNLSVKSELESQINFSKSLDNELKTDSMGIIADNNEETEETSKSPGKPESICDSIEKNPIDEIECEIPSQSSSPSPETVNEAISTVVGNDLNTTNSCLTEINEIVQSIDNDNPVSSEALIDTENEANNENGTVINNLSNLRENFEKFDIITNTDTDEDNIGTNIDDVDEADENNDNNDNNNNIDDDDNDNDDDDNNNNDSQDDDKSLSIKNAESNSKEIIVEGSVENCCELILFHGEKLLPRIDKKPDATTTSPLPFNENNSSIADGEKSISKVPFRKSNMKMFMLKKPRNKFKSIKTSKWCYKIKKYYFYLKLKHLNQQHYINKKLKSCQSQSVSNDDSKQSEEINTKKRILNNACKTARRMKNVASFLKKKNSKGSYFNNFDLEEKNISKKSLRNSTEFHITTRLKKETSFEIDSNEENSSNSDDEIHSIFELNLESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENDFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHCHSNNKNLTLNSKVKKKNLKSPTFSLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVDWFSGNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMKINIISKIRNEIIVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRHQQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIENCLDESDASSNFMLEKADELIYEDTFNNLIVQIINEFIDQLDSVKKETDTDYCENISNNDDITFDISVLSKIGWPKERILFSRLELIVQTIEKGEWPFSKNQNLPIFEESEVLSDSLKTNKEEVVSLFQASENIKTEPQLTSFKSKRRGRKRTVTQFMPPQQINDISKTDQIKLEEHCLQEETNIQAAYSWNAALSLSLSSDPTLLMQKMLQMTPETNSGHASSSAPGSENRISNPNNGLNLSNLFKVKSTTNGSSTDSSSWNVSQTSGIKTSKNNVRRGRRPKHTGPYEVSRDSKRESVSGLNIFNNRSLNSNSSIENSNSNPETIIPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMSTMLASQSPLNIYNSFLLSGEGSKNSLPDEQMNNASSFYMQQYQDCLLSMLGTSGHSMPPGLDFKSLINHEELTKGNKRRSISPIKNTGIPTKVKSYSISHLTDDDNSGSPEENRTPAHSNLASIVGLVEKSEDKLGFLNSNYKISNSKLSTPEAVGKLHISNSNSDMLASYQAYLYSAMLYSDYISSMQQYSLANNKINNNIPEIFSNFKQPPPQQQQNKAIDIMQSNSNNNQVNITPTPNIPIELTSSSLLLSSSSSLLSALSSSSSSSFSSKANKRNKVTNFSVESMGIAATEPFPNIKVGSVEQSATSHISSSQDNNDDDYAVLDLSNR 3078          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000000092.1 (SMESG000000092.1)

HSP 1 Score: 5667.04 bits (14700), Expect = 0.000e+0
Identity = 3040/3078 (98.77%), Postives = 3048/3078 (99.03%), Query Frame = 3
Query:   36 MDHDIFSCNVTSSFLDDLSEISQEPLNICNYNQTNRLQNSNIYNRELCASQSTMNYYPVASTLSSHPNYQRSNMYNYNFPNYEYNSNIPDQRMNMPYIQSTNSDHRMMDMQYDSMKIIENDRMNLPPNNYIPVKNNIPNNYIDNKYQNFQKYYSINKNNFQHNQMYRSSEIPSSGHNESHCMNYQYPQYFPNGSQSVYYDHGVSHFDEHQKAERINFQNIASIDQNIYNFETKLHFLSQNLSNNPNCIHEINEIKEKLVYFNQLKEKCLLSRNKMNFNFKGDINENKDVTAIKQINNYNSAPRQDVYNSTNSNMSPFYSRNINKPYDGXXXXXXXXXXXXSEKFVQIESSEVDKTFPNNIIDNSSHKSFISELTSGEFPQTSTSNTKQQNNRDELFTPPISEFTDLTSVMPLKDSQTKPNITQTNDTNKNNPLKTDPSELEIHIQSVYQNSEIDKPNTNEIDNNLSVKSELESQINFSKSLDNELKTDSMGIIADNNEETEETSKSPGKPESICDSIEKKPIDEIECEIXXXXXXXXXETVNEAISTVVGNDLNTTNSCLTEINEIVQSIDNDNPVSTEALIDTEKEANNENGTVINNLSNLRENFEKFDIITNTNTDEDNIGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSLSIKNAELNSKEIIVEGSVENCCELILFHGEKLLPRIDKKPDATTTSPLPFNENNSSIADAEKSISKVPFQKSNMKMLMLKKPRNKFKSIKTSKWCXXXXXXXXXXXXXXXNQQHYINKKLKSCQSQSVSNDDSKQSEEINTKKRILNNACKTARRMKNVASFLKKKNSKGSYFNNFDLEEKNISKKSLRNSTEFHITTRLKKETSFXXXXXXXXXXXXXXXXXXXFELNLESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHFHXXXXXXXXXXXXXXXXXXXPTFTLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMXXXXXXXXXXXXXVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRQQQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIENCLDESDASSNFMLEKADELIYEDTFNNLIVQIINEFIDQLDSVKKETDTDYCENISNNDDITFDISVLSKIGWPKERILFSRLELIVQTIEKGEWPFSKNQNIPIFEESEVLSGSLKTNKEEVVSLFQASENIKTEPQLTSFKSKRRGRKRTVTQFMPTQQINDISKTDQIKLEEHCLQEETNIQXXXXXXXXXXXXXXXXXXXXMQKMLQMTPETNSGHASSSAPGSENRIXXXXXXXXXXXXFKVKXXXXXXXXXXXXXXXXXXXGIKTSKNNVRRGRRPKHTGPYEVSRDSKRESVSGLXXXXXXXXXXXXXXXXXXXXPETIIPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMSTMLASQSPLNIYNSFLLSGEGSKNSLPDEQMNNASSFYMQQYQDCLLSMLGTSGHSMPPGLDFKSLINHEELTKGNKRRSISPIKNTGIPTKVKSYSISHLTDDDNSGSPEENRTPAHSNLASIVGLVEKSEDKLGFLNSNYKISNSKLSTPEAVGKLHISNSNSDMLASYQAYLYSAMLYSDYISSMQQYSLANNKINNNIPEIFSNFKXXXXXXXXNKAIDIMQSNSNNNQVNITPTPNIPIELT-XXXXXXXXXXXXXXXXXXXXXXXXXKANKRNKVTNFSVESMGIAATEPFPNIKVGSVEQSATSHISSSQDNNDDDYAVLDLSNR 9266
            MDHDIFSCNVTSSFLDDLSEISQEPLNICNYNQTNRLQNSNIYNRELCASQSTMNYYPVASTLSSHPNYQRSNMYNYNFPNYEYNSNIPDQRMNMPYIQSTNSDHRMMDMQYDSMKIIENDRMNLPPNNYIPVKNNIPNNYIDNKYQNFQKYYSINKNNFQHNQMYRSSEIPSSGHNESHCMNYQYPQYFPNGSQSVYYDHGVSHFDEHQKAERINFQNIASIDQNIYNFETKLHFLSQNLSNNPNCIHEINEIKEKLVYFNQLKEKCLLSRNKMNFNFKGDINENKDVTAIKQINNYNSAPRQDVYNSTNSNMSPFYSRNINKPYDGYMYNYMPNNQQYSEKFVQIESSEVDKTFPNNIIDNSSHKSFISELTSGEFPQTSTSNTKQQNNRDELFTPPISEFTDLTSVMPLKDSQTKPNITQTNDTNK NPLKTDPSELEIHIQSVYQNSEIDKPNTNEIDNNLSVKSELESQINFSKSLDNELKTDSMGIIADNNEETEETSKSPGKPESICDSIEK PIDEIECEIPSQSSSPSPETVNEAISTVVGNDLNTTNSCLTEINEIVQSIDNDNPVS+EALIDTE EANNENGTVINNLSNLRENFEKFDIITNT+TDEDNIGTNIDDVDEADENNDNNDNNNNIDDDDND+DDDDNNNNDSQDDDKSLSIKNAE NSKEIIVEGSVENCCELILFHGEKLLPRIDKKPDATTTSPLPFNENNSSIAD EKSISKVPF+KSNMKM MLKKPRNKFKSIKTSKWCYKIKKYYFYLKLKHLNQQHYINKKLKSCQSQSVSNDDSKQSEEINTKKRILNNACKTARRMKNVASFLKKKNSKGSYFNNFDLEEKNISKKSLRNSTEFHITTRLKKETSFEIDSNEENSSNSDDEIHSIFELNLESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCEN+FDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAH HSNNKNLTLNSKVKKKNLKSPTF+LPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFV+WFSGNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMKINIISKIRNEIIVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLR QQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIENCLDESDASSNFMLEKADELIYEDTFNNLIVQIINEFIDQLDSVKKETDTDYCENISNNDDITFDISVLSKIGWPKERILFSRLELIVQTIEKGEWPFSKNQN+PIFEESEVLS SLKTNKEEVVSLFQASENIKTEPQLTSFKSKRRGRKRTVTQFMP QQINDISKTDQIKLEEHCLQEETNIQAAYSWNAALSLSLSSDPTLLMQKMLQMTPETNSGHASSSAPGSENRISNPNNGLNLSNLFKVKSTTNGSSTDSSSWNVSQTSGIKTSKNNVRRGRRPKHTGPYEVSRDSKRESVSGLNIFNNRSLNSNSSIENSNSNPETIIPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMSTMLASQSPLNIYNSFLLSGEGSKNSLPDEQMNNASSFYMQQYQDCLLSMLGTSGHSMPPGLDFKSLINHEELTKGNKRRSISPIKNTGIPTKVKSYSISHLTDDDNSGSPEENRTPAHSNLASIVGLVEKSEDKL                  AVGKLHISNSNSDMLASYQAYLYSAMLYSDYISSMQQYSLANNKINNNIPEIFSNFKQPPPQQQQNKAIDIMQSNSNNNQVNITPTPNIPIELT SS LLSSSSSLLSALSSSSSSSFSSKANKRNKVTNFSVESMGIAATEPFPNIKVGSVEQSATSHISSSQDNNDDDYAVLDLSNR
Sbjct:    1 MDHDIFSCNVTSSFLDDLSEISQEPLNICNYNQTNRLQNSNIYNRELCASQSTMNYYPVASTLSSHPNYQRSNMYNYNFPNYEYNSNIPDQRMNMPYIQSTNSDHRMMDMQYDSMKIIENDRMNLPPNNYIPVKNNIPNNYIDNKYQNFQKYYSINKNNFQHNQMYRSSEIPSSGHNESHCMNYQYPQYFPNGSQSVYYDHGVSHFDEHQKAERINFQNIASIDQNIYNFETKLHFLSQNLSNNPNCIHEINEIKEKLVYFNQLKEKCLLSRNKMNFNFKGDINENKDVTAIKQINNYNSAPRQDVYNSTNSNMSPFYSRNINKPYDGYMYNYMPNNQQYSEKFVQIESSEVDKTFPNNIIDNSSHKSFISELTSGEFPQTSTSNTKQQNNRDELFTPPISEFTDLTSVMPLKDSQTKPNITQTNDTNKKNPLKTDPSELEIHIQSVYQNSEIDKPNTNEIDNNLSVKSELESQINFSKSLDNELKTDSMGIIADNNEETEETSKSPGKPESICDSIEKNPIDEIECEIPSQSSSPSPETVNEAISTVVGNDLNTTNSCLTEINEIVQSIDNDNPVSSEALIDTENEANNENGTVINNLSNLRENFEKFDIITNTDTDEDNIGTNIDDVDEADENNDNNDNNNNIDDDDNDNDDDDNNNNDSQDDDKSLSIKNAESNSKEIIVEGSVENCCELILFHGEKLLPRIDKKPDATTTSPLPFNENNSSIADGEKSISKVPFRKSNMKMFMLKKPRNKFKSIKTSKWCYKIKKYYFYLKLKHLNQQHYINKKLKSCQSQSVSNDDSKQSEEINTKKRILNNACKTARRMKNVASFLKKKNSKGSYFNNFDLEEKNISKKSLRNSTEFHITTRLKKETSFEIDSNEENSSNSDDEIHSIFELNLESKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEIDRVLESKQIEVNKKCENDFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYLQRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQREFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEISGDESNGSIFDSSKAHCHSNNKNLTLNSKVKKKNLKSPTFSLPSESKDAENDDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELESLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARGRRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTNISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHEIIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVLGIFKHGWEKYDDIYKDPCFGFVDWFSGNNYPVCSDDEKNMKKNKNPSFNKLDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSFQKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETEFYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQKICQRYPLLYDDNNTLEVENISTERANRCLMKINIISKIRNEIIVHPEIEKRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFRQTILDLLRHQQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIENCLDESDASSNFMLEKADELIYEDTFNNLIVQIINEFIDQLDSVKKETDTDYCENISNNDDITFDISVLSKIGWPKERILFSRLELIVQTIEKGEWPFSKNQNLPIFEESEVLSDSLKTNKEEVVSLFQASENIKTEPQLTSFKSKRRGRKRTVTQFMPPQQINDISKTDQIKLEEHCLQEETNIQAAYSWNAALSLSLSSDPTLLMQKMLQMTPETNSGHASSSAPGSENRISNPNNGLNLSNLFKVKSTTNGSSTDSSSWNVSQTSGIKTSKNNVRRGRRPKHTGPYEVSRDSKRESVSGLNIFNNRSLNSNSSIENSNSNPETIIPIINIFNGTLIYDENAPKRKNLESFLMHNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMSTMLASQSPLNIYNSFLLSGEGSKNSLPDEQMNNASSFYMQQYQDCLLSMLGTSGHSMPPGLDFKSLINHEELTKGNKRRSISPIKNTGIPTKVKSYSISHLTDDDNSGSPEENRTPAHSNLASIVGLVEKSEDKL------------------AVGKLHISNSNSDMLASYQAYLYSAMLYSDYISSMQQYSLANNKINNNIPEIFSNFKQPPPQQQQNKAIDIMQSNSNNNQVNITPTPNIPIELTSSSLLLSSSSSLLSALSSSSSSSFSSKANKRNKVTNFSVESMGIAATEPFPNIKVGSVEQSATSHISSSQDNNDDDYAVLDLSNR 3060          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000033395.1 (SMESG000033395.1)

HSP 1 Score: 446.817 bits (1148), Expect = 8.599e-132
Identity = 271/697 (38.88%), Postives = 403/697 (57.82%), Query Frame = 3
Query: 2814 ATEEVEEYYLKYRGFSYIHCEWKSSESVIDPAFPSKLKRYKNLKINNLEEQDECL----FNPDYVEIDRVLESKQ---IEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSE----DVDPAKVKEYLQRNSYAYTENSELIKPTHK-NWKPITMDRVYKNGNV---LRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFN-YGFKGPFLIIVPLSTLGNWQREFEQWSN-LNIILYHGSAKSRKLIQKYEAFSLDHESSQPHK--LLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYG----NLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEK-FVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTY-----TESKPISQLSKKEIEDLLKLGA 4817
            + E   +Y +K+R +S+IH  W+S  +V        +K+   LK   ++++ E       +P+ ++  +  E +    ++   +CE   D         + YL+KW++L Y   TWE  +    ++ P  + E+ +R+      N +    T +  + PI     Y +      LRDYQL+GVNWL   W    + ILADEMGLGKTIQ+I FL  LFN +   GPFL++VPLST+ +WQ EF  W+  +NII+Y G A SR++I++ E +        P K  L F+  ITTYE+LL D  + +K  WA   +DEAHRLKN   +L   L   D   R+L+TGTP+ N+++EL+ LL+F+   KF    DF  +Y     N   EE V+ L  +L+P +LRR K+DVEKSL  K E ++ V +   Q + Y+ IL +N+  LSK   G+   + +N +MEL+KCCNH  L+   +E                   +NK+  +  L++Y  + SSGK++L+ KL+ +LK+  H+VLIFSQMVR+LDI+ DYL+   + ++R+DG I G LR++AID F ++    F FLL T+AGGLGINL  AD VII+DSDWNPQNDLQA AR HRIGQ++ V+VYR + +N+ E ++ + A  K+ LD  ++Q M       T++      SK E+ ++LK GA
Sbjct:  234 SDETERQYLIKWREWSHIHSTWESETTVQTYQNFDGMKKL--LKFKEIQKRREIWKKHHASPEDLDAAQFEEERNESLLQQKMECERIIDAQRNKNSDSLDYLIKWKTLDYRYSTWESGDIIVKNLFPNGIIEFEERSRSVKIPNRKCEALTRRPKFAPIREQPDYLSHTSDMKLRDYQLDGVNWLAHAWTRGNSVILADEMGLGKTIQTIGFLSYLFNQHTIFGPFLLVVPLSTISSWQTEFNIWAPYMNIIIYTGDAVSRQVIRECEWYF-------PKKKMLKFHVCITTYELLLKDKDWLNKISWAFLGVDEAHRLKNDESQLYNFLITFDTNTRLLITGTPVHNSLRELWALLHFIMPDKFNTWPDFEDRYNISNENREVEEVVSELYKVLEPFLLRRTKKDVEKSLPSKSEQIIRVPMCRKQTELYKLILTKNYEALSKETRGHT-SSFLNIVMELKKCCNHVQLVNPLDEET-----------------ENKMDPDSHLRYY--IKSSGKMMLLDKLMFELKEKGHRVLIFSQMVRMLDIISDYLVLRGWGFQRLDGSIKGSLRKQAIDHFNAEGSTDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMARAHRIGQKRQVSVYRFVIKNSIEEKIIECAKRKMVLDHLVIQRMDSALHRKTDANKNQPFSKDELNEILKFGA 901          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 455.677 bits (1171), Expect = 6.508e-130
Identity = 305/893 (34.15%), Postives = 456/893 (51.06%), Query Frame = 3
Query: 2751 VQKILGSRIVSVSDG---IDASIKATE--------------EVEEYYLKYRGFSYIHCEWKSS-----------------ESVIDPAFPSKLKRYKN------LKINNLEEQ-DECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEK----SEDVDPAKVKEYLQRNSYAYT--------ENSEL--------IKPTH-----KNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGF-KGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHES----------SQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMDDDKDGEKFCEEDIDKILLSRSTVIRLNNSERN-------------SSFSKASFS---ITDN----------------RSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTN 5096
            V KIL  R +    G   +D + K+TE               + E+++K+R  SY +CEW +                    + +P  P     YK          +NLEE+  +    P++++I R+++                   ++   ++YL+KWR L Y+E TWE+     E +D   + E        +T        +NS +        I P H     K       D + + G  L  YQLEG+NWL F +    + ILADEMGLGKTIQ+I FL  L+  G  KGPFL+  PLST+ NW+REFE W+ +  ++ Y G   SR +++++E FS +  +           Q  +  F+ ++T+YE++  D        W   ++DEAHRLKN + K    L    + +++LLTGTPLQNN++ELF+LL+F+   KF     FL ++ ++  EEQV  L  +L   +LRRLK DV   +  K E +V VEL+ +Q K+Y+ IL RNF  LS    G+ I +L+N +M+L+KCCNHP+L           F SG+D        +   +     +  +++ +SGKL L++K+LPKLK   H+VLIFSQM R+LDILED++ Y  Y++ERIDG + G  RQ++IDRF + D   FVFLL T+AGGLGINL  AD VIIYDSDWNP ND+QA +R HRIGQ   V +YR +TRNT E  +   A  K+ L   +++       K  + +SKKE++++LK G      + D++      ED  KI+     + RL +  +              SSF  A +S   ++ N                + D+   DP +W+K  +     + E  +  +    R+R+Q N
Sbjct:  504 VHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDH----------------MTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHE-FSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQI-SLINIVMDLKKCCNHPYL-----------FPSGSD--------EAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPG--LGGKGGASMSKKELDEILKFGTEDLFKEKDEN------EDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVN 1351          
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Match: SMESG000068192.1 (SMESG000068192.1)

HSP 1 Score: 455.677 bits (1171), Expect = 7.369e-130
Identity = 305/886 (34.42%), Postives = 457/886 (51.58%), Query Frame = 3
Query: 2751 VQKILGSRIVSVSDG---IDASIKATE--------------EVEEYYLKYRGFSYIHCEWKSS-----------------ESVIDPAFPSKLKRYKN------LKINNLEEQ-DECLFNPDYVEIDRVLESKQIEVNKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEK----SEDVDPAKVKEYLQRNSYAYT--------ENSEL--------IKPTH-----KNWKPITMDRVYKNGNVLRDYQLEGVNWLTFCWITNRNCILADEMGLGKTIQSIAFLIELFNYGF-KGPFLIIVPLSTLGNWQREFEQWS-NLNIILYHGSAKSRKLIQKYEAFSLDHES----------SQPHKLLFNAIITTYEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLTGTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQPMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGVSGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQNKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDILEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTS-DPEKFVFLLCTKAGGLGINLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYEREMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMD-DDKDGEKFCEED--IDKILLSRSTVIRLNN---SERNSSFSKASFS---ITDN----------------RSDIKLDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTN 5096
            V KIL  R +    G   +D + K+TE               + E+++K+R  SY +CEW +                    + +P  P     YK          +NLEE+  +    P++++I R+++                   ++   ++YL+KWR L Y+E TWE+     E +D   + E        +T        +NS +        I P H     K       D + + G  L  YQLEG+NWL F +    + ILADEMGLGKTIQ+I FL  L+  G  KGPFL+  PLST+ NW+REFE W+ +  ++ Y G   SR +++++E FS +  +           Q  +  F+ ++T+YE++  D        W   ++DEAHRLKN + K    L    + +++LLTGTPLQNN++ELF+LL+F+   KF     FL ++ ++  EEQV  L  +L   +LRRLK DV   +  K E +V VEL+ +Q K+Y+ IL RNF  LS    G+ I +L+N +M+L+KCCNHP+L           F SG+D        +   +     +  +++ +SGKL L++K+LPKLK   H+VLIFSQM R+LDILED++ Y  Y++ERIDG + G  RQ++IDRF + D   FVFLL T+AGGLGINL  AD VIIYDSDWNP ND+QA +R HRIGQ   V +YR +TRNT E  +   A  K+ L   +++       K  + +SKKE++++LK G      + D+ D  K   +D  ID+++      I       ++  SSF  A +S   ++ N                + D+   DP +W+K  +     + E  +  +    R+R+Q N
Sbjct:  504 VHKILTWRWMEPPKGKDELDHTHKSTEVEKNPTGGHGRQRAPMREFFVKFRDLSYWNCEWLTELQLDVHHPILLRNYFKKNDMDEPPAPEDGSTYKGRAREKVADPHNLEERFYKWSVRPEWMQIHRIIDH----------------MTHRNNSIWYLIKWRDLAYDECTWEQLDGEYEVIDMKHLVEEYHIMRKLFTGDIYKKKFKNSSIPKEIILKKIPPEHPTTDLKKRMSKQPDYIEETGGKLHQYQLEGLNWLRFSFGNVVDTILADEMGLGKTIQTITFLYSLYKEGHSKGPFLVAAPLSTVINWEREFEFWAPDFYVVTYVGDKDSRAVVREHE-FSYEEGAMRTSKHACRMRQGTRTKFHVLLTSYELISIDQALLGSISWEVLVVDEAHRLKNNQSKFFRILSSYKINYKLLLTGTPLQNNLEELFHLLHFMTPEKFNDMQGFLDEFADISKEEQVKRLHEILGEHLLRRLKADVLTDMPSKGEFIVRVELSPMQAKFYKYILTRNFDALSVKGGGSQI-SLINIVMDLKKCCNHPYL-----------FPSGSD--------EAPKLRNGAYEGLALIKASGKLELLYKMLPKLKTGGHRVLIFSQMTRLLDILEDFMDYMGYKFERIDGAVTGQQRQDSIDRFNAPDSVSFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQSNKVMIYRFVTRNTVEERVTQVAKKKMMLTHLVVRPG--LGGKGGASMSKKELDEILKFGTEDLFKEKDENDDHKIVYDDGAIDRLIDRSQQGIEEKEDMMTDYLSSFKVAHYSKREVSVNEDDEDDDDEETRGEIIKQDLDPADPTYWEKLLRHHYEQDQEDLSKSLGKGKRIRKQVN 1350          
The following BLAST results are available for this feature:
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHD90.000e+044.40chromodomain helicase DNA binding protein 9 [Sourc... [more]
CHD90.000e+044.75chromodomain helicase DNA binding protein 9 [Sourc... [more]
CHD90.000e+044.75chromodomain helicase DNA binding protein 9 [Sourc... [more]
CHD90.000e+044.75chromodomain helicase DNA binding protein 9 [Sourc... [more]
CHD90.000e+044.75chromodomain helicase DNA binding protein 9 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd-76.562e-847.95Chromodomain and Helicase Domain protein [Source:... [more]
chd-14.288e-14439.21Chromodomain and Helicase Domain protein [Source:... [more]
chd-31.169e-12734.49Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
let-4181.579e-12741.07pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
isw-12.135e-10841.73Chromatin-remodeling complex ATPase chain isw-1 [... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kis9.975e-1957.09gene:FBgn0266557 transcript:FBtr0308254[more]
kis1.013e-2457.16gene:FBgn0266557 transcript:FBtr0299837[more]
kis7.445e-2757.09gene:FBgn0266557 transcript:FBtr0078144[more]
kis3.025e-4957.09gene:FBgn0266557 transcript:FBtr0308255[more]
kis3.852e-2557.09gene:FBgn0266557 transcript:FBtr0308253[more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd90.000e+043.50chromodomain helicase DNA binding protein 9 [Sourc... [more]
chd90.000e+043.50chromodomain helicase DNA binding protein 9 [Sourc... [more]
chd60.000e+043.32chromodomain helicase DNA binding protein 6 [Sourc... [more]
chd60.000e+043.32chromodomain helicase DNA binding protein 6 [Sourc... [more]
chd70.000e+040.76chromodomain helicase DNA binding protein 7 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd80.000e+043.61chromodomain helicase DNA binding protein 8 [Sourc... [more]
chd80.000e+043.22chromodomain helicase DNA binding protein 8 [Sourc... [more]
chd80.000e+043.22chromodomain helicase DNA binding protein 8 [Sourc... [more]
chd80.000e+043.22chromodomain helicase DNA binding protein 8 [Sourc... [more]
chd80.000e+043.74chromodomain helicase DNA binding protein 8 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chd90.000e+043.82chromodomain helicase DNA binding protein 9 [Sourc... [more]
Chd90.000e+043.82chromodomain helicase DNA binding protein 9 [Sourc... [more]
Chd90.000e+043.78chromodomain helicase DNA binding protein 9 [Sourc... [more]
Chd80.000e+042.65chromodomain helicase DNA binding protein 8 [Sourc... [more]
Chd80.000e+042.65chromodomain helicase DNA binding protein 8 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3L8U1|CHD9_HUMAN0.000e+044.75Chromodomain-helicase-DNA-binding protein 9 OS=Hom... [more]
sp|B5DE69|CHD8_XENTR0.000e+043.22Chromodomain-helicase-DNA-binding protein 8 OS=Xen... [more]
sp|Q8BYH8|CHD9_MOUSE0.000e+043.82Chromodomain-helicase-DNA-binding protein 9 OS=Mus... [more]
sp|Q9HCK8|CHD8_HUMAN0.000e+042.85Chromodomain-helicase-DNA-binding protein 8 OS=Hom... [more]
sp|Q06A37|CHD7_CHICK0.000e+043.12Chromodomain-helicase-DNA-binding protein 7 OS=Gal... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SA093.068e-1446.07Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YVD82.822e-1446.07Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3WBE13.115e-1543.16Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3T3N50.000e+047.99Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A2C9K5810.000e+043.60Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd90.000e+043.71chromodomain helicase DNA binding protein 9 [Sourc... [more]
chd90.000e+043.67chromodomain helicase DNA binding protein 9 [Sourc... [more]
chd90.000e+043.67chromodomain helicase DNA binding protein 9 [Sourc... [more]
chd70.000e+042.28chromodomain helicase DNA binding protein 7 [Sourc... [more]
chd60.000e+041.25chromodomain helicase DNA binding protein 6 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006707.10.000e+041.35pep scaffold:Pmarinus_7.0:GL476370:281119:459539:-... [more]
ENSPMAT00000006729.10.000e+054.62pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-... [more]
ENSPMAT00000004254.17.106e-13247.50pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 ge... [more]
SMARCA59.815e-11840.95SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA57.302e-11540.22SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CHD11.916e-13737.95Chromatin remodeler that regulates various aspects... [more]
ISW21.003e-11441.40ATP-dependent DNA translocase involved in chromati... [more]
ISW15.352e-10744.93ATPase subunit of imitation-switch (ISWI) class ch... [more]
STH12.059e-9639.38ATPase component of the RSC chromatin remodeling c... [more]
SNF21.175e-9337.63Catalytic subunit of the SWI/SNF chromatin remodel... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO472980.000e+046.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395851.181e-13937.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407611.039e-11042.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466695.720e-10938.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319438.156e-10139.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd90.000e+043.46chromodomain helicase DNA binding protein 9 [Sourc... [more]
chd90.000e+043.16chromodomain helicase DNA binding protein 9 [Sourc... [more]
chd80.000e+042.01chromodomain helicase DNA binding protein 8 [Sourc... [more]
chd73.129e-2746.56chromodomain helicase DNA binding protein 7 [Sourc... [more]
chd23.417e-13938.74chromodomain helicase DNA binding protein 2 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000092.10.000e+099.35SMESG000000092.1[more]
SMESG000000092.10.000e+098.77SMESG000000092.1[more]
SMESG000033395.18.599e-13238.88SMESG000033395.1[more]
SMESG000068192.16.508e-13034.15SMESG000068192.1[more]
SMESG000068192.17.369e-13034.42SMESG000068192.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013216 ID=SMED30013216|Name=Chromodomain-helicase-DNA-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=9901bp
ACGACAGTTAAAATATTAAACAAAAATAATGCATAATGGATCATGATATT
TTTTCATGTAATGTGACTTCCAGCTTTTTGGATGATTTATCTGAAATTTC
TCAAGAACCTTTAAATATTTGCAATTATAATCAGACAAACCGATTGCAGA
ATTCTAATATATATAATCGTGAACTTTGTGCATCTCAGTCTACCATGAAT
TATTATCCTGTTGCATCTACATTATCTTCTCATCCAAATTATCAGAGATC
TAACATGTATAATTATAATTTTCCAAATTATGAGTACAATTCAAATATTC
CGGACCAAAGAATGAATATGCCTTACATTCAATCCACTAATTCAGATCAT
CGTATGATGGATATGCAATATGATAGTATGAAAATAATTGAAAATGATCG
TATGAATCTTCCGCCAAATAATTATATTCCTGTTAAAAATAATATTCCAA
ACAATTACATTGATAACAAATATCAAAATTTTCAGAAATATTATTCAATA
AACAAAAATAATTTCCAACATAATCAAATGTATCGCTCATCGGAAATCCC
TAGTTCGGGCCACAACGAATCTCACTGTATGAATTATCAATATCCTCAAT
ATTTTCCAAATGGTAGTCAGTCTGTGTATTACGATCATGGAGTGTCACAT
TTTGATGAACATCAAAAAGCCGAACGTATAAATTTTCAAAACATTGCTTC
TATAGATCAAAATATATATAATTTTGAAACAAAATTACATTTCCTATCAC
AGAATTTGTCAAATAATCCCAACTGTATTCATGAAATCAATGAAATTAAA
GAAAAGTTAGTATACTTTAATCAATTAAAAGAAAAATGTTTATTATCACG
TAATAAAATGAATTTTAATTTCAAAGGAGATATAAATGAAAATAAAGACG
TAACTGCAATAAAACAGATTAATAATTACAATTCTGCCCCTAGACAGGAT
GTATATAATTCAACAAACTCAAATATGTCACCATTTTATTCACGAAACAT
CAATAAACCATATGATGGTTACATGTACAATTATATGCCAAATAACCAAC
AATATAGTGAGAAATTTGTCCAAATCGAATCATCAGAAGTCGATAAAACA
TTTCCCAACAACATTATCGACAATTCATCTCATAAATCATTTATATCGGA
ATTAACCAGCGGAGAATTTCCTCAAACATCCACGAGTAACACTAAACAGC
AGAACAATCGGGATGAATTATTTACTCCTCCGATCTCAGAATTTACAGAT
CTCACTTCAGTAATGCCATTAAAGGATTCACAAACCAAGCCAAATATCAC
CCAGACAAACGACACAAATAAAAACAATCCCCTGAAAACCGATCCAAGTG
AACTGGAAATTCACATACAATCAGTTTATCAAAATTCCGAAATCGACAAA
CCCAACACAAATGAAATCGACAATAATCTATCTGTAAAAAGTGAATTAGA
ATCTCAAATTAATTTCTCCAAATCTCTCGATAATGAGCTTAAAACCGATT
CTATGGGAATTATTGCTGATAATAACGAGGAAACAGAAGAAACAAGTAAA
AGTCCCGGCAAACCCGAATCGATATGTGATAGCATTGAAAAGAAACCCAT
CGATGAAATAGAATGCGAAATACCATCACAATCATCGTCACCATCACCAG
AAACGGTAAATGAGGCAATATCAACAGTAGTTGGAAATGATTTGAATACT
ACTAATAGTTGTCTAACAGAAATCAACGAAATTGTTCAATCGATTGATAA
TGATAATCCCGTTAGTACCGAAGCACTAATCGATACTGAAAAAGAAGCAA
ATAATGAAAATGGAACAGTAATCAATAATCTATCGAATCTAAGGGAAAAT
TTCGAGAAATTCGATATAATCACGAATACAAATACAGATGAGGATAACAT
TGGAACTAATATCGATGATGTTGATGAGGCTGATGAAAATAATGATAACA
ATGATAATAATAATAATATTGATGACGACGACAATGACGATGATGATGAT
GATAACAACAATAACGATTCGCAAGATGATGATAAGTCGCTATCAATTAA
AAATGCTGAATTAAATTCCAAGGAAATTATTGTTGAAGGCAGTGTTGAAA
ATTGTTGTGAATTGATATTATTTCATGGTGAGAAATTGTTACCGAGAATT
GATAAGAAACCTGATGCCACTACCACATCGCCGCTACCATTCAATGAAAA
CAATTCATCAATAGCAGATGCAGAGAAATCAATTTCAAAAGTACCTTTTC
AAAAATCAAATATGAAGATGTTGATGTTAAAAAAACCTAGAAACAAATTT
AAATCAATAAAAACATCTAAATGGTGTTACAAAATTAAAAAATATTATTT
TTATTTGAAATTGAAACATTTGAATCAGCAGCATTATATTAATAAAAAAT
TAAAATCCTGTCAATCTCAATCAGTAAGTAACGACGATTCGAAACAATCT
GAAGAAATCAATACAAAAAAAAGGATATTAAATAATGCTTGCAAAACTGC
AAGGCGAATGAAAAATGTTGCATCATTTTTAAAGAAAAAAAATTCCAAAG
GAAGTTATTTTAATAACTTTGATTTAGAGGAAAAGAATATATCGAAAAAA
TCCCTTCGGAATTCTACAGAATTTCATATAACAACTAGGCTTAAAAAAGA
AACCAGCTTTGAGATTGATTCAAATGAAGAAAACTCATCAAACAGTGACG
ATGAAATACATTCCATTTTTGAATTAAACTTGGAAAGTAAAAATCAAATC
GTTCAAAAAATTCTTGGTTCAAGAATTGTGAGCGTGTCTGATGGAATTGA
TGCTTCGATAAAGGCAACTGAAGAAGTGGAAGAGTATTATTTGAAATATC
GAGGCTTTTCTTATATTCATTGTGAGTGGAAATCTTCAGAATCGGTAATT
GATCCGGCATTTCCTTCAAAGTTGAAGAGATATAAAAATCTGAAAATTAA
TAATCTTGAGGAACAAGACGAATGTTTGTTTAATCCTGATTATGTGGAGA
TTGATAGGGTATTAGAGTCAAAACAAATAGAAGTTAATAAAAAATGCGAG
AATGAATTTGACTTAGATTTTGTCAATAAAGAAACAATCGTTTATTATCT
AGTAAAATGGAGAAGTTTGCCATATGAAGAAATTACTTGGGAGAAATCAG
AAGATGTTGATCCGGCTAAAGTCAAAGAATATTTGCAACGAAATTCTTAT
GCCTACACCGAAAATTCAGAGTTAATTAAGCCTACTCACAAAAATTGGAA
ACCGATAACTATGGATAGAGTGTATAAAAATGGTAACGTTCTTCGGGATT
ACCAGTTAGAAGGAGTTAATTGGTTGACATTTTGTTGGATAACAAACAGG
AATTGTATATTGGCCGATGAGATGGGTCTCGGTAAAACTATTCAGAGTAT
TGCATTTCTGATTGAGCTATTTAACTATGGATTTAAGGGTCCATTTTTGA
TAATTGTACCATTATCAACTCTAGGTAATTGGCAGAGAGAATTTGAACAA
TGGTCGAATTTAAATATTATTCTCTATCATGGATCGGCTAAAAGTCGTAA
ATTAATTCAAAAGTACGAGGCTTTCTCTCTCGACCATGAAAGTTCTCAAC
CACATAAATTACTTTTCAATGCAATTATAACAACATATGAAGTTTTATTA
TCAGATCTTTTATTTTTTTCCAAATTTCAATGGGCAGCCAGTATTATTGA
TGAAGCGCATCGATTGAAAAATAAACGGTGTAAGCTTATCGAAGGTCTAA
GAATGCTGGATCTCCAGTTTCGCGTTTTACTAACTGGTACACCGTTGCAA
AACAACGTTCAGGAACTGTTTAATTTGTTGAACTTTTTGGAATCTTCCAA
ATTTTTCTGTGAATCCGATTTCCTTTCACAGTATGGCAATTTGCGAAGTG
AAGAGCAAGTTGCCAGTTTGAAAATACTTCTTCAACCTATGATGCTTCGG
CGTCTTAAAGAAGATGTGGAGAAAAGTTTAGCACCTAAAGAGGAAATTGT
TGTTGAAGTTGAATTAACAAACATTCAAAAAAAATATTATCGAGCGATAT
TGGAACGAAATTTTACATTTCTTTCTAAAGGAGTTTCCGGAAACAACATA
CCAAATTTAATGAATACAATGATGGAGTTGCGTAAATGCTGCAATCACCC
GTTTTTAATAAAAGGTGCAGAAGAAGCCATTTTGAATAACTTTAATAGTG
GAACTGACATGGGGAATATTACAAAATTTATCCAGAATAAAATTATCGAC
GAAGAAACATTACAATTCTATTCAATGGTTTACTCTTCTGGGAAACTTGT
TCTAATTCATAAGTTATTACCCAAGCTAAAACAAGCCAGCCACAAAGTGC
TGATATTTTCACAAATGGTTCGAGTACTCGATATATTGGAAGACTATCTT
ATCTATGAAAAGTATCAATATGAAAGAATTGATGGTCGCATTCATGGTTT
ATTGCGACAAGAAGCTATTGACCGATTTACTTCGGATCCTGAGAAATTTG
TCTTCCTTCTTTGTACAAAAGCTGGTGGGCTAGGCATTAATTTAACTGCT
GCCGATGTTGTAATAATTTACGATTCTGATTGGAATCCACAAAATGACTT
GCAAGCCCAAGCTCGCTGCCATAGAATAGGTCAACAGAAATTGGTCAATG
TTTATCGGTTGATCACTCGAAATACATACGAAAGAGAAATGTTTGATAGA
GCATCTCTTAAACTGGGTTTAGATAAAGCTATTCTTCAATCTATGACTTA
TACAGAATCAAAACCGATCTCACAATTATCAAAAAAAGAAATAGAAGATT
TGTTAAAGTTAGGAGCTTATGGATCTTTAATGGACGATGATAAAGACGGT
GAAAAGTTTTGTGAAGAAGATATTGACAAAATTCTACTATCGAGATCAAC
AGTTATTCGGTTAAATAATTCTGAAAGAAATTCTTCGTTTTCAAAAGCTT
CATTTTCAATTACCGATAACAGATCTGATATTAAACTTGATGATCCGAAT
TTTTGGCAAAAATGGGCCAAGAAAGCCGGAGTTGATGAAAATGAAATTTG
CAATTCTTTAATTATGGACAAACCAAGACTTCGGCGTCAGACAAATCGAT
ATAAACCAAATTCTACTCTTTATGATGAAATAAGTGGAGATGAATCAAAT
GGATCTATTTTTGATTCTTCCAAAGCTCACTTTCATTCGAACAATAAAAA
TCTTACTTTGAATTCTAAAGTTAAAAAGAAAAATTTAAAAAGTCCCACTT
TTACTTTACCCTCTGAATCTAAAGATGCTGAAAATGATGATTCAGCTTCT
AAACACACTCAAGACATGGATCGTTACGATTTGTTTAAAGCAGAAAAATG
TTTGTTACAATTCGGATGGGGAAGATGGGAACATGCGTTGGAAAAAATAT
CATTTAAAGTTCCCATATCGGCCAAAGAATTGGAATCACTTTGTAGAACG
ATTTTACAATATGCCCATCGTCATTATTCAGGGGATGACAGAATTTATAG
TTTCATTGAAGATCTAATGTTGCCCGAATCAGATTCTAATACGATGAAAA
GACATCTTGGATATTCAGCTCCTGTTGCTCGGGGAAGAAGAGGTCGCAAA
GGATTAGAAGAAATGATATCAGCTATTACTAAAAAAGATATGATTGTTCC
GGAAAATAGAAACATTAAAAGGAACAGTGAAATATCCGAAGACGTGAATA
ATATTGATGAAGAGCAGTCGGATGTTTTCACTAACATTTCAACGCCAGTA
TCAGTAAATGGAGATAATAGTGATAATGGAAGTGAATTTTCAGCCTTGGT
TTGTCCAAACTTCAGAAGACATATTCAACGAACCAGTCATAAATTACTTC
ACAGAATCCAATTCTTGTACTTCCTTAATCATGAAATAATTGGTATCGAA
AGAGCTCAATTAATATTAAACAACACAAATTACACAGACATTCCCGGATT
TCCTGAATTAAAACTATTTACATATTTAGATAGTGATTATTTACCTTCTT
GGTGGAATACAACAGTTGATAAATGCCTTGTTCTTGGTATTTTCAAACAT
GGTTGGGAAAAATATGATGATATTTATAAAGACCCATGCTTTGGATTTGT
CAATTGGTTTTCTGGTAACAATTATCCAGTCTGTTCAGACGATGAAAAAA
ATATGAAAAAGAATAAAAATCCTTCATTTAATAAGTTAGATTCACAGGAA
ACCATGGAAATTGCTGAAAGTACAGATACTACTCAGTTAAATTCAAAAGA
TAAAAACTCAGAAATTGATAAAAAAGATGATTTCCCAACCAACGCTGAAC
TAAATATTCGACTAAGGAAAATAATAGGATCTTTTCAAAAGTTGTGGAGA
CAAAAAGAAAGTGAAAGAAACAAGATCAAAACCAATTATCAGTCATTGGA
TCCTGCTCTATTAACGCCAGAAATGAATAGTCATATGAATAATGATGGGA
AAACTGCAAAATGGTCAAGAAGAGAGGAAACTGAATTTTATAGGGCTATC
AATTCTTTTGGCATTGAAAAACACAGTGAAACGGATGAGATAATATGGAC
TAATTTTAGAAATGCCTGTAATTTGCCAAGAAAATCTAACGAATCGCTTA
CTGAATACTTTAAAGCTTTCTATACAATGTGTCAAAAAATTTGTCAGAGA
TATCCTCTTTTATATGATGATAATAATACACTTGAAGTTGAAAATATATC
AACAGAACGAGCCAATCGCTGTTTAATGAAAATAAATATCATATCCAAAA
TTAGGAATGAAATAATTGTTCATCCAGAAATTGAGAAAAGAATTAAACTT
TGTGAAAGTACAAATGATTTCCCATCGTGGTGGATTGCTGGATTTCATGA
TTTGAGTATTCTTAAAGGAATTTCTAAATATGGAGCAACTCGAACTGAGA
TAGCTATTATCAGTGATTCTAATTTGGAATTTAGACAAACAATTTTGGAT
TTACTTAGACAACAACAGCAAGCTAATAGTAAAAGTGTGTCACTGGAAGT
AAATAAAATAGCTCCAAAGAATTGTTGTAAAAAAATCGATAAAAATGAAA
ACCAAAATGAAATCATTGAAAATTGTTTAGATGAGAGTGATGCTTCGTCG
AATTTCATGTTAGAAAAAGCTGATGAATTAATTTATGAAGATACATTTAA
TAATTTAATTGTTCAAATAATAAATGAATTTATTGATCAATTAGACTCCG
TCAAAAAAGAAACCGATACCGATTATTGTGAAAATATTAGCAATAACGAC
GATATAACATTTGACATTTCCGTACTCTCCAAAATCGGCTGGCCAAAAGA
AAGGATACTTTTCTCGAGATTAGAACTAATAGTTCAAACTATTGAAAAAG
GAGAATGGCCTTTTTCTAAAAATCAAAATATACCGATTTTTGAGGAAAGC
GAAGTTCTTTCAGGTTCTTTAAAAACAAATAAAGAAGAAGTTGTTTCTTT
GTTTCAAGCTTCCGAAAATATCAAAACAGAGCCGCAACTTACTTCTTTCA
AATCGAAACGTCGAGGTCGTAAACGAACTGTTACTCAATTTATGCCCACA
CAGCAAATAAACGATATTTCCAAAACCGATCAAATAAAATTAGAAGAGCA
TTGTTTACAGGAAGAAACCAATATCCAAGCAGCATATTCATGGAATGCTG
CGTTATCTTTGTCGTTGTCGAGTGATCCAACACTTTTAATGCAAAAGATG
CTACAAATGACCCCGGAAACAAATAGTGGACATGCTTCTTCTAGCGCACC
CGGAAGCGAAAATCGAATATCAAATCCAAATAATGGATTAAATCTGTCTA
ACTTGTTTAAAGTAAAATCAACTACAAACGGTTCTTCAACGGATTCCAGT
TCATGGAATGTAAGCCAAACATCTGGAATCAAAACTAGTAAAAATAATGT
CCGAAGAGGTCGTAGACCGAAACATACTGGGCCATATGAGGTGTCAAGAG
ATTCTAAAAGAGAATCTGTATCAGGATTGAATATTTTCAACAATCGTTCT
CTTAATTCCAACTCATCAATTGAAAATTCTAACAGTAATCCAGAAACGAT
AATTCCAATTATCAATATCTTTAATGGAACTCTTATTTATGATGAAAATG
CTCCAAAAAGAAAGAATCTTGAAAGCTTTTTGATGCATAATGCAAATTAT
ATGCCCTATTCAGTGGAAGAAGAAGATCAAAAAATATTTAACAAAGTCGC
AAAAGCTCGTGGACAAGAAACAGGTCCTCTAGAGGCAATGATATTTACTC
AATATATGAATTTCATGATGAGCACAATGCTAGCTTCACAGTCTCCTTTA
AATATTTACAATTCATTTCTATTATCGGGAGAAGGATCGAAAAATAGTTT
ACCAGACGAACAAATGAATAATGCATCTTCGTTTTATATGCAACAATACC
AGGATTGTCTTCTGTCGATGCTTGGGACTAGCGGCCATTCAATGCCACCA
GGATTAGATTTTAAATCTCTAATCAACCACGAAGAACTAACTAAAGGAAA
TAAAAGACGATCAATATCCCCTATAAAAAATACTGGAATACCAACTAAAG
TCAAATCATATTCCATTAGTCATTTAACGGATGACGACAATTCCGGTAGT
CCTGAAGAAAATAGAACTCCTGCACACTCCAATTTAGCTTCAATTGTTGG
ACTTGTAGAGAAATCAGAGGATAAATTAGGTTTTTTAAATTCTAATTATA
AAATTTCCAACAGTAAACTTTCTACACCTGAAGCTGTCGGAAAATTGCAT
ATATCAAATTCCAATTCCGATATGTTGGCTTCTTATCAGGCTTATCTATA
CAGTGCTATGCTTTACTCAGACTATATCTCATCGATGCAGCAATACTCTC
TCGCTAACAATAAAATCAATAACAATATTCCAGAAATATTTAGTAATTTT
AAACAGCCGCCGCCACAACAACAACAAAATAAAGCCATTGATATAATGCA
ATCTAATAGCAATAATAACCAAGTAAATATCACACCAACTCCAAACATTC
CTATTGAGTTGACTTCTTCTTCATTATTATCATCCTCCTCATCATTATTA
TCAGCATTATCGTCGTCGTCGTCATCGTCGTTCAGTTCCAAAGCGAATAA
ACGAAATAAAGTTACAAATTTCTCCGTTGAATCGATGGGTATTGCTGCAA
CAGAGCCGTTTCCGAATATTAAAGTCGGCTCTGTGGAACAAAGTGCAACC
TCTCATATTTCATCATCACAAGACAACAATGATGATGATTATGCAGTACT
TGATCTCAGCAATAGATGAAACAATATATATGAATATATAATATATTTAT
ATATTGAACTGACATTAATTAGGAAGCATTTAGTGACTTATTCCATAAAA
CCTCACCCTGATATGGTCAATCAAATGTACTTTGTTAATTTATCCTCAAT
ATGTGTTTGCTCTAGATCATTTTATACCTTCTTTTGCATTTATTTAATAT
ACTCTCTGTATATCAATGCGCAACATATATATATACATATATATAATTAT
CGGATATACATAATGTGTGTACCGTGATTACAATGTGTTACCAATTAATT
CTGTTGATTATTTTGTATAGTTATTTATTTATTTATATTACCTTTATCGC
AGTGGCGCATTTATTTGGCCATTTATTTGTGTGCAATAATAAACCACAGG
GATTATTGTGTCTGTGAAAGAGGAGGGCAGGGAGGGGGTAGAAGGAGGAT
GAGGAGGAGTTTGAAATGAATTCGAAACTGACCTGGGAATTCAATGTACA
AATGTGAATGAATTTGAAAAAGCAATTTTAGTATTTGAACGTGAATGTGT
GTGTGTGTTGTGTGTTATTTTTAATGATTGTATTGGAATTATTTTTAATA
GCTTTATGACAAATTGGTTTCCAGGATGAAATAAATACATTTTTTTCGTG
G
back to top

protein sequence of SMED30013216-orf-1

>SMED30013216-orf-1 ID=SMED30013216-orf-1|Name=SMED30013216-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3078bp
MDHDIFSCNVTSSFLDDLSEISQEPLNICNYNQTNRLQNSNIYNRELCAS
QSTMNYYPVASTLSSHPNYQRSNMYNYNFPNYEYNSNIPDQRMNMPYIQS
TNSDHRMMDMQYDSMKIIENDRMNLPPNNYIPVKNNIPNNYIDNKYQNFQ
KYYSINKNNFQHNQMYRSSEIPSSGHNESHCMNYQYPQYFPNGSQSVYYD
HGVSHFDEHQKAERINFQNIASIDQNIYNFETKLHFLSQNLSNNPNCIHE
INEIKEKLVYFNQLKEKCLLSRNKMNFNFKGDINENKDVTAIKQINNYNS
APRQDVYNSTNSNMSPFYSRNINKPYDGYMYNYMPNNQQYSEKFVQIESS
EVDKTFPNNIIDNSSHKSFISELTSGEFPQTSTSNTKQQNNRDELFTPPI
SEFTDLTSVMPLKDSQTKPNITQTNDTNKNNPLKTDPSELEIHIQSVYQN
SEIDKPNTNEIDNNLSVKSELESQINFSKSLDNELKTDSMGIIADNNEET
EETSKSPGKPESICDSIEKKPIDEIECEIPSQSSSPSPETVNEAISTVVG
NDLNTTNSCLTEINEIVQSIDNDNPVSTEALIDTEKEANNENGTVINNLS
NLRENFEKFDIITNTNTDEDNIGTNIDDVDEADENNDNNDNNNNIDDDDN
DDDDDDNNNNDSQDDDKSLSIKNAELNSKEIIVEGSVENCCELILFHGEK
LLPRIDKKPDATTTSPLPFNENNSSIADAEKSISKVPFQKSNMKMLMLKK
PRNKFKSIKTSKWCYKIKKYYFYLKLKHLNQQHYINKKLKSCQSQSVSND
DSKQSEEINTKKRILNNACKTARRMKNVASFLKKKNSKGSYFNNFDLEEK
NISKKSLRNSTEFHITTRLKKETSFEIDSNEENSSNSDDEIHSIFELNLE
SKNQIVQKILGSRIVSVSDGIDASIKATEEVEEYYLKYRGFSYIHCEWKS
SESVIDPAFPSKLKRYKNLKINNLEEQDECLFNPDYVEIDRVLESKQIEV
NKKCENEFDLDFVNKETIVYYLVKWRSLPYEEITWEKSEDVDPAKVKEYL
QRNSYAYTENSELIKPTHKNWKPITMDRVYKNGNVLRDYQLEGVNWLTFC
WITNRNCILADEMGLGKTIQSIAFLIELFNYGFKGPFLIIVPLSTLGNWQ
REFEQWSNLNIILYHGSAKSRKLIQKYEAFSLDHESSQPHKLLFNAIITT
YEVLLSDLLFFSKFQWAASIIDEAHRLKNKRCKLIEGLRMLDLQFRVLLT
GTPLQNNVQELFNLLNFLESSKFFCESDFLSQYGNLRSEEQVASLKILLQ
PMMLRRLKEDVEKSLAPKEEIVVEVELTNIQKKYYRAILERNFTFLSKGV
SGNNIPNLMNTMMELRKCCNHPFLIKGAEEAILNNFNSGTDMGNITKFIQ
NKIIDEETLQFYSMVYSSGKLVLIHKLLPKLKQASHKVLIFSQMVRVLDI
LEDYLIYEKYQYERIDGRIHGLLRQEAIDRFTSDPEKFVFLLCTKAGGLG
INLTAADVVIIYDSDWNPQNDLQAQARCHRIGQQKLVNVYRLITRNTYER
EMFDRASLKLGLDKAILQSMTYTESKPISQLSKKEIEDLLKLGAYGSLMD
DDKDGEKFCEEDIDKILLSRSTVIRLNNSERNSSFSKASFSITDNRSDIK
LDDPNFWQKWAKKAGVDENEICNSLIMDKPRLRRQTNRYKPNSTLYDEIS
GDESNGSIFDSSKAHFHSNNKNLTLNSKVKKKNLKSPTFTLPSESKDAEN
DDSASKHTQDMDRYDLFKAEKCLLQFGWGRWEHALEKISFKVPISAKELE
SLCRTILQYAHRHYSGDDRIYSFIEDLMLPESDSNTMKRHLGYSAPVARG
RRGRKGLEEMISAITKKDMIVPENRNIKRNSEISEDVNNIDEEQSDVFTN
ISTPVSVNGDNSDNGSEFSALVCPNFRRHIQRTSHKLLHRIQFLYFLNHE
IIGIERAQLILNNTNYTDIPGFPELKLFTYLDSDYLPSWWNTTVDKCLVL
GIFKHGWEKYDDIYKDPCFGFVNWFSGNNYPVCSDDEKNMKKNKNPSFNK
LDSQETMEIAESTDTTQLNSKDKNSEIDKKDDFPTNAELNIRLRKIIGSF
QKLWRQKESERNKIKTNYQSLDPALLTPEMNSHMNNDGKTAKWSRREETE
FYRAINSFGIEKHSETDEIIWTNFRNACNLPRKSNESLTEYFKAFYTMCQ
KICQRYPLLYDDNNTLEVENISTERANRCLMKINIISKIRNEIIVHPEIE
KRIKLCESTNDFPSWWIAGFHDLSILKGISKYGATRTEIAIISDSNLEFR
QTILDLLRQQQQANSKSVSLEVNKIAPKNCCKKIDKNENQNEIIENCLDE
SDASSNFMLEKADELIYEDTFNNLIVQIINEFIDQLDSVKKETDTDYCEN
ISNNDDITFDISVLSKIGWPKERILFSRLELIVQTIEKGEWPFSKNQNIP
IFEESEVLSGSLKTNKEEVVSLFQASENIKTEPQLTSFKSKRRGRKRTVT
QFMPTQQINDISKTDQIKLEEHCLQEETNIQAAYSWNAALSLSLSSDPTL
LMQKMLQMTPETNSGHASSSAPGSENRISNPNNGLNLSNLFKVKSTTNGS
STDSSSWNVSQTSGIKTSKNNVRRGRRPKHTGPYEVSRDSKRESVSGLNI
FNNRSLNSNSSIENSNSNPETIIPIINIFNGTLIYDENAPKRKNLESFLM
HNANYMPYSVEEEDQKIFNKVAKARGQETGPLEAMIFTQYMNFMMSTMLA
SQSPLNIYNSFLLSGEGSKNSLPDEQMNNASSFYMQQYQDCLLSMLGTSG
HSMPPGLDFKSLINHEELTKGNKRRSISPIKNTGIPTKVKSYSISHLTDD
DNSGSPEENRTPAHSNLASIVGLVEKSEDKLGFLNSNYKISNSKLSTPEA
VGKLHISNSNSDMLASYQAYLYSAMLYSDYISSMQQYSLANNKINNNIPE
IFSNFKQPPPQQQQNKAIDIMQSNSNNNQVNITPTPNIPIELTSSSLLSS
SSSLLSALSSSSSSSFSSKANKRNKVTNFSVESMGIAATEPFPNIKVGSV
EQSATSHISSSQDNNDDDYAVLDLSNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016817hydrolase activity, acting on acid anhydrides
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR038718SNF2-like_sf
IPR037259BRK_sf
IPR001650Helicase_C
IPR000953Chromo/chromo_shadow_dom
IPR014001Helicase_ATP-bd
IPR023780Chromo_domain
IPR000330SNF2_N
IPR027417P-loop_NTPase
IPR016197Chromo-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 1449..1532
e-value: 1.3E-23
score: 94.5
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 1420..1532
e-value: 1.6E-17
score: 63.9
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 1423..1590
score: 19.108
IPR000953Chromo/chromo shadow domainSMARTSM00298chromo_7coord: 985..1054
e-value: 1.3E-6
score: 38.0
coord: 902..971
e-value: 3.3E-7
score: 40.0
IPR000953Chromo/chromo shadow domainPROSITEPS50013CHROMO_2coord: 987..1062
score: 10.313
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 1082..1283
e-value: 1.9E-35
score: 133.8
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 1098..1271
score: 22.424
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 1080..1315
e-value: 3.9E-191
score: 637.4
IPR023780Chromo domainPFAMPF00385Chromocoord: 904..968
e-value: 3.3E-6
score: 26.9
coord: 988..1052
e-value: 5.9E-8
score: 32.5
NoneNo IPR availableGENE3DG3DSA:2.40.50.40coord: 900..973
e-value: 1.0E-7
score: 33.9
NoneNo IPR availableGENE3DG3DSA:2.40.50.40coord: 978..1053
e-value: 1.5E-20
score: 74.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1316..1563
e-value: 3.9E-191
score: 637.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1736..1758
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 413..431
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..394
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 488..513
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 622..653
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2596..2641
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2060..2081
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3049..3078
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2596..2619
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2559..2582
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 413..437
NoneNo IPR availablePANTHERPTHR45623:SF11KISMET, ISOFORM Ccoord: 795..2687
NoneNo IPR availablePANTHERPTHR45623FAMILY NOT NAMEDcoord: 795..2687
NoneNo IPR availableCDDcd17995DEXHc_CHD6_7_8_9coord: 1086..1306
e-value: 1.27955E-108
score: 343.847
NoneNo IPR availableCDDcd18668CD1_tandem_CHD5-9_likecoord: 900..968
e-value: 7.73259E-16
score: 72.3693
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 1418..1543
e-value: 2.64051E-59
score: 198.855
NoneNo IPR availableCDDcd18663CD2_tandem_CHD5-9_likecoord: 984..1053
e-value: 8.24112E-24
score: 94.6633
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 1103..1374
e-value: 1.6E-54
score: 184.9
IPR037259BRK domain superfamilyGENE3DG3DSA:2.20.28.130coord: 2665..2709
e-value: 6.1E-6
score: 27.8
IPR037259BRK domain superfamilySUPERFAMILYSSF160481BRK domain-likecoord: 2664..2708
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1308..1616
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1051..1306
IPR016197Chromo-like domain superfamilySUPERFAMILYSSF54160Chromo domain-likecoord: 972..1053
IPR016197Chromo-like domain superfamilySUPERFAMILYSSF54160Chromo domain-likecoord: 898..968