Histone H2A

Overview
NameHistone H2A
Smed IDSMED30013212
Length (bp)787
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H2A (SMED30013212) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H2A (SMED30013212) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H2A (SMED30013212) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H2A (SMED30013212) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013212

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013212SMESG000015784.1 SmedASXL_004713SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013212SMESG000015784.1 SmedASXL_004713SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013212SMESG000015784.1 dd_Smed_v4_469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013212SMESG000015784.1 Contig49719newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013212SMESG000015784.1 Contig49719uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30013212SMESG000015784.1 dd_Smed_v6_469_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC20 (H2A clustered histone 20 [Source:HGNC Symbol;Acc:HGNC:4738])

HSP 1 Score: 135.961 bits (341), Expect = 7.531e-40
Identity = 69/129 (53.49%), Postives = 91/129 (70.54%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATK 483
            MSGRGK   +   K ++++ +AGL  PV R+ R L+KG YA+R+ AGA VYM+AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E+  A +K
Sbjct:    1 MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK 129          
BLAST of Histone H2A vs. Ensembl Human
Match: MACROH2A1 (macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:4740])

HSP 1 Score: 135.961 bits (341), Expect = 2.416e-39
Identity = 72/123 (58.54%), Postives = 87/123 (70.73%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQ---KAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MS RG      G K+ TKT    KAG++ PV R+ RY+KKG    RI  GA VYM+AV+EYL AE+ EL+GNAA+ NK+  +TPRHI+L V ND ELN+LLK V I+SGGVLP IHP LL KK
Sbjct:    1 MSSRG------GKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK 117          
BLAST of Histone H2A vs. Ensembl Human
Match: MACROH2A2 (macroH2A.2 histone [Source:HGNC Symbol;Acc:HGNC:14453])

HSP 1 Score: 141.354 bits (355), Expect = 3.779e-39
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MSGR   +K     + +++ +AG++ PV RL RYLKKG +  RIS GA VYM+AVIEYL AE+ EL+GNAA+ NK+  I PRHI+L V ND ELN+LLK V I+SGGVLP IHP LL KK
Sbjct:    1 MSGRSGKKKM---SKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKK 117          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC14 (H2A clustered histone 14 [Source:HGNC Symbol;Acc:HGNC:4727])

HSP 1 Score: 133.65 bits (335), Expect = 5.442e-39
Identity = 67/123 (54.47%), Postives = 88/123 (71.54%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGET 465
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E+
Sbjct:    1 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTES 123          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC11 (H2A clustered histone 11 [Source:HGNC Symbol;Acc:HGNC:4737])

HSP 1 Score: 133.65 bits (335), Expect = 5.657e-39
Identity = 67/123 (54.47%), Postives = 88/123 (71.54%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGET 465
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E+
Sbjct:    1 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTES 123          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 125.946 bits (315), Expect = 1.977e-36
Identity = 62/104 (59.62%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            +++ +AGL  PV RL R L+KG YAQR+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKK 121          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 125.946 bits (315), Expect = 1.977e-36
Identity = 62/104 (59.62%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            +++ +AGL  PV RL R L+KG YAQR+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKK 121          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-68 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 125.946 bits (315), Expect = 2.225e-36
Identity = 62/104 (59.62%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            +++ +AGL  PV RL R L+KG YAQR+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKK 121          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-65 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 125.946 bits (315), Expect = 2.225e-36
Identity = 62/104 (59.62%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            +++ +AGL  PV RL R L+KG YAQR+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKK 121          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-61 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 125.946 bits (315), Expect = 2.225e-36
Identity = 62/104 (59.62%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            +++ +AGL  PV RL R L+KG YAQR+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKK 121          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33853 (gene:FBgn0053853 transcript:FBtr0091857)

HSP 1 Score: 124.405 bits (311), Expect = 9.100e-36
Identity = 60/106 (56.60%), Postives = 78/106 (73.58%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            +++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33859 (gene:FBgn0053859 transcript:FBtr0091863)

HSP 1 Score: 124.405 bits (311), Expect = 9.100e-36
Identity = 60/106 (56.60%), Postives = 78/106 (73.58%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            +++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33856 (gene:FBgn0053856 transcript:FBtr0091860)

HSP 1 Score: 124.405 bits (311), Expect = 9.100e-36
Identity = 60/106 (56.60%), Postives = 78/106 (73.58%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            +++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33850 (gene:FBgn0053850 transcript:FBtr0091854)

HSP 1 Score: 124.02 bits (310), Expect = 1.430e-35
Identity = 60/106 (56.60%), Postives = 78/106 (73.58%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            +++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33847 (gene:FBgn0053847 transcript:FBtr0091851)

HSP 1 Score: 124.02 bits (310), Expect = 1.430e-35
Identity = 60/106 (56.60%), Postives = 78/106 (73.58%), Query Frame = 1
Query:  145 TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            +++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: hist1h2a10 (histone cluster 1 H2A family member 10 [Source:ZFIN;Acc:ZDB-GENE-131127-92])

HSP 1 Score: 135.961 bits (341), Expect = 5.178e-40
Identity = 69/122 (56.56%), Postives = 87/122 (71.31%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: hist1h2a10 (histone cluster 1 H2A family member 10 [Source:ZFIN;Acc:ZDB-GENE-131127-92])

HSP 1 Score: 135.961 bits (341), Expect = 5.178e-40
Identity = 69/122 (56.56%), Postives = 87/122 (71.31%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: hist1h2a5 (histone cluster 1 H2A family member 5 [Source:ZFIN;Acc:ZDB-GENE-131121-77])

HSP 1 Score: 135.961 bits (341), Expect = 5.524e-40
Identity = 69/122 (56.56%), Postives = 87/122 (71.31%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:    1 MSGRGKTGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: FP236630.1 (histone cluster 1 H2A family member 9 [Source:NCBI gene;Acc:100334621])

HSP 1 Score: 135.961 bits (341), Expect = 5.584e-40
Identity = 69/122 (56.56%), Postives = 87/122 (71.31%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: CU459186.5 (si:dkey-23a13.6 [Source:NCBI gene;Acc:103908687])

HSP 1 Score: 135.961 bits (341), Expect = 5.584e-40
Identity = 69/122 (56.56%), Postives = 87/122 (71.31%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000000447.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:124390910:124391717:1 gene:ENSXETG00000000090.1 transcript:ENSXETT00000000447.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 3.162e-41
Identity = 72/132 (54.55%), Postives = 92/132 (69.70%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQAS 492
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E+T AA    S
Sbjct:    1 MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAAKSNGS 132          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000010097.1 (H2A.X variant histone [Source:NCBI gene;Acc:100487455])

HSP 1 Score: 139.813 bits (351), Expect = 3.506e-41
Identity = 72/133 (54.14%), Postives = 95/133 (71.43%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETT-PAATKQAS 492
            MSGRGKA  +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK  +T P + K++S
Sbjct:    1 MSGRGKAVSKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKSSSTAPTSGKKSS 133          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000031617.1 (histone H2A type 1-like [Source:NCBI gene;Acc:100486008])

HSP 1 Score: 139.043 bits (349), Expect = 4.625e-41
Identity = 71/127 (55.91%), Postives = 91/127 (71.65%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAA 477
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E++ AA
Sbjct:    1 MSGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKAESSKAA 127          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: hist1h2ah (histone H2A type 1-like [Source:NCBI gene;Acc:108644455])

HSP 1 Score: 139.043 bits (349), Expect = 4.989e-41
Identity = 71/127 (55.91%), Postives = 91/127 (71.65%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAA 477
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E+T AA
Sbjct:    1 MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAA 127          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: hist1h2ah (histone H2A type 1-like [Source:NCBI gene;Acc:108644455])

HSP 1 Score: 139.043 bits (349), Expect = 4.989e-41
Identity = 71/127 (55.91%), Postives = 91/127 (71.65%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAA 477
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E+T AA
Sbjct:    1 MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAA 127          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac20 (H2A clustered histone 20 [Source:MGI Symbol;Acc:MGI:2448316])

HSP 1 Score: 135.961 bits (341), Expect = 5.170e-40
Identity = 69/129 (53.49%), Postives = 91/129 (70.54%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATK 483
            MSGRGK   +   K ++++ +AGL  PV R+ R L+KG YA+R+ AGA VYM+AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK E+  A +K
Sbjct:    1 MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK 129          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ax (H2A.X variant histone [Source:MGI Symbol;Acc:MGI:102688])

HSP 1 Score: 135.576 bits (340), Expect = 1.152e-39
Identity = 71/137 (51.82%), Postives = 93/137 (67.88%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETT-----PAATKQAS 492
            MSGRGK   +   K ++++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK   T     PA  K+AS
Sbjct:    1 MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKAS 137          
BLAST of Histone H2A vs. Ensembl Mouse
Match: Macroh2a2 (macroH2A.2 histone [Source:MGI Symbol;Acc:MGI:3037658])

HSP 1 Score: 141.354 bits (355), Expect = 2.622e-39
Identity = 71/120 (59.17%), Postives = 88/120 (73.33%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MSGR   +K     + +++ +AG++ PV RL RYLKKG +  RIS GA VYM+AVIEYL AE+ EL+GNAA+ NK+  I PRHI+L V ND ELN+LLK V I+SGGVLP IHP LL KK
Sbjct:    1 MSGRSGKKKM---SKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKK 117          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac21 (H2A clustered histone 21 [Source:MGI Symbol;Acc:MGI:2448314])

HSP 1 Score: 134.035 bits (336), Expect = 3.412e-39
Identity = 68/123 (55.28%), Postives = 88/123 (71.54%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGET 465
            MSGRGK   +   K ++++ +AGL  PV R+ R L+KG YA+R+ AGA VYM+AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E+
Sbjct:    1 MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTES 123          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac15 (H2A clustered histone 15 [Source:MGI Symbol;Acc:MGI:2448297])

HSP 1 Score: 134.035 bits (336), Expect = 3.640e-39
Identity = 67/123 (54.47%), Postives = 88/123 (71.54%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGET 465
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG Y++R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK ET
Sbjct:    1 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTET 123          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P16866|H2A4_VOLCA (Histone H2A-IV OS=Volvox carteri OX=3067 PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.384e-41
Identity = 73/120 (60.83%), Postives = 90/120 (75.00%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            M+GRGK  K  G K  +++ KAGL  PV R+ RYLKKG+YA+RI AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRHI L +RND EL +LL +V I+SGGVLP IH  LL KK
Sbjct:    1 MAGRGKG-KTAGKKAVSRSSKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVPRHIQLAIRNDEELGKLLGDVTIASGGVLPNIHAVLLPKK 119          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P16865|H2A3_VOLCA (Histone H2A-III OS=Volvox carteri OX=3067 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.853e-41
Identity = 73/120 (60.83%), Postives = 90/120 (75.00%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            M+GRGK  K  G K  +++ KAGL  PV R+ RYLKKG+YA+RI AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRHI L +RND EL +LL +V I+SGGVLP IH  LL KK
Sbjct:    1 MAGRGKG-KTAGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVPRHIQLAIRNDEELGKLLGDVTIASGGVLPNIHAVLLPKK 119          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P50567|H2A_CHLRE (Histone H2A OS=Chlamydomonas reinhardtii OX=3055 GN=H2A-II PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 4.450e-41
Identity = 73/120 (60.83%), Postives = 89/120 (74.17%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            M+GRGK  K  G K  +++ KAGL  PV R+ RYLKKG+YA+RI AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRHI L +RND EL +LL  V I+SGGVLP IH  LL KK
Sbjct:    1 MAGRGKG-KTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVPRHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKK 119          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P40282|H2A_PLAFA (Histone H2A OS=Plasmodium falciparum OX=5833 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.275e-41
Identity = 70/130 (53.85%), Postives = 89/130 (68.46%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQ 486
            MS +GK  ++   K  + + KAGL  PV R+ RYLKKG+YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  ITPRHI L VRND ELN+ L  V  +SGGVLP IH  LL KK +       Q
Sbjct:    1 MSAKGKTGRKKASKGTSNSAKAGLQFPVGRIGRYLKKGKYAKRVGAGAPVYLAAVLEYLCAEILELAGNAARDNKKSRITPRHIQLAVRNDEELNKFLAGVTFASGGVLPNIHNVLLPKKSQLKAGTANQ 130          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q74ZL4|H2A1_ASHGO (Histone H2A.1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=HTA1 PE=3 SV=3)

HSP 1 Score: 139.428 bits (350), Expect = 1.949e-40
Identity = 69/130 (53.08%), Postives = 90/130 (69.23%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQ 486
            MSG+G          Q+++ KAGL  PV R+ R L+KG YAQRI +GA VYM+AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL NV I+ GGVLP IH +LL KK      A+++
Sbjct:    1 MSGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQRIGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHANLLPKKSAKATKASQE 130          
BLAST of Histone H2A vs. TrEMBL
Match: A0A5J4NM66 (Histone H2A OS=Paragonimus westermani OX=34504 GN=DEA37_0007305 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.288e-66
Identity = 104/136 (76.47%), Postives = 118/136 (86.76%), Query Frame = 1
Query:   94 IMSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQAS*NV 501
            +MSGRGKARK  GGK+ TK+ +AGLVMPVSR+ RYLKKGRYA+R S  A+VYMSAVIEYLVAEVNELSGNAAKANKR+TITPRHIMLGVRNDAELNELLK+VHIS GGVLPCIHP+LLK+KG    + T  +  N+
Sbjct:    1 MMSGRGKARKPAGGKKHTKSTRAGLVMPVSRVHRYLKKGRYARRTSIAASVYMSAVIEYLVAEVNELSGNAAKANKRKTITPRHIMLGVRNDAELNELLKHVHISHGGVLPCIHPTLLKRKGGIIGSPTGPSGPNI 136          
BLAST of Histone H2A vs. TrEMBL
Match: G7YSB8 (Histone H2A OS=Clonorchis sinensis OX=79923 GN=CLF_109178 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.254e-65
Identity = 102/121 (84.30%), Postives = 112/121 (92.56%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKG 459
            MSGRGKARK  GGK+ TK+ +AGLVMPVSR+ RYLKKGRYA+R S  A+VYMSAVIEYLVAEVNELSGNAAKANKR+TITPRHIMLGVRNDAELNELLK+VHIS GGVLPCIHP+LLK+KG
Sbjct:    1 MSGRGKARKAAGGKKHTKSNRAGLVMPVSRVHRYLKKGRYARRTSIAASVYMSAVIEYLVAEVNELSGNAAKANKRKTITPRHIMLGVRNDAELNELLKHVHISHGGVLPCIHPTLLKRKG 121          
BLAST of Histone H2A vs. TrEMBL
Match: A0A4S2LSX8 (Histone H2A OS=Opisthorchis felineus OX=147828 GN=CRM22_005065 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.268e-65
Identity = 102/121 (84.30%), Postives = 112/121 (92.56%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKG 459
            MSGRGKARK  GGK+ TK+ +AGLVMPVSR+ RYLKKGRYA+R S  A+VYMSAVIEYLVAEVNELSGNAAKANKR+TITPRHIMLGVRNDAELNELLK+VHIS GGVLPCIHP+LLK+KG
Sbjct:    1 MSGRGKARKAAGGKKHTKSNRAGLVMPVSRVHRYLKKGRYARRTSIAASVYMSAVIEYLVAEVNELSGNAAKANKRKTITPRHIMLGVRNDAELNELLKHVHISHGGVLPCIHPTLLKRKG 121          
BLAST of Histone H2A vs. TrEMBL
Match: A0A074ZL78 (Histone H2A OS=Opisthorchis viverrini OX=6198 GN=T265_08152 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.268e-65
Identity = 102/121 (84.30%), Postives = 112/121 (92.56%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKG 459
            MSGRGKARK  GGK+ TK+ +AGLVMPVSR+ RYLKKGRYA+R S  A+VYMSAVIEYLVAEVNELSGNAAKANKR+TITPRHIMLGVRNDAELNELLK+VHIS GGVLPCIHP+LLK+KG
Sbjct:    1 MSGRGKARKAAGGKKHTKSNRAGLVMPVSRVHRYLKKGRYARRTSIAASVYMSAVIEYLVAEVNELSGNAAKANKRKTITPRHIMLGVRNDAELNELLKHVHISHGGVLPCIHPTLLKRKG 121          
BLAST of Histone H2A vs. TrEMBL
Match: A0A0R3SBB2 (Histone H2A OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1741 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 4.695e-65
Identity = 103/127 (81.10%), Postives = 113/127 (88.98%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKG--ETTP 471
            MSGRGKARK  GGK+ TK+ +AGLVMPVSR+ RYLK GRYA+R S  A+VY+SAVIEYLVAEVNELSGNAAKANKR+TITPRHIMLGVRNDAELNELLKNVHIS GGVLPCIHPSLLK+K   +T P
Sbjct:    1 MSGRGKARKPAGGKKHTKSARAGLVMPVSRVHRYLKMGRYARRTSTAASVYLSAVIEYLVAEVNELSGNAAKANKRKTITPRHIMLGVRNDAELNELLKNVHISHGGVLPCIHPSLLKRKSYPDTIP 127          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000026274.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10145526:10150789:1 gene:ENSAMXG00000025549.2 transcript:ENSAMXT00000026274.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.42 bits (337), Expect = 2.405e-39
Identity = 68/122 (55.74%), Postives = 87/122 (71.31%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE 122          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: h2ax (H2A.X variant histone [Source:NCBI gene;Acc:394048])

HSP 1 Score: 133.65 bits (335), Expect = 4.011e-39
Identity = 67/120 (55.83%), Postives = 86/120 (71.67%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK
Sbjct:    1 MSGRGKTGGKARAKSKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000025558.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19464785:19465983:-1 gene:ENSAMXG00000024832.2 transcript:ENSAMXT00000025558.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 7.076e-39
Identity = 70/123 (56.91%), Postives = 86/123 (69.92%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQ---TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MSGRGK        R+   +++ +AGL  PV R+ R LKKG YA R+  GAAVY++AV+EYL AEV EL+GNA++ NK+R I+PRHI L VRND ELN LL +V IS GGVLP I   LL KK
Sbjct:    1 MSGRGKKVGAAASNRKATVSRSTRAGLQFPVGRVARLLKKGNYAPRVGTGAAVYLAAVLEYLSAEVLELAGNASRDNKKRRISPRHIQLAVRNDEELNALLSSVTISEGGVLPNIQAQLLPKK 123          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000038524.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:20241840:20244700:1 gene:ENSAMXG00000039576.1 transcript:ENSAMXT00000038524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 3.895e-38
Identity = 71/132 (53.79%), Postives = 88/132 (66.67%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQ---TKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATK 483
            MSGRGK       KR+   +++ +AGL  PV R+ R LKKG YA R+  GAAVY+++V+EYL AEV EL+GNA++ NK+  I PRHI L VRND ELN LL +V IS GGVLP I   LL KK +  P   K
Sbjct:    1 MSGRGKKVGAAASKRKATVSRSTRAGLQFPVGRVARLLKKGNYAPRVGTGAAVYLASVLEYLSAEVLELAGNASRDNKKHRIAPRHIQLAVRNDEELNALLGSVTISEGGVLPNIQAQLLPKKTKIKPFKIK 132          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: macroh2a1 (core histone macro-H2A.1 [Source:NCBI gene;Acc:103035252])

HSP 1 Score: 133.65 bits (335), Expect = 6.304e-37
Identity = 66/120 (55.00%), Postives = 87/120 (72.50%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MS RG  +K     + +++ KAG++ PV R+ RY+K+G    RI  GA VYM+AV+EYL AE+ EL+GNAA+ NK+  +TPRHI+L V ND ELN+LLK V I++GGVLP IHP LL KK
Sbjct:    1 MSSRGGKKKS---TKTSRSTKAGVIFPVGRMLRYIKRGLPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIAAGGVLPNIHPELLAKK 117          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005338.1 (pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-1 gene:ENSPMAG00000004859.1 transcript:ENSPMAT00000005338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 2.712e-39
Identity = 68/130 (52.31%), Postives = 89/130 (68.46%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQ 486
            MSGRGK   +   K ++++ +AGL  PV R+ R L+KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+L+  V I+ GGVLP I   LL KK      A K+
Sbjct:    1 MSGRGKTGGKSRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKKTSQAKNALKK 130          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002388.1 (pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1 gene:ENSPMAG00000002177.1 transcript:ENSPMAT00000002388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 3.329e-39
Identity = 69/130 (53.08%), Postives = 90/130 (69.23%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLL-KKKGETTPAATK 483
            MSGRGK   +   K ++++ +AGL  PV R+ R L+KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+L+  V I+ GGVLP I   LL KK  +  P A K
Sbjct:    1 MSGRGKTGGKSRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKKTSQNHPLACK 130          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011253.1 (pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-1 gene:ENSPMAG00000010226.1 transcript:ENSPMAT00000011253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.954 bits (328), Expect = 1.289e-38
Identity = 65/120 (54.17%), Postives = 86/120 (71.67%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MSGRGK   +   K ++++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I   LL KK
Sbjct:    1 MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011166.1 (pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088:1 gene:ENSPMAG00000010139.1 transcript:ENSPMAT00000011166.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 2.124e-38
Identity = 66/120 (55.00%), Postives = 85/120 (70.83%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MSGRGK   +   K ++++ +AGL  PV R+ R L KG YAQR+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+L+  V I+ GGVLP I   LL KK
Sbjct:    1 MSGRGKTGGKSRAKAKSRSSRAGLQFPVGRVHRLLCKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011165.1 (pep scaffold:Pmarinus_7.0:GL476820:1017376:1017756:1 gene:ENSPMAG00000010138.1 transcript:ENSPMAT00000011165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.413 bits (324), Expect = 2.579e-38
Identity = 65/120 (54.17%), Postives = 85/120 (70.83%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MSGRGK   +   K ++++ +AGL  PV R+ R L+KG YAQR+ AG  VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+L+  V I+ GGVLP I   LL KK
Sbjct:    1 MSGRGKTGGKSRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVVAGTPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTA2 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical (see also HTA1) subtypes; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p [Source:SGD;Acc:S000000099])

HSP 1 Score: 134.806 bits (338), Expect = 1.932e-40
Identity = 64/115 (55.65%), Postives = 86/115 (74.78%), Query Frame = 1
Query:  142 QTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQ 486
            Q+++ KAGL  PV R+ R L++G YAQRI +GA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL NV I+ GGVLP IH +LL KK   T  A+++
Sbjct:   17 QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKTAKASQE 131          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTA1 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical subtypes (see also HTA2); DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p; N-terminally propionylated in vivo [Source:SGD;Acc:S000002633])

HSP 1 Score: 132.494 bits (332), Expect = 1.222e-39
Identity = 63/115 (54.78%), Postives = 85/115 (73.91%), Query Frame = 1
Query:  142 QTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQ 486
            Q+++ KAGL  PV R+ R L++G YAQRI +GA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L +RND ELN+LL NV I+ GGVLP IH +LL KK      A+++
Sbjct:   17 QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATKASQE 131          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTZ1 (Histone variant H2AZ; exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin; Htz1p-containing nucleosomes facilitate RNA Pol II passage by affecting correct assembly and modification status of RNA Pol II elongation complexes and by favoring efficient nucleosome remodeling [Source:SGD;Acc:S000005372])

HSP 1 Score: 98.9821 bits (245), Expect = 1.486e-26
Identity = 54/102 (52.94%), Postives = 74/102 (72.55%), Query Frame = 1
Query:  157 KAGLVMPVSRLQRYLKK---GRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKK 453
            +AGL  PV R++RYLK+   GR   R+ + AA+Y++AV+EYL AEV EL+GNAAK  K + ITPRH+ L +R D EL+ L++   I+SGGVLP I+ +LL K
Sbjct:   28 RAGLQFPVGRIKRYLKRHATGR--TRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRAT-IASGGVLPHINKALLLK 126          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO27651 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7T8N1])

HSP 1 Score: 140.198 bits (352), Expect = 3.218e-42
Identity = 73/127 (57.48%), Postives = 90/127 (70.87%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAA 477
            MSGRGK  K  G K +T++ +AGL  PV R+ R+L+KG YA+R+ AGA VYM+AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN LL  V I+ GGVLP I   LL KK E  P A
Sbjct:    1 MSGRGKG-KAKGTKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKKTEKKPKA 126          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO27766 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5])

HSP 1 Score: 138.272 bits (347), Expect = 1.818e-41
Identity = 71/122 (58.20%), Postives = 89/122 (72.95%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK  K  G K +T++ +AGL  PV R+ R+L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN LL  V I+ GGVLP I  SLL KK E
Sbjct:    1 MSGRGKG-KAKGTKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO27764 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5])

HSP 1 Score: 138.272 bits (347), Expect = 1.818e-41
Identity = 71/122 (58.20%), Postives = 89/122 (72.95%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK  K  G K +T++ +AGL  PV R+ R+L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN LL  V I+ GGVLP I  SLL KK E
Sbjct:    1 MSGRGKG-KAKGTKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO37980 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5])

HSP 1 Score: 138.272 bits (347), Expect = 1.818e-41
Identity = 71/122 (58.20%), Postives = 89/122 (72.95%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK  K  G K +T++ +AGL  PV R+ R+L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN LL  V I+ GGVLP I  SLL KK E
Sbjct:    1 MSGRGKG-KAKGTKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO28365 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5])

HSP 1 Score: 138.272 bits (347), Expect = 1.818e-41
Identity = 71/122 (58.20%), Postives = 89/122 (72.95%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MSGRGK  K  G K +T++ +AGL  PV R+ R+L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN LL  V I+ GGVLP I  SLL KK E
Sbjct:    1 MSGRGKG-KAKGTKSKTRSSRAGLQFPVGRIHRHLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKKTE 121          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000027984.1 (pep primary_assembly:ASM223467v1:1:8921530:8926502:-1 gene:ENSORLG00000030081.1 transcript:ENSORLT00000027984.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 4.261e-41
Identity = 73/130 (56.15%), Postives = 92/130 (70.77%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQ 486
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E  PA TKQ
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE-KPAKTKQ 129          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000034627.1 (pep primary_assembly:ASM223467v1:1:1239146:1240518:-1 gene:ENSORLG00000022956.1 transcript:ENSORLT00000034627.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 1.695e-40
Identity = 72/130 (55.38%), Postives = 92/130 (70.77%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQ 486
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E  PA TK+
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTE-KPAKTKK 129          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000042751.1 (pep primary_assembly:ASM223467v1:1:3319702:3323229:-1 gene:ENSORLG00000023254.1 transcript:ENSORLT00000042751.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 3.359e-40
Identity = 71/132 (53.79%), Postives = 90/132 (68.18%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQAS 492
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E      K AS
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPKTTGKNAS 132          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000001657.2 (pep primary_assembly:ASM223467v1:1:2123146:2150212:1 gene:ENSORLG00000028923.1 transcript:ENSORLT00000001657.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 4.159e-40
Identity = 72/130 (55.38%), Postives = 91/130 (70.00%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGET-TPAATK 483
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E   PA TK
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPKPAKTK 130          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000000855.2 (pep primary_assembly:ASM223467v1:14:2847578:2851345:1 gene:ENSORLG00000000693.2 transcript:ENSORLT00000000855.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 5.751e-40
Identity = 70/129 (54.26%), Postives = 90/129 (69.77%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATK 483
            MSGRGK   +   K +T++ +AGL  PV R+ R L+KG YA R+ AGA VY++AV+EYL AE+ EL+GNAA+ NK+  I PRH+ L VRND ELN+LL  V I+ GGVLP I   LL KK E T + +K
Sbjct:    1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAVRVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKSRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKTKSGSK 129          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000015784.1 (SMESG000015784.1)

HSP 1 Score: 267.7 bits (683), Expect = 6.741e-92
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQAS 492
            MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQAS
Sbjct:    1 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPAATKQAS 132          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 134.806 bits (338), Expect = 7.365e-40
Identity = 67/122 (54.92%), Postives = 88/122 (72.13%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MS +GKA K    + +T++ +AGL  PV R+ R L+KG +A+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I  SLL KK E
Sbjct:    1 MSAKGKAGKTTKSQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKKAE 122          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000067932.1 (SMESG000067932.1)

HSP 1 Score: 134.806 bits (338), Expect = 9.382e-40
Identity = 69/127 (54.33%), Postives = 91/127 (71.65%), Query Frame = 1
Query:   97 MSGR-GKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGETTPA 474
            MSG+ GKA K    + +T++ +AGL  PV R+ R L+KG +A+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V IS GGV+P I  +LL KK E  PA
Sbjct:    1 MSGKAGKAGKTSRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPA 127          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 134.806 bits (338), Expect = 1.014e-39
Identity = 67/122 (54.92%), Postives = 88/122 (72.13%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKKGE 462
            MS +GKA K    + +T++ +AGL  PV R+ R L+KG +A+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL  V I+ GGVLP I  SLL KK E
Sbjct:    1 MSAKGKAGKTTKSQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKKAE 122          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000018807.1 (SMESG000018807.1)

HSP 1 Score: 129.413 bits (324), Expect = 1.193e-37
Identity = 67/120 (55.83%), Postives = 87/120 (72.50%), Query Frame = 1
Query:   97 MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAVYMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKNVHISSGGVLPCIHPSLLKKK 456
            MSGRGK  K    K ++++ +AGL  PV R+ R L+KG YA+R+ AGA VY++AV+EYL AEV EL+GNAA+ NK+  I PRH+ L +RND ELN+LL +V I+ GGVLP I   LL KK
Sbjct:    1 MSGRGKGGKSRN-KAKSRSVRAGLQFPVGRIHRMLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGSVTIAQGGVLPNIQSVLLPKK 119          
The following BLAST results are available for this feature:
BLAST of Histone H2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AC207.531e-4053.49H2A clustered histone 20 [Source:HGNC Symbol;Acc:H... [more]
MACROH2A12.416e-3958.54macroH2A.1 histone [Source:HGNC Symbol;Acc:HGNC:47... [more]
MACROH2A23.779e-3959.17macroH2A.2 histone [Source:HGNC Symbol;Acc:HGNC:14... [more]
H2AC145.442e-3954.47H2A clustered histone 14 [Source:HGNC Symbol;Acc:H... [more]
H2AC115.657e-3954.47H2A clustered histone 11 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Histone H2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-351.977e-3659.62Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-351.977e-3659.62Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-682.225e-3659.62Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
his-652.225e-3659.62Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
his-612.225e-3659.62Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
back to top
BLAST of Histone H2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His2A:CG338539.100e-3656.60gene:FBgn0053853 transcript:FBtr0091857[more]
His2A:CG338599.100e-3656.60gene:FBgn0053859 transcript:FBtr0091863[more]
His2A:CG338569.100e-3656.60gene:FBgn0053856 transcript:FBtr0091860[more]
His2A:CG338501.430e-3556.60gene:FBgn0053850 transcript:FBtr0091854[more]
His2A:CG338471.430e-3556.60gene:FBgn0053847 transcript:FBtr0091851[more]
back to top
BLAST of Histone H2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hist1h2a105.178e-4056.56histone cluster 1 H2A family member 10 [Source:ZFI... [more]
hist1h2a105.178e-4056.56histone cluster 1 H2A family member 10 [Source:ZFI... [more]
hist1h2a55.524e-4056.56histone cluster 1 H2A family member 5 [Source:ZFIN... [more]
FP236630.15.584e-4056.56histone cluster 1 H2A family member 9 [Source:NCBI... [more]
CU459186.55.584e-4056.56si:dkey-23a13.6 [Source:NCBI gene;Acc:103908687][more]
back to top
BLAST of Histone H2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000000447.13.162e-4154.55pep primary_assembly:Xenopus_tropicalis_v9.1:3:124... [more]
ENSXETT00000010097.13.506e-4154.14H2A.X variant histone [Source:NCBI gene;Acc:100487... [more]
ENSXETT00000031617.14.625e-4155.91histone H2A type 1-like [Source:NCBI gene;Acc:1004... [more]
hist1h2ah4.989e-4155.91histone H2A type 1-like [Source:NCBI gene;Acc:1086... [more]
hist1h2ah4.989e-4155.91histone H2A type 1-like [Source:NCBI gene;Acc:1086... [more]
back to top
BLAST of Histone H2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2ac205.170e-4053.49H2A clustered histone 20 [Source:MGI Symbol;Acc:MG... [more]
H2ax1.152e-3951.82H2A.X variant histone [Source:MGI Symbol;Acc:MGI:1... [more]
Macroh2a22.622e-3959.17macroH2A.2 histone [Source:MGI Symbol;Acc:MGI:3037... [more]
H2ac213.412e-3955.28H2A clustered histone 21 [Source:MGI Symbol;Acc:MG... [more]
H2ac153.640e-3954.47H2A clustered histone 15 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Histone H2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16866|H2A4_VOLCA1.384e-4160.83Histone H2A-IV OS=Volvox carteri OX=3067 PE=3 SV=1[more]
sp|P16865|H2A3_VOLCA1.853e-4160.83Histone H2A-III OS=Volvox carteri OX=3067 PE=3 SV=... [more]
sp|P50567|H2A_CHLRE4.450e-4160.83Histone H2A OS=Chlamydomonas reinhardtii OX=3055 G... [more]
sp|P40282|H2A_PLAFA7.275e-4153.85Histone H2A OS=Plasmodium falciparum OX=5833 PE=2 ... [more]
sp|Q74ZL4|H2A1_ASHGO1.949e-4053.08Histone H2A.1 OS=Ashbya gossypii (strain ATCC 1089... [more]
back to top
BLAST of Histone H2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NM662.288e-6676.47Histone H2A OS=Paragonimus westermani OX=34504 GN=... [more]
G7YSB81.254e-6584.30Histone H2A OS=Clonorchis sinensis OX=79923 GN=CLF... [more]
A0A4S2LSX81.268e-6584.30Histone H2A OS=Opisthorchis felineus OX=147828 GN=... [more]
A0A074ZL781.268e-6584.30Histone H2A OS=Opisthorchis viverrini OX=6198 GN=T... [more]
A0A0R3SBB24.695e-6581.10Histone H2A OS=Hymenolepis diminuta OX=6216 GN=HDI... [more]
back to top
BLAST of Histone H2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000026274.22.405e-3955.74pep primary_assembly:Astyanax_mexicanus-2.0:21:101... [more]
h2ax4.011e-3955.83H2A.X variant histone [Source:NCBI gene;Acc:394048... [more]
ENSAMXT00000025558.27.076e-3956.91pep primary_assembly:Astyanax_mexicanus-2.0:12:194... [more]
ENSAMXT00000038524.13.895e-3853.79pep primary_assembly:Astyanax_mexicanus-2.0:12:202... [more]
macroh2a16.304e-3755.00core histone macro-H2A.1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005338.12.712e-3952.31pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-... [more]
ENSPMAT00000002388.13.329e-3953.08pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1... [more]
ENSPMAT00000011253.11.289e-3854.17pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-... [more]
ENSPMAT00000011166.12.124e-3855.00pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088... [more]
ENSPMAT00000011165.12.579e-3854.17pep scaffold:Pmarinus_7.0:GL476820:1017376:1017756... [more]
back to top
BLAST of Histone H2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HTA21.932e-4055.65Histone H2A; core histone protein required for chr... [more]
HTA11.222e-3954.78Histone H2A; core histone protein required for chr... [more]
HTZ11.486e-2652.94Histone variant H2AZ; exchanged for histone H2A in... [more]
back to top
BLAST of Histone H2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO276513.218e-4257.48Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7T8N1][more]
EDO277661.818e-4158.20Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5][more]
EDO277641.818e-4158.20Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5][more]
EDO379801.818e-4158.20Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5][more]
EDO283651.818e-4158.20Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5][more]
back to top
BLAST of Histone H2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027984.14.261e-4156.15pep primary_assembly:ASM223467v1:1:8921530:8926502... [more]
ENSORLT00000034627.11.695e-4055.38pep primary_assembly:ASM223467v1:1:1239146:1240518... [more]
ENSORLT00000042751.13.359e-4053.79pep primary_assembly:ASM223467v1:1:3319702:3323229... [more]
ENSORLT00000001657.24.159e-4055.38pep primary_assembly:ASM223467v1:1:2123146:2150212... [more]
ENSORLT00000000855.25.751e-4054.26pep primary_assembly:ASM223467v1:14:2847578:285134... [more]
back to top
BLAST of Histone H2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015784.16.741e-92100.00SMESG000015784.1[more]
SMESG000006040.17.365e-4054.92SMESG000006040.1[more]
SMESG000067932.19.382e-4054.33SMESG000067932.1[more]
SMESG000006040.11.014e-3954.92SMESG000006040.1[more]
SMESG000018807.11.193e-3755.83SMESG000018807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013212 ID=SMED30013212|Name=Histone H2A|organism=Schmidtea mediterranea sexual|type=transcript|length=787bp
ATTTCTTTATAAAATTTTAATATTTTATAGTTTTGTTTTACTTTATCCAG
TAGCCATTTTGTTTCGTGTTAGTAATAAATTTATAATAAATTTATTATGT
CTGGAAGAGGAAAAGCACGTAAACAACCTGGAGGTAAGCGCCAGACGAAA
ACTCAAAAGGCTGGCTTAGTTATGCCTGTAAGTAGATTACAAAGATATCT
TAAAAAAGGACGTTATGCTCAAAGAATATCTGCAGGAGCGGCAGTTTATA
TGTCAGCTGTTATTGAATATTTGGTTGCTGAAGTAAACGAATTGTCAGGT
AACGCTGCTAAAGCAAACAAAAGACGTACCATTACTCCTCGCCATATAAT
GTTAGGTGTGAGGAATGATGCAGAATTAAATGAGTTATTAAAGAATGTAC
ATATTAGCTCAGGTGGTGTCCTTCCGTGCATTCACCCATCTTTGTTAAAA
AAGAAAGGTGAAACAACGCCTGCTGCAACTAAGCAAGCATCTTAAAACGT
TTAAGATGTTATAAAGTTTTTATGTCGATGTATTTTGTTGTTTCATTGTA
TATTTTATACACCATAGCTCGTTAGTAATGTTTGGATATTTTTTAACTGT
ATGTTGGAATAATTATGGAATTAATAATTTTGATTAAATAAATTAATATG
TTTGTTTATTAATATTATAAATGATTAGGGATGTTATAATTATTCAATTG
CCTTGTCTTATATTAAATGTTGTGATTATGTGTAAAAAAATTTTGTAATA
CTGAATATTTTGTTATTTTTTATAAATTACAAAAAGT
back to top

protein sequence of SMED30013212-orf-1

>SMED30013212-orf-1 ID=SMED30013212-orf-1|Name=SMED30013212-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=133bp
MSGRGKARKQPGGKRQTKTQKAGLVMPVSRLQRYLKKGRYAQRISAGAAV
YMSAVIEYLVAEVNELSGNAAKANKRRTITPRHIMLGVRNDAELNELLKN
VHISSGGVLPCIHPSLLKKKGETTPAATKQAS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR002119Histone_H2A
IPR009072Histone-fold
IPR032454Histone_H2A_C
IPR007125Histone_H2A/H2B/H3
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0005694chromosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002119Histone H2APRINTSPR00620HISTONEH2Acoord: 14..36
score: 43.69
coord: 43..58
score: 62.2
coord: 58..71
score: 73.2
coord: 86..98
score: 65.64
coord: 100..118
score: 53.73
IPR002119Histone H2ASMARTSM00414h2a4coord: 3..123
e-value: 6.4E-56
score: 201.8
IPR002119Histone H2ACDDcd00074H2Acoord: 6..120
e-value: 3.78997E-53
score: 161.349
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 1..128
e-value: 4.2E-52
score: 177.4
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 5..121
IPR032454Histone H2A, C-terminal domainPFAMPF16211Histone_H2A_Ccoord: 93..123
e-value: 1.8E-13
score: 49.9
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 11..89
e-value: 1.7E-14
score: 54.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
NoneNo IPR availablePANTHERPTHR23430:SF20CORE HISTONE MACRO-H2A.1coord: 1..125
NoneNo IPR availablePANTHERPTHR23430HISTONE H2Acoord: 1..125